Symbol:
Usp9x
Name:
ubiquitin specific peptidase 9, X-linked
RGD ID:
1560056
Description:
Predicted to enable several functions, including co-SMAD binding activity; deubiquitinase activity; and ubiquitin protein ligase binding activity. Predicted to be involved in several processes, including DNA alkylation repair; protein deubiquitination; and transforming growth factor beta receptor superfamily signaling pathway. Predicted to act upstream of or within several processes, including cellular response to transforming growth factor beta stimulus; in utero embryonic development; and nervous system development. Predicted to be located in apical part of cell; cilium; and growth cone. Predicted to be active in several cellular components, including centrosome; cytosol; and postsynapse. Human ortholog(s) of this gene implicated in female-restricted syndromic X-linked intellectual disability 99 and non-syndromic X-linked intellectual disability 99. Orthologous to human USP9X (ubiquitin specific peptidase 9 X-linked); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC363445; probable ubiquitin carboxyl-terminal hydrolase FAF-X; RGD1560056; similar to ubiquitin specific protease 9, X-linked (fat facets-like, Drosophila); ubiquitin specific peptidase 9, X chromosome
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
USP9X (ubiquitin specific peptidase 9 X-linked) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Usp9x (ubiquitin specific peptidase 9, X chromosome) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Usp9x (ubiquitin specific peptidase 9 X-linked) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
USP9X (ubiquitin specific peptidase 9 X-linked) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
USP9X (ubiquitin specific peptidase 9 X-linked) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp9x (ubiquitin specific peptidase 9 X-linked) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
USP9X (ubiquitin specific peptidase 9 X-linked) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
USP9X (ubiquitin specific peptidase 9 X-linked) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Usp9x (ubiquitin specific peptidase 9 X-linked) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
USP9Y (ubiquitin specific peptidase 9 Y-linked) HGNC
OrthoDB, Panther
Alliance orthologs 3
Mus musculus (house mouse):
Usp9x (ubiquitin specific peptidase 9, X chromosome)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
USP9X (ubiquitin specific peptidase 9 X-linked)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp9 (ubiquitin specific peptidase 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T24B8.7
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
faf
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
usp9x
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 12,261,633 - 12,399,780 (-) NCBI GRCr8 mRatBN7.2 X 9,588,825 - 9,726,993 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 9,588,825 - 9,696,711 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 9,772,936 - 9,880,483 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 13,270,083 - 13,377,627 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 9,539,867 - 9,647,608 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 10,510,033 - 10,660,555 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 10,510,033 - 10,630,297 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 11,308,415 - 11,458,704 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 21,606,330 - 21,718,042 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 10,119,391 - 10,226,802 (-) NCBI Celera Cytogenetic Map X q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp9x Rat (-)-epigallocatechin 3-gallate multiple interactions ISO USP9X (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of USP9X mRNA CTD PMID:22079256 Usp9x Rat (1->4)-beta-D-glucan multiple interactions ISO Usp9x (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP9X mRNA CTD PMID:36331819 Usp9x Rat 1,2-dimethylhydrazine decreases expression ISO Usp9x (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP9X mRNA CTD PMID:22206623 Usp9x Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of USP9X mRNA CTD PMID:29097150 Usp9x Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of USP9X mRNA CTD PMID:32145629 Usp9x Rat 17beta-estradiol increases expression ISO Usp9x (Mus musculus) 6480464 Estradiol results in increased expression of USP9X mRNA CTD PMID:39298647 Usp9x Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO USP9X (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Usp9x Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Usp9x (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Usp9x Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp9x (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP9X mRNA CTD PMID:21570461 Usp9x Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP9X mRNA CTD PMID:34747641 Usp9x Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP9X mRNA CTD PMID:32109520 and PMID:33387578 Usp9x Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Usp9x