Advanced Search (OLGA)

Gene: Otud3 (OTU deubiquitinase 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Otud3

Name:

OTU deubiquitinase 3

RGD ID:

1560468

Description:

Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in cellular response to nutrient levels; protein deubiquitination; and protein stabilization. Predicted to act upstream of or within negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction and protein deubiquitination. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Orthologous to human OTUD3 (OTU deubiquitinase 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC500572; OTU domain containing 3; OTU domain-containing protein 3; RGD1560468; similar to novel protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OTUD3 (OTU deubiquitinase 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Otud3 (OTU domain containing 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Otud3 (OTU deubiquitinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OTUD3 (OTU deubiquitinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OTUD3 (OTU deubiquitinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Otud3 (OTU deubiquitinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OTUD3 (OTU deubiquitinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OTUD3 (OTU deubiquitinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Otud3 (OTU deubiquitinase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CPEB1 (cytoplasmic polyadenylation element binding protein 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	OTUD3 (OTU deubiquitinase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Otud3 (OTU domain containing 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	otud3 (OTU deubiquitinase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	otud3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	plcxd2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	156,419,099 - 156,445,341 (-)	NCBI		GRCr8
mRatBN7.2	5	151,135,826 - 151,162,207 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,140,059 - 151,163,560 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	153,837,429 - 153,859,585 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,611,737 - 155,633,893 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,593,646 - 155,615,802 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,346,286 - 157,368,450 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,346,286 - 157,368,472 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	161,086,486 - 161,108,351 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	157,718,629 - 157,741,095 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	149,525,815 - 149,547,300 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud3	Rat	3-hydroxy-3-methylglutaryl-CoA lyase deficiency		ISO	OTUD3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of hydroxymethylglutaryl-CoA lyase	ClinVar	PMID:28492532
Otud3	Rat	chromosome 1p36 deletion syndrome		ISO	OTUD3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 1p36 deletion syndrome	ClinVar
Otud3	Rat	congenital disorder of glycosylation Ir		ISO	OTUD3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation type Ir	ClinVar	PMID:28492532
Otud3	Rat	hyperprolinemia type 2		ISO	OTUD3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hyperprolinemia type 2	ClinVar	PMID:28492532
Otud3	Rat	Parkinson's disease 6		ISO	OTUD3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive early-onset Parkinson disease 6	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud3	Rat	2,2',4,4'-Tetrabromodiphenyl ether	multiple interactions	ISO	Otud3 (Mus musculus)	6480464	[Flame Retardants results in increased abundance of 2 more ...	CTD	PMID:38995820
