Symbol:
Map2k7
Name:
mitogen activated protein kinase kinase 7
RGD ID:
1560043
Description:
Enables several functions, including ATP binding activity; JUN kinase kinase activity; and magnesium ion binding activity. Involved in several processes, including MAPK cascade; cellular response to sorbitol; and positive regulation of JNK cascade. Predicted to be located in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in colon adenocarcinoma; lung adenocarcinoma; lung carcinoma; and lung non-small cell carcinoma. Orthologous to human MAP2K7 (mitogen-activated protein kinase kinase 7); PARTICIPATES IN c-Jun N-terminal kinases MAPK signaling pathway; adenosine signaling pathway; FasL mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cadmium atom