Rat 2,4,6-tribromophenol decreases expression ISO USP9X (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Usp9x Rat 2,6-dimethoxyphenol multiple interactions ISO USP9X (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Usp9x Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of USP9X mRNA CTD PMID:21346803 Usp9x Rat 3-methylcholanthrene increases expression ISO Usp9x (Mus musculus) 6480464 Methylcholanthrene results in increased expression of USP9X mRNA CTD PMID:25926378 Usp9x Rat 4,4'-sulfonyldiphenol increases expression ISO Usp9x (Mus musculus) 6480464 bisphenol S results in increased expression of USP9X mRNA CTD PMID:39298647 Usp9x Rat 5-fluorouracil affects response to substance ISO USP9X (Homo sapiens) 6480464 USP9X protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Usp9x Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of USP9X protein CTD PMID:33236894 Usp9x Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of USP9X mRNA CTD PMID:28959563 Usp9x Rat aflatoxin B1 increases expression ISO Usp9x (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of USP9X mRNA CTD PMID:19770486 Usp9x Rat all-trans-retinoic acid decreases expression ISO USP9X (Homo sapiens) 6480464 Tretinoin results in decreased expression of USP9X mRNA CTD PMID:15498508 Usp9x Rat all-trans-retinoic acid increases expression ISO USP9X (Homo sapiens) 6480464 Tretinoin results in increased expression of USP9X mRNA CTD PMID:23724009 Usp9x Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of USP9X mRNA CTD PMID:38685447 Usp9x Rat antirheumatic drug decreases expression ISO USP9X (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of USP9X mRNA CTD PMID:24449571 Usp9x Rat aristolochic acid A decreases expression ISO USP9X (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP9X mRNA CTD PMID:33212167 Usp9x Rat arsane multiple interactions ISO USP9X (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of USP9X mRNA CTD PMID:39836092 Usp9x Rat arsenic atom multiple interactions ISO USP9X (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of USP9X mRNA CTD PMID:39836092 Usp9x Rat arsenite(3-) multiple interactions ISO USP9X (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to USP9X mRNA] CTD PMID:32406909 Usp9x Rat atrazine decreases expression ISO USP9X (Homo sapiens) 6480464 Atrazine results in decreased expression of USP9X mRNA CTD PMID:22378314 Usp9x Rat benzo[a]pyrene decreases expression ISO Usp9x (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of USP9X mRNA CTD PMID:19770486 Usp9x Rat benzo[a]pyrene affects methylation ISO USP9X (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of USP9X 5' UTR and Benzo(a)pyrene affects the methylation of USP9X intron CTD PMID:27901495 and PMID:30157460 Usp9x Rat benzo[a]pyrene diol epoxide I decreases expression ISO USP9X (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Usp9x Rat bis(2-ethylhexyl) phthalate decreases expression ISO Usp9x (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of USP9X mRNA CTD PMID:33754040 Usp9x Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of USP9X mRNA CTD PMID:25181051 Usp9x Rat bisphenol A decreases expression ISO USP9X (Homo sapiens) 6480464 bisphenol A results in decreased expression of USP9X protein CTD PMID:31675489 and PMID:37567409 Usp9x Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP9X mRNA CTD PMID:30816183 more ... Usp9x Rat Bisphenol A diglycidyl ether affects splicing ISO Usp9x (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of USP9X mRNA CTD PMID:36464114 Usp9x Rat bisphenol AF affects splicing ISO Usp9x (Mus musculus) 6480464 bisphenol AF affects the splicing of USP9X mRNA CTD PMID:36464114 Usp9x Rat bisphenol AF increases expression ISO USP9X (Homo sapiens) 6480464 bisphenol AF results in increased expression of USP9X protein CTD PMID:34186270 Usp9x Rat bisphenol F increases expression ISO Usp9x (Mus musculus) 6480464 bisphenol F results in increased expression of USP9X mRNA CTD PMID:38685157 Usp9x Rat bisphenol F increases expression ISO USP9X (Homo sapiens) 6480464 bisphenol F results in increased expression of USP9X protein CTD PMID:34186270 Usp9x Rat butanal decreases expression ISO USP9X (Homo sapiens) 6480464 butyraldehyde results in decreased expression of USP9X mRNA CTD PMID:26079696 Usp9x Rat cadmium dichloride increases expression ISO USP9X (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of USP9X mRNA CTD PMID:38382870 Usp9x Rat caffeine decreases phosphorylation ISO USP9X (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of USP9X protein CTD PMID:35688186 Usp9x Rat CGP 52608 multiple interactions ISO USP9X (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP9X gene] CTD PMID:28238834 Usp9x Rat chlordecone increases expression ISO Usp9x (Mus musculus) 6480464 Chlordecone results in increased expression of USP9X mRNA CTD PMID:33711761 Usp9x Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of USP9X mRNA CTD PMID:30744511 Usp9x Rat chlorpyrifos decreases expression ISO Usp9x (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of USP9X mRNA