Otud3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	OTUD3 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of OTUD3 mRNA	CTD	PMID:21296121
Otud3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of OTUD3 mRNA	CTD	PMID:22298810
Otud3	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	Otud3 (Mus musculus)	6480464	bisphenol S affects the expression of OTUD3 mRNA	CTD	PMID:39298647
Otud3	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of OTUD3 mRNA	CTD	PMID:24780913
Otud3	Rat	acrolein	multiple interactions	ISO	OTUD3 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of OTUD3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of OTUD3 mRNA	CTD	PMID:32699268
Otud3	Rat	aflatoxin B1	affects expression	ISO	OTUD3 (Homo sapiens)	6480464	Aflatoxin B1 affects the expression of OTUD3 protein	CTD	PMID:20106945
Otud3	Rat	aflatoxin B1	decreases expression	EXP		6480464	Aflatoxin B1 results in decreased expression of OTUD3 mRNA	CTD	PMID:33354967
Otud3	Rat	alpha-pinene	multiple interactions	ISO	OTUD3 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of OTUD3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of OTUD3 mRNA	CTD	PMID:32699268
Otud3	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of OTUD3 mRNA	CTD	PMID:25181051
Otud3	Rat	bisphenol A	decreases expression	ISO	Otud3 (Mus musculus)	6480464	bisphenol A results in decreased expression of OTUD3 mRNA	CTD	PMID:33221593
Otud3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of OTUD3 mRNA	CTD	PMID:34947998
Otud3	Rat	bisphenol A	increases expression	ISO	Otud3 (Mus musculus)	6480464	bisphenol A results in increased expression of OTUD3 mRNA	CTD	PMID:25594700
Otud3	Rat	carbon nanotube	increases expression	ISO	Otud3 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Otud3	Rat	chromium(6+)	affects expression	ISO	Otud3 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of OTUD3 mRNA	CTD	PMID:28472532
Otud3	Rat	cisplatin	decreases expression	ISO	OTUD3 (Homo sapiens)	6480464	Cisplatin results in decreased expression of OTUD3 mRNA	CTD	PMID:27594783
Otud3	Rat	dioxygen	multiple interactions	ISO	Otud3 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of OTUD3 mRNA	CTD	PMID:30529165
Otud3	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of OTUD3 mRNA	CTD	PMID:29391264
Otud3	Rat	FR900359	increases phosphorylation	ISO	OTUD3 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of OTUD3 protein	CTD	PMID:37730182
Otud3	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of OTUD3 mRNA	CTD	PMID:33387578
Otud3	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of OTUD3 gene	CTD	PMID:35440735
Otud3	Rat	methyl methanesulfonate	increases expression	ISO	OTUD3 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of OTUD3 mRNA	CTD	PMID:23649840
Otud3	Rat	methylparaben	increases expression	ISO	OTUD3 (Homo sapiens)	6480464	methylparaben results in increased expression of OTUD3 mRNA	CTD	PMID:31745603
Otud3	Rat	ozone	multiple interactions	ISO	OTUD3 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of OTUD3 mRNA more ...	CTD	PMID:32699268
Otud3	Rat	paracetamol	affects expression	ISO	Otud3 (Mus musculus)	6480464	Acetaminophen affects the expression of OTUD3 mRNA	CTD	PMID:17562736
Otud3	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of OTUD3 mRNA	CTD	PMID:33387578
Otud3	Rat	paracetamol	increases expression	ISO	OTUD3 (Homo sapiens)	6480464	Acetaminophen results in increased expression of OTUD3 mRNA	CTD	PMID:21420995 and PMID:29067470
Otud3	Rat	pirinixic acid	multiple interactions	ISO	OTUD3 (Homo sapiens)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of OTUD3 mRNA	CTD	PMID:19710929