CTD PMID:20350560 Usp9x Rat chromium(6+) decreases expression ISO USP9X (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of USP9X mRNA CTD PMID:30690063 Usp9x Rat cocaine increases expression ISO Usp9x (Mus musculus) 6480464 Cocaine results in increased expression of USP9X mRNA CTD PMID:20056891 Usp9x Rat cocaine multiple interactions ISO Usp9x (Mus musculus) 6480464 EHMT2 inhibits the reaction [Cocaine results in increased expression of USP9X mRNA] CTD PMID:20056891 Usp9x Rat copper(II) sulfate increases expression ISO USP9X (Homo sapiens) 6480464 Copper Sulfate results in increased expression of USP9X mRNA CTD PMID:19549813 Usp9x Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of USP9X mRNA CTD PMID:21266533 Usp9x Rat dioxygen increases expression ISO Usp9x (Mus musculus) 6480464 Oxygen deficiency results in increased expression of USP9X mRNA CTD PMID:24205000 Usp9x Rat dorsomorphin multiple interactions ISO USP9X (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP9X mRNA CTD PMID:27188386 Usp9x Rat elemental selenium decreases expression ISO USP9X (Homo sapiens) 6480464 Selenium results in decreased expression of USP9X mRNA CTD PMID:19244175 Usp9x Rat entinostat increases expression ISO USP9X (Homo sapiens) 6480464 entinostat results in increased expression of USP9X mRNA CTD PMID:26272509 Usp9x Rat entinostat multiple interactions ISO USP9X (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP9X mRNA CTD PMID:27188386 Usp9x Rat enzyme inhibitor multiple interactions ISO USP9X (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of USP9X protein CTD PMID:23301498 Usp9x Rat fenofibrate increases expression ISO Usp9x (Mus musculus) 6480464 Fenofibrate results in increased expression of USP9X mRNA CTD PMID:21318169 Usp9x Rat fenofibrate multiple interactions ISO Usp9x (Mus musculus) 6480464 PPARA protein affects the reaction [Fenofibrate results in increased expression of USP9X mRNA] CTD PMID:21318169 Usp9x Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of USP9X mRNA CTD PMID:23962444 Usp9x Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of USP9X mRNA CTD PMID:24136188 Usp9x Rat folic acid decreases expression ISO Usp9x (Mus musculus) 6480464 Folic Acid results in decreased expression of USP9X mRNA CTD PMID:25629700 Usp9x Rat furfural multiple interactions ISO USP9X (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Usp9x Rat ivermectin decreases expression ISO USP9X (Homo sapiens) 6480464 Ivermectin results in decreased expression of USP9X protein CTD PMID:32959892 Usp9x Rat manganese atom multiple interactions ISO USP9X (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of USP9X mRNA CTD PMID:39836092 Usp9x Rat manganese(0) multiple interactions ISO USP9X (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of USP9X mRNA CTD PMID:39836092 Usp9x Rat manganese(II) chloride multiple interactions ISO USP9X (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of USP9X mRNA CTD PMID:39836092 Usp9x Rat menadione affects expression ISO USP9X (Homo sapiens) 6480464 Vitamin K 3 affects the expression of USP9X mRNA CTD PMID:20044591 Usp9x Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of USP9X mRNA CTD PMID:30467583 Usp9x Rat methidathion decreases expression ISO Usp9x (Mus musculus) 6480464 methidathion results in decreased expression of USP9X mRNA CTD PMID:34813904 Usp9x Rat methylmercury chloride decreases expression ISO USP9X (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of USP9X mRNA CTD PMID:28001369 Usp9x Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of USP9X mRNA CTD PMID:30744511 Usp9x Rat methylparaben increases expression ISO USP9X (Homo sapiens) 6480464 methylparaben results in increased expression of USP9X mRNA CTD PMID:31745603 Usp9x Rat miconazole decreases expression ISO Usp9x (Mus musculus) 6480464 Miconazole results in decreased expression of USP9X mRNA CTD PMID:27462272 Usp9x Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of USP9X gene CTD PMID:33148267 Usp9x Rat N-methylformamide increases expression ISO Usp9x (Mus musculus) 6480464 methylformamide analog results in increased expression of USP9X mRNA and methylformamide results in increased expression of USP9X mRNA CTD PMID:17040096 Usp9x Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of USP9X mRNA CTD PMID:22110744 Usp9x Rat nickel subsulfide increases expression EXP 6480464 nickel subsulfide results in increased expression of USP9X mRNA CTD PMID:21086188 Usp9x Rat nickel sulfate decreases expression ISO USP9X (Homo sapiens) 6480464 nickel sulfate results in decreased expression of USP9X mRNA CTD PMID:22714537 Usp9x Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP9X mRNA CTD PMID:25729387 Usp9x Rat paracetamol decreases expression ISO USP9X (Homo sapiens) 6480464 Acetaminophen results in decreased expression of USP9X mRNA CTD PMID:21420995 Usp9x Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of USP9X mRNA CTD PMID:33387578 Usp9x Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp9x (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP9X mRNA CTD PMID:36331819 Usp9x Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of USP9X gene CTD PMID:33148267 Usp9x Rat phlorizin decreases expression ISO Usp9x (Mus musculus) 6480464 Phlorhizin results in decreased expression of USP9X mRNA CTD PMID:22538082 Usp9x Rat potassium chromate multiple interactions ISO USP9X (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of USP9X mRNA CTD PMID:22079256 Usp9x Rat potassium chromate decreases expression ISO USP9X (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of USP9X mRNA CTD PMID:22079256 and PMID:22714537 Usp9x Rat raloxifene decreases expression ISO Usp9x (Mus musculus) 6480464 Raloxifene Hydrochloride results in decreased expression of USP9X mRNA CTD PMID:33269387 Usp9x Rat resveratrol multiple interactions ISO USP9X (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of USP9X mRNA CTD PMID:23557933 Usp9x Rat SB 431542 multiple interactions ISO USP9X (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP9X mRNA CTD PMID:27188386 Usp9x Rat selenium atom decreases expression ISO USP9X (Homo sapiens) 6480464 Selenium results in decreased expression of USP9X mRNA CTD PMID:19244175 Usp9x Rat sodium arsenate increases expression ISO Usp9x (Mus musculus) 6480464 sodium arsenate results in increased expression of USP9X mRNA CTD PMID:21795629 Usp9x Rat sodium arsenite increases expression ISO USP9X (Homo sapiens) 6480464 sodium arsenite results in increased expression of USP9X mRNA CTD PMID:38568856 Usp9x Rat sodium arsenite increases expression ISO Usp9x (Mus musculus) 6480464 sodium arsenite results in increased expression of USP9X mRNA CTD PMID:36209798 Usp9x Rat sodium arsenite multiple interactions ISO USP9X (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of USP9X mRNA CTD PMID:39836092 Usp9x Rat sodium chloride multiple interactions ISO USP9X (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of USP9X protein more ... CTD PMID:38598786 Usp9x Rat succimer multiple interactions ISO Usp9x (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of USP9X mRNA and [Succimer co-treated with Magnetite Nanoparticles] affects the expression of USP9X mRNA CTD PMID:21641980 and PMID:26378955 Usp9x Rat tamibarotene affects expression ISO USP9X (Homo sapiens) 6480464 tamibarotene affects the expression of USP9X mRNA CTD PMID:15498508 Usp9x Rat temozolomide decreases expression ISO USP9X (Homo sapiens) 6480464 Temozolomide results in decreased expression of USP9X mRNA CTD PMID:31758290 Usp9x Rat tert-butyl hydroperoxide increases expression ISO USP9X (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of USP9X mRNA CTD PMID:15336504 Usp9x Rat testosterone decreases expression ISO USP9X (Homo sapiens) 6480464 Testosterone results in decreased expression of USP9X mRNA CTD PMID:33359661 Usp9x Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of USP9X mRNA CTD PMID:30723492 Usp9x Rat thapsigargin increases expression ISO Usp9x (Mus musculus) 6480464 Thapsigargin results in increased expression of USP9X protein CTD PMID:24648495 Usp9x Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of USP9X mRNA CTD PMID:34492290 Usp9x Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP9X mRNA CTD PMID:25729387 Usp9x Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of USP9X mRNA CTD PMID:33387578 Usp9x Rat trichostatin A decreases expression ISO USP9X (Homo sapiens) 6480464 trichostatin A results in decreased expression of USP9X mRNA CTD PMID:24935251 Usp9x Rat valproic acid decreases expression ISO USP9X (Homo sapiens) 6480464 Valproic Acid results in decreased expression of USP9X mRNA CTD PMID:23179753 and PMID:24935251 Usp9x Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of USP9X mRNA CTD PMID:29427782 Usp9x Rat valproic acid decreases methylation ISO USP9X (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of USP9X gene CTD PMID:29154799 Usp9x Rat vitamin E decreases expression ISO USP9X (Homo sapiens) 6480464 Vitamin E results in decreased expression of USP9X mRNA CTD PMID:19244175
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-tribromophenol (ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) aconitine (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) chlordecone (ISO) chlorohydrocarbon (EXP) chlorpyrifos (ISO) chromium(6+) (ISO) cocaine (ISO) copper(II) sulfate (ISO) dibutyl phthalate (EXP) dioxygen (ISO) dorsomorphin (ISO) elemental selenium (ISO) entinostat (ISO) enzyme inhibitor (ISO) fenofibrate (ISO) fipronil (EXP) flutamide (EXP) folic acid (ISO) furfural (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) methapyrilene (EXP) methidathion (ISO) methylmercury chloride (EXP,ISO) methylparaben (ISO) miconazole (ISO) N,N-diethyl-m-toluamide (EXP) N-methylformamide (ISO) nickel dichloride (EXP) nickel subsulfide (EXP) nickel sulfate (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phlorizin (ISO) potassium chromate (ISO) raloxifene (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) succimer (ISO) tamibarotene (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP) thapsigargin (ISO) thioacetamide (EXP) topotecan (EXP) trichloroethene (EXP) trichostatin A (ISO) valproic acid (EXP,ISO) vitamin E (ISO)