Otud3	Rat	pirinixic acid	increases expression	ISO	Otud3 (Mus musculus)	6480464	pirinixic acid results in increased expression of OTUD3 mRNA	CTD	PMID:23811191
Otud3	Rat	raloxifene	decreases expression	ISO	Otud3 (Mus musculus)	6480464	Raloxifene Hydrochloride results in decreased expression of OTUD3 mRNA	CTD	PMID:33269387
Otud3	Rat	raloxifene	multiple interactions	ISO	Otud3 (Mus musculus)	6480464	[SOD1 protein mutant form affects the susceptibility to Raloxifene Hydrochloride] which results in decreased expression of OTUD3 mRNA	CTD	PMID:33269387
Otud3	Rat	resveratrol	multiple interactions	ISO	OTUD3 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of OTUD3 mRNA	CTD	PMID:23557933
Otud3	Rat	sodium arsenate	decreases expression	ISO	Otud3 (Mus musculus)	6480464	sodium arsenate results in decreased expression of OTUD3 mRNA	CTD	PMID:30953684
Otud3	Rat	sodium arsenite	increases expression	ISO	OTUD3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of OTUD3 mRNA	CTD	PMID:38568856
Otud3	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of OTUD3 mRNA	CTD	PMID:23411599 and PMID:34492290
Otud3	Rat	titanium dioxide	decreases expression	ISO	Otud3 (Mus musculus)	6480464	titanium dioxide results in decreased expression of OTUD3 mRNA	CTD	PMID:29264374
Otud3	Rat	titanium dioxide	decreases methylation	ISO	Otud3 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of OTUD3 gene	CTD	PMID:35295148
Otud3	Rat	triphenyl phosphate	affects expression	ISO	OTUD3 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of OTUD3 mRNA	CTD	PMID:37042841
Otud3	Rat	urethane	increases expression	ISO	OTUD3 (Homo sapiens)	6480464	Urethane results in increased expression of OTUD3 mRNA	CTD	PMID:28818685
Otud3	Rat	valproic acid	increases expression	ISO	OTUD3 (Homo sapiens)	6480464	Valproic Acid results in increased expression of OTUD3 mRNA	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud3	Rat	cellular response to nutrient levels	involved_in	ISO	OTUD3 (Homo sapiens)	1624291	PMID:35675826	RGD	PMID:35675826
Otud3	Rat	negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	acts_upstream_of_or_within	ISO	OTUD3 (Homo sapiens)	1624291	PMID:26280536	RGD	PMID:26280536
Otud3	Rat	protein deubiquitination	involved_in	ISO	OTUD3 (Homo sapiens)	1624291	PMID:32011234	RGD	PMID:32011234
Otud3	Rat	protein K11-linked deubiquitination	acts_upstream_of_or_within	ISO	OTUD3 (Homo sapiens)	1624291	PMID:26280536	RGD	PMID:26280536
Otud3	Rat	protein K11-linked deubiquitination	involved_in	ISO	OTUD3 (Homo sapiens)	1624291	PMID:23827681	RGD	PMID:23827681
Otud3	Rat	protein K27-linked deubiquitination	acts_upstream_of_or_within	ISO	OTUD3 (Homo sapiens)	1624291	PMID:26280536	RGD	PMID:26280536
Otud3	Rat	protein K48-linked deubiquitination	acts_upstream_of_or_within	ISO	OTUD3 (Homo sapiens)	1624291	PMID:26280536	RGD	PMID:26280536
Otud3	Rat	protein K48-linked deubiquitination	involved_in	ISO	OTUD3 (Homo sapiens)	1624291	PMID:35675826	RGD	PMID:35675826
Otud3	Rat	protein K6-linked deubiquitination	involved_in	ISO	OTUD3 (Homo sapiens)	1624291	PMID:23827681	RGD	PMID:23827681
Otud3	Rat	protein K6-linked deubiquitination	acts_upstream_of_or_within	ISO	OTUD3 (Homo sapiens)	1624291	PMID:26280536	RGD	PMID:26280536
Otud3	Rat	protein stabilization	acts_upstream_of_or_within	ISO	OTUD3 (Homo sapiens)	1624291	PMID:26280536	RGD	PMID:26280536
Otud3	Rat	protein stabilization	involved_in	IBA	PANTHER:PTN002646079 and UniProtKB:Q5T2D3	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Otud3	Rat	protein stabilization	involved_in	ISO	OTUD3 (Homo sapiens)	1624291	PMID:35675826	RGD	PMID:35675826