Biological Process
axon extension (IEA,ISO) BMP signaling pathway (IEA,ISO) cell migration (IBA) cellular response to transforming growth factor beta stimulus (ISO) cerebellar cortex structural organization (ISO) cilium assembly (IEA,ISO) cytosolic ciliogenesis (IEA,ISO) DNA alkylation repair (IEA,ISO) hippocampus development (ISO) in utero embryonic development (ISO) monoubiquitinated protein deubiquitination (IEA,ISO) negative regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO) neuron migration (IEA,ISO) neuron projection extension (ISO) positive regulation of TORC2 signaling (IEA,ISO) post-embryonic development (ISO) protein deubiquitination (IEA,ISO) protein deubiquitination involved in ubiquitin-dependent protein catabolic process (IEA,ISO) protein import into peroxisome matrix, receptor recycling (IEA,ISO) protein K63-linked deubiquitination (IEA,ISO) protein stabilization (IEA,ISO) proteolysis (IEA) regulation of circadian rhythm (IEA,ISO) regulation of postsynapse assembly (ISO) regulation of protein stability (IBA) transforming growth factor beta receptor signaling pathway (IEA,ISO)
Usp9x Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 12,261,633 - 12,399,780 (-) NCBI GRCr8 mRatBN7.2 X 9,588,825 - 9,726,993 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 9,588,825 - 9,696,711 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 9,772,936 - 9,880,483 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 13,270,083 - 13,377,627 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 9,539,867 - 9,647,608 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 10,510,033 - 10,660,555 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 10,510,033 - 10,630,297 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 11,308,415 - 11,458,704 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 21,606,330 - 21,718,042 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 10,119,391 - 10,226,802 (-) NCBI Celera Cytogenetic Map X q12 NCBI
USP9X Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 41,085,445 - 41,236,579 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 41,085,445 - 41,236,579 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 40,944,698 - 41,095,832 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 40,829,832 - 40,980,776 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera X 45,085,646 - 45,236,596 (+) NCBI Celera Cytogenetic Map X p11.4 NCBI HuRef X 38,676,295 - 38,826,441 (+) NCBI HuRef CHM1_1 X 40,977,600 - 41,128,503 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 40,487,470 - 40,638,605 (+) NCBI T2T-CHM13v2.0
Usp9x Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 12,937,221 - 13,039,567 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 12,937,737 - 13,039,567 (+) Ensembl GRCm39 Ensembl GRCm38 X 13,070,982 - 13,173,328 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 13,071,498 - 13,173,328 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 12,648,624 - 12,750,454 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 12,228,496 - 12,328,745 (+) NCBI MGSCv36 mm8 Celera X 10,768,972 - 10,871,748 (+) NCBI Celera Cytogenetic Map X A1.1 NCBI cM Map X 7.95 NCBI
Usp9x Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955565 1,479,040 - 1,602,070 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955565 1,479,040 - 1,602,070 (-) NCBI ChiLan1.0 ChiLan1.0
USP9X Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 42,734,028 - 42,881,834 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 42,737,410 - 42,887,035 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 33,535,543 - 33,683,220 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 41,231,814 - 41,380,569 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 41,232,041 - 41,379,910 (+) Ensembl panpan1.1 panPan2
USP9X Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 35,522,873 - 35,676,086 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 22,845,661 - 23,024,786 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 35,571,563 - 35,712,343 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 X 35,624,905 - 35,803,984 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 35,597,545 - 35,776,521 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 35,640,469 - 35,819,595 (+) NCBI UU_Cfam_GSD_1.0
Usp9x Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 27,780,903 - 27,894,664 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936502 7,649,842 - 7,735,382 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936502 7,649,808 - 7,732,731 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP9X
USP9X Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 38,255,414 - 38,402,855 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl Y 489,840 - 626,098 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 ChlSab1.1 Ensembl X 38,256,008 - 38,403,323 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666076 3,448,010 - 3,595,885 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp9x
.
Predicted Target Of
Count of predictions: 1123 Count of miRNA genes: 360 Interacting mature miRNAs: 492 Transcripts: ENSRNOT00000048980 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
70165 Bp64 Blood pressure QTL 64 5.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) X 1448129 31706553 Rat 1298071 Edpm12 Estrogen-dependent pituitary mass QTL 12 3.2 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) X 2927898 47927898 Rat 731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat 70166 Bp65 Blood pressure QTL 65 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) X 1447972 11374346 Rat 10755455 Coatc13 Coat color QTL 13 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 4406000 49406000 Rat 631666 Iddm5 Insulin dependent diabetes mellitus QTL 5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 4494549 49494549 Rat 634325 Bw13 Body weight QTL 13 0 body mass (VT:0001259) body weight (CMO:0000012) X 1447972 20991088 Rat 631204 Gluco15 Glucose level QTL 15 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) X 1623715 22646544 Rat
RH127557
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 X 12,261,810 - 12,262,010 (+) Marker Load Pipeline mRatBN7.2 X 9,589,002 - 9,589,202 (+) MAPPER mRatBN7.2 Rnor_6.0 X 10,510,211 - 10,510,410 NCBI Rnor6.0 Rnor_6.0 X 10,523,776 - 10,523,975 NCBI Rnor6.0 Rnor_5.0 X 11,322,158 - 11,322,357 UniSTS Rnor5.0 Rnor_5.0 X 11,308,593 - 11,308,792 UniSTS Rnor5.0 RGSC_v3.4 X 21,606,508 - 21,606,707 UniSTS RGSC3.4 Celera X 10,119,569 - 10,119,768 UniSTS Cytogenetic Map X q13 UniSTS
RH125670
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 X 12,265,623 - 12,265,854 (+) Marker Load Pipeline mRatBN7.2 X 9,592,814 - 9,593,046 (+) MAPPER mRatBN7.2 Rnor_6.0 X 10,526,220 - 10,526,451 NCBI Rnor6.0 Rnor_5.0 X 11,324,602 - 11,324,833 UniSTS Rnor5.0 RGSC_v3.4 X 21,610,320 - 21,610,551 UniSTS RGSC3.4 Celera X 10,123,381 - 10,123,612 UniSTS Cytogenetic Map X q13 UniSTS
RH142260
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 9,591,801 - 9,591,955 (+) MAPPER mRatBN7.2 Rnor_6.0 X 10,513,010 - 10,513,163 NCBI Rnor6.0 Rnor_5.0 X 11,311,392 - 11,311,545 UniSTS Rnor5.0 RGSC_v3.4 X 21,609,307 - 21,609,460 UniSTS RGSC3.4 Celera X 10,122,368 - 10,122,521 UniSTS RH 3.4 Map X 21.6 UniSTS Cytogenetic Map X q13 UniSTS
BF396338
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 9,640,927 - 9,641,075 (+) MAPPER mRatBN7.2 Rnor_6.0 X 10,573,812 - 10,573,959 NCBI Rnor6.0 Rnor_5.0 X 11,372,194 - 11,372,341 UniSTS Rnor5.0 RGSC_v3.4 X 21,660,103 - 21,660,250 UniSTS RGSC3.4 Celera X 10,171,446 - 10,171,593 UniSTS RH 3.4 Map X 16.2 UniSTS Cytogenetic Map X q13 UniSTS
RH141703
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 9,591,548 - 9,591,751 (+) MAPPER mRatBN7.2 Rnor_6.0 X 10,512,757 - 10,512,959 NCBI Rnor6.0 Rnor_5.0 X 11,311,139 - 11,311,341 UniSTS Rnor5.0 RGSC_v3.4 X 21,609,054 - 21,609,256 UniSTS RGSC3.4 Celera X 10,122,115 - 10,122,317 UniSTS RH 3.4 Map X 23.9 UniSTS Cytogenetic Map X q13 UniSTS
BG371737
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map X 19.2 UniSTS Cytogenetic Map X q13 UniSTS
D20S998
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 9,592,789 - 9,592,908 (+) MAPPER mRatBN7.2 Rnor_6.0 X 10,526,195 - 10,526,313 NCBI Rnor6.0 Rnor_5.0 X 11,324,577 - 11,324,695 UniSTS Rnor5.0 RGSC_v3.4 X 21,610,295 - 21,610,413 UniSTS RGSC3.4 Celera X 10,123,356 - 10,123,474 UniSTS Cytogenetic Map X q13 UniSTS