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud3	Rat	cytoplasm	located_in	ISO	OTUD3 (Homo sapiens)	1624291	PMID:26280536	RGD	PMID:26280536
Otud3	Rat	nucleus	is_active_in	ISO	OTUD3 (Homo sapiens)	1624291	PMID:35675826	RGD	PMID:35675826

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud3	Rat	cysteine-type deubiquitinase activity	enables	ISO	OTUD3 (Homo sapiens)	1624291	PMID:23827681 more ...	RGD	PMID:23827681 more ...
Otud3	Rat	cysteine-type deubiquitinase activity	enables	IEA	EC:3.4.19.12	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Otud3	Rat	cysteine-type deubiquitinase activity	enables	IBA	FB:FBgn0026738 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Otud3	Rat	cysteine-type peptidase activity	enables	IEA	UniProtKB-KW:KW-0788	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Otud3	Rat	protein binding	enables	ISO	Otud3 (Mus musculus)	1624291	UniProtKB:O08586 and PMID:26280536	RGD	PMID:26280536
Otud3	Rat	protein binding	enables	ISO	OTUD3 (Homo sapiens)	1624291	UniProtKB:P60484-1 more ...	RGD	PMID:26280536 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:23827681	PMID:26280536

Otud3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	156,419,099 - 156,445,341 (-)	NCBI		GRCr8
mRatBN7.2	5	151,135,826 - 151,162,207 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,140,059 - 151,163,560 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	153,837,429 - 153,859,585 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,611,737 - 155,633,893 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,593,646 - 155,615,802 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,346,286 - 157,368,450 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,346,286 - 157,368,472 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	161,086,486 - 161,108,351 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	157,718,629 - 157,741,095 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	149,525,815 - 149,547,300 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

OTUD3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	19,882,395 - 19,912,945 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	19,882,395 - 19,912,945 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	20,208,888 - 20,239,438 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	20,081,475 - 20,112,025 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	18,535,727 - 18,566,275 (+)	NCBI		Celera
Cytogenetic Map	1	p36.13	NCBI
HuRef	1	18,454,515 - 18,485,063 (+)	NCBI		HuRef
CHM1_1	1	20,318,433 - 20,348,979 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	19,705,780 - 19,736,328 (+)	NCBI		T2T-CHM13v2.0

Otud3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	138,618,374 - 138,641,322 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	138,622,690 - 138,641,256 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	138,891,063 - 138,914,026 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	138,895,379 - 138,913,945 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	138,451,294 - 138,469,862 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	138,167,028 - 138,194,561 (-)	NCBI		MGSCv36	mm8
Celera	4	140,681,791 - 140,700,203 (-)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	70.57	NCBI

Otud3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	487,994 - 516,217 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	488,295 - 516,162 (+)	NCBI	ChiLan1.0	ChiLan1.0

OTUD3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	207,206,462 - 207,238,251 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	206,323,313 - 206,355,107 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	18,836,697 - 18,867,568 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	19,888,492 - 19,911,040 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	19,880,667 - 19,905,857 (+)	Ensembl	panpan1.1		panPan2

OTUD3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	78,843,627 - 78,875,215 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	78,847,177 - 78,875,121 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	75,357,183 - 75,388,674 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	79,410,480 - 79,441,987 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	79,415,377 - 79,442,142 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	76,229,387 - 76,260,582 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	77,236,287 - 77,267,770 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	78,307,247 - 78,338,718 (-)	NCBI		UU_Cfam_GSD_1.0

Otud3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	40,169,259 - 40,182,347 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	5,994,076 - 6,011,799 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	5,994,019 - 6,010,101 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OTUD3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	78,241,624 - 78,273,539 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	78,241,604 - 78,273,544 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

OTUD3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	112,642,979 - 112,673,435 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	112,648,143 - 112,672,819 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	3,507,292 - 3,537,289 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Otud3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	4,949,975 - 4,976,067 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	4,950,727 - 4,979,856 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Otud3
266 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	133
Count of miRNA genes:	107
Interacting mature miRNAs:	118
Transcripts:	ENSRNOT00000023143
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	151113452	164465185	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat

BI289834

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,140,251 - 151,140,341 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,346,479 - 157,346,568	NCBI	Rnor6.0
Rnor_5.0	5	161,086,679 - 161,086,768	UniSTS	Rnor5.0
RGSC_v3.4	5	157,718,822 - 157,718,911	UniSTS	RGSC3.4
Celera	5	149,526,008 - 149,526,097	UniSTS
RH 3.4 Map	5	1033.2	UniSTS
Cytogenetic Map	5	q36	UniSTS

BI290083

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,151,948 - 151,152,149 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,358,328 - 157,358,528	NCBI	Rnor6.0
Rnor_5.0	5	161,098,229 - 161,098,429	UniSTS	Rnor5.0
RGSC_v3.4	5	157,731,090 - 157,731,290	UniSTS	RGSC3.4
Celera	5	149,537,798 - 149,537,998	UniSTS
RH 3.4 Map	5	1033.5	UniSTS
Cytogenetic Map	5	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001191983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110631	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC118094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023143 ⟹ ENSRNOP00000023143

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	151,140,059 - 151,163,560 (-)	Ensembl
Rnor_6.0 Ensembl	5	157,346,286 - 157,368,450 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079855 ⟹ ENSRNOP00000071051

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	157,347,102 - 157,368,472 (-)	Ensembl