RH125324
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 9,590,527 - 9,590,706 (+) MAPPER mRatBN7.2 Rnor_6.0 X 10,525,301 - 10,525,479 NCBI Rnor6.0 Rnor_6.0 X 10,511,736 - 10,511,914 NCBI Rnor6.0 Rnor_5.0 X 11,310,118 - 11,310,296 UniSTS Rnor5.0 Rnor_5.0 X 11,323,683 - 11,323,861 UniSTS Rnor5.0 RGSC_v3.4 X 21,608,033 - 21,608,211 UniSTS RGSC3.4 Celera X 10,121,094 - 10,121,272 UniSTS Cytogenetic Map X q13 UniSTS
USP9X_3261
Rat Assembly Chr Position (strand) Source JBrowse RGSC_v3.4 X 21,609,885 - 21,610,490 UniSTS RGSC3.4 Celera X 10,122,946 - 10,123,551 UniSTS Cytogenetic Map X q13 UniSTS
px-12d6
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 X 12,261,992 - 12,262,106 (+) Marker Load Pipeline mRatBN7.2 X 9,589,184 - 9,589,297 (+) MAPPER mRatBN7.2 Rnor_6.0 X 10,510,393 - 10,510,505 NCBI Rnor6.0 Rnor_6.0 X 10,523,958 - 10,524,070 NCBI Rnor6.0 Rnor_5.0 X 11,322,340 - 11,322,452 UniSTS Rnor5.0 Rnor_5.0 X 11,308,775 - 11,308,887 UniSTS Rnor5.0 RGSC_v3.4 X 21,606,690 - 21,606,802 UniSTS RGSC3.4 Celera X 10,119,751 - 10,119,863 UniSTS Cytogenetic Map X q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048980 ⟹ ENSRNOP00000043441
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 9,590,589 - 9,696,711 (-) Ensembl Rnor_6.0 Ensembl X 10,511,797 - 10,630,297 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000080651 ⟹ ENSRNOP00000072190
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 9,588,825 - 9,696,695 (-) Ensembl Rnor_6.0 Ensembl X 10,510,033 - 10,630,281 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093067 ⟹ ENSRNOP00000075990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 9,594,237 - 9,696,711 (-) Ensembl
RefSeq Acc Id:
NM_001135923 ⟹ NP_001129395
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,633 - 12,369,491 (-) NCBI mRatBN7.2 X 9,588,825 - 9,696,695 (-) NCBI Rnor_6.0 X 10,510,033 - 10,630,281 (-) NCBI Rnor_5.0 X 11,308,415 - 11,458,704 (-) NCBI RGSC_v3.4 X 21,606,330 - 21,718,042 (-) RGD Celera X 10,119,391 - 10,226,786 (-) NCBI
Sequence:
AGTGGGAGTCTGCGCTGCTGCCGCTGCTGCCGCTGCTGTCGCTGTCGCTGCTGCCGCTGCCGCCGCCGACACTGCCACTGGCCGTGCGGGTTTTCTTTTTCTTTTTCTTTTTCTCTTTTCTTTTTTGA
hide sequence
RefSeq Acc Id:
XM_039099859 ⟹ XP_038955787
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,369,516 (-) NCBI mRatBN7.2 X 9,588,943 - 9,696,011 (-) NCBI
RefSeq Acc Id:
XM_039099860 ⟹ XP_038955788
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,399,780 (-) NCBI mRatBN7.2 X 9,588,943 - 9,726,993 (-) NCBI
RefSeq Acc Id:
XM_039099861 ⟹ XP_038955789
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,399,780 (-) NCBI mRatBN7.2 X 9,588,943 - 9,726,993 (-) NCBI
RefSeq Acc Id:
XM_039099862 ⟹ XP_038955790
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,368,531 (-) NCBI mRatBN7.2 X 9,588,943 - 9,695,584 (-) NCBI
RefSeq Acc Id:
XM_039099863 ⟹ XP_038955791
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,369,516 (-) NCBI mRatBN7.2 X 9,588,943 - 9,696,011 (-) NCBI
RefSeq Acc Id:
XM_039099864 ⟹ XP_038955792
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,369,516 (-) NCBI mRatBN7.2 X 9,588,943 - 9,696,011 (-) NCBI
RefSeq Acc Id:
XM_039099865 ⟹ XP_038955793
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,369,516 (-) NCBI mRatBN7.2 X 9,588,943 - 9,696,011 (-) NCBI
RefSeq Acc Id:
XM_039099867 ⟹ XP_038955795
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,346,895 (-) NCBI mRatBN7.2 X 9,588,943 - 9,674,098 (-) NCBI
RefSeq Acc Id:
XM_063280114 ⟹ XP_063136184
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,399,780 (-) NCBI
RefSeq Acc Id:
XM_063280115 ⟹ XP_063136185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,399,780 (-) NCBI
RefSeq Acc Id:
XM_063280116 ⟹ XP_063136186
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 12,261,751 - 12,399,780 (-) NCBI
RefSeq Acc Id:
NP_001129395 ⟸ NM_001135923
- Peptide Label:
isoform 2
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
- Sequence:
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQIEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFFRDGLTISF
hide sequence
Ensembl Acc Id:
ENSRNOP00000072190 ⟸ ENSRNOT00000080651
Ensembl Acc Id:
ENSRNOP00000043441 ⟸ ENSRNOT00000048980
RefSeq Acc Id:
XP_038955789 ⟸ XM_039099861
- Peptide Label:
isoform X1
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955788 ⟸ XM_039099860
- Peptide Label:
isoform X1
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955793 ⟸ XM_039099865
- Peptide Label:
isoform X4
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955791 ⟸ XM_039099863
- Peptide Label:
isoform X2
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955792 ⟸ XM_039099864
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038955787 ⟸ XM_039099859
- Peptide Label:
isoform X1
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955790 ⟸ XM_039099862
- Peptide Label:
isoform X1
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038955795 ⟸ XM_039099867
- Peptide Label:
isoform X4
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000075990 ⟸ ENSRNOT00000093067
RefSeq Acc Id:
XP_063136186 ⟸ XM_063280116
- Peptide Label:
isoform X2
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136185 ⟸ XM_063280115
- Peptide Label:
isoform X1
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136184 ⟸ XM_063280114
- Peptide Label:
isoform X1
- UniProtKB:
A6JZY9 (UniProtKB/TrEMBL), D3ZC84 (UniProtKB/TrEMBL)
RGD ID: 13701707 Promoter ID: EPDNEW_R12231 Type: initiation region Name: Usp9x_1 Description: ubiquitin specific peptidase 9, X-linked SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 10,630,281 - 10,630,341 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Usp9x
ubiquitin specific peptidase 9, X-linked
Usp9x
ubiquitin specific peptidase 9, X chromosome
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Usp9x
ubiquitin specific peptidase 9, X chromosome
Usp9x_predicted
ubiquitin specific peptidase 9, X chromosome (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Usp9x_predicted
ubiquitin specific peptidase 9, X chromosome (predicted)
RGD1560056_predicted
similar to ubiquitin specific protease 9, X-linked (fat facets-like, Drosophila) (predicted)
Symbol and Name updated
1299863 APPROVED
2006-03-07
RGD1560056_predicted
similar to ubiquitin specific protease 9, X-linked (fat facets-like, Drosophila) (predicted)
LOC363445
similar to ubiquitin specific protease 9, X-linked (fat facets-like, Drosophila)
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC363445
similar to ubiquitin specific protease 9, X-linked (fat facets-like, Drosophila)
Symbol and Name status set to provisional
70820 PROVISIONAL