RefSeq Acc Id:

NM_001191983 ⟹ NP_001178912

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	156,423,332 - 156,445,341 (-)	NCBI
mRatBN7.2	5	151,140,059 - 151,162,071 (-)	NCBI
Rnor_6.0	5	157,346,286 - 157,368,450 (-)	NCBI
Rnor_5.0	5	161,086,486 - 161,108,351 (-)	NCBI
Celera	5	149,525,815 - 149,547,300 (-)	NCBI

Sequence:

show sequence

ATGTCCCGAAAGCAAGCGGCGAAGAGCCGGCCGGGCAGCGGCGGCCGCAGAGCCGAGGCGGAGCGCAAGCGGGACGAGCGGGCAGCGCGCCGGGCGCTGGCCAAGGAGCGGCGGAACCGGCCGGAGCC
TGGCAGCAGCGGCTGCGAAGAAGAGTTTGTGAGCTTCGCCAACCAACTGCAGGCCCTGGGACTGAAGCTGCGGGAGGTGCCGGGGGACGGCAATTGCCTGTTCAGAGCGCTGGGCGACCAGTTGGAGG
GCCATTCTCGGAACCATCTGAAGCACCGACAGGAGACCGTGGACTACATGATAAGGCAGCGTGAAGATTTTGAGCCCTTTGTGGAAGATGACATCCCCTTTGAGAAGCATGTGGCCAGTTTGGCAAAG
CCTGGTACTTTTGCTGGCAATGATGCAATTGTAGCGTTTGCAAGAAACCATCAGTTGAATGTGGTGATCCATCAACTTAATGCCCCTTTGTGGCAGATTCGAGGCACAGACAAGAGCAGCGCGAGGGA
GCTCCACATCGCCTACCGGTACGGGGAACACTATGACAGCGTCCGGAGGATCAATGACAACTCAGAAGCGCCAGCTCATCTCCTAACTGACTTCCAGATGCTTCATCAAGATAGAACAAATAAAAAAG
AGAAAATGAAGACACAAGGGGACAGTCTGAGAGATGACATGGAAGATGCTGTCCAGAAAGCTGGCAGTGCAACTGGATGCACGGATTCTAACTTAATAGTCCAGAACCTGGAAGCTGAGAGTCACACT
ATCGAGCCTTCAGTAACCGCCCTGCTTCAGATGAACCAGGGGACAAGCAAGGATGCGGAGAAGAGCCTTGAGCCTGGTGACAGAGTGAAGCAGCGTGGCCCTTCGTGTGAGGAGGCAGGCGGCGGCTC
CAGACTCTCTGGAAATCAGGGCAGAAACGAAGGCAGAGTGGAGACCAGTGAGGCTCGGGCCAGCCCTGGTGAAGAGAGCAGAGCGCGTAAGAAGAGCCAGTGCCCGAAGGTCACAAACAAGCAGCGGA
GGGAACAACAGCGGCTGGAGAAGAAGAAGCGTCAGGAGGAGAGGCACCGCCTCAAAGCCCTGGAGAACAGAAATGGCAGCAGAGACCGGGGCAGAGAAGCAGACGTGAACACGCAGGTCACCTTGGTG
AAGACCTTCGCTGCTCTGAACATCTGACTCTCGCACCCGAGAGCTGAACGATGCACATTGCAGACAAGGCTTCCCAGCCACGTGTCCCCTGAGGATGAGACAACTGTCAGCACCCACACACGAGCCCG
AGGAGCCAGTGTCCTTCAAGCTGCCTCTTTCTCTCCTGTGCTCTGTTGTGTGAGAGTGTGGTGACACCATTCACCTTCTGGAACTCAAACAAAATACTAAGTCATAGGTGGGTCATGGGGCCAGGAGG
CTTCGCTTGCCCTGCGAATCAGAGTGTGGTGGCTCTAGGCTCTTCCCTTGATGCGTGAGGGGGGTTCCTTGTAATAATTCTTGAAGTCGTTAGCACAATCATTAGACATCTTCATGACAA

hide sequence

RefSeq Acc Id:

XM_039110628 ⟹ XP_038966556

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	156,419,099 - 156,445,277 (-)	NCBI
mRatBN7.2	5	151,135,826 - 151,162,030 (-)	NCBI

RefSeq Acc Id:

XM_039110630 ⟹ XP_038966558

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	156,419,099 - 156,445,277 (-)	NCBI
mRatBN7.2	5	151,135,826 - 151,162,007 (-)	NCBI

RefSeq Acc Id:

XM_039110631 ⟹ XP_038966559

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	156,419,099 - 156,445,277 (-)	NCBI
mRatBN7.2	5	151,135,826 - 151,162,007 (-)	NCBI


Protein RefSeqs	NP_001178912	(Get FASTA)	NCBI Sequence Viewer
	XP_038966556	(Get FASTA)	NCBI Sequence Viewer
	XP_038966558	(Get FASTA)	NCBI Sequence Viewer
	XP_038966559	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL80894	(Get FASTA)	NCBI Sequence Viewer
	EDL80895	(Get FASTA)	NCBI Sequence Viewer
	EDL80896	(Get FASTA)	NCBI Sequence Viewer
	EDL80897	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023143
	ENSRNOP00000023143.5

RefSeq Acc Id:

NP_001178912 ⟸ NM_001191983

- UniProtKB:

D4A7M3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRKQAAKSRPGSGGRRAEAERKRDERAARRALAKERRNRPEPGSSGCEEEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIRQREDFEPFVEDDIPFEKHVASLAK
PGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRGTDKSSARELHIAYRYGEHYDSVRRINDNSEAPAHLLTDFQMLHQDRTNKKEKMKTQGDSLRDDMEDAVQKAGSATGCTDSNLIVQNLEAESHT
IEPSVTALLQMNQGTSKDAEKSLEPGDRVKQRGPSCEEAGGGSRLSGNQGRNEGRVETSEARASPGEESRARKKSQCPKVTNKQRREQQRLEKKKRQEERHRLKALENRNGSRDRGREADVNTQVTLV
KTFAALNI

hide sequence

Ensembl Acc Id:

ENSRNOP00000071051 ⟸ ENSRNOT00000079855

Ensembl Acc Id:

ENSRNOP00000023143 ⟸ ENSRNOT00000023143

RefSeq Acc Id:	XP_038966556 ⟸ XM_039110628
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038966559 ⟸ XM_039110631
- Peptide Label:	isoform X3

Protein Domains

OTU

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A7M3-F1-model_v2	AlphaFold	D4A7M3	1-392	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694201

Promoter ID:

EPDNEW_R4720

Type:

initiation region

Name:

Otud3_1

Description:

OTU deubiquitinase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	157,368,548 - 157,368,608	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-39435	BioCyc
Ensembl Genes	ENSRNOG00000017037	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023143	ENTREZGENE
	ENSRNOT00000023143.8	UniProtKB/TrEMBL
Gene3D-CATH	3.90.70.80	UniProtKB/TrEMBL
InterPro	OTU	UniProtKB/TrEMBL
	OTU_ubiquitin_thioesterase	UniProtKB/TrEMBL
	Papain_like_cys_pep_sf	UniProtKB/TrEMBL
KEGG Report	rno:500572	UniProtKB/TrEMBL
NCBI Gene	500572	ENTREZGENE
PANTHER	OTU DOMAIN CONTAINING PROTEIN	UniProtKB/TrEMBL
	OTU DOMAIN-CONTAINING PROTEIN 3	UniProtKB/TrEMBL
Pfam	OTU	UniProtKB/TrEMBL
PhenoGen	Otud3	PhenoGen
PROSITE	OTU	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017037	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/TrEMBL
UniProt	D4A7M3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-03-13	Otud3	OTU deubiquitinase 3	Otud3	OTU domain containing 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-28	Otud3	OTU domain containing 3	RGD1560468_predicted	similar to novel protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1560468_predicted	similar to novel protein (predicted)	LOC500572	similar to novel protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500572	similar to novel protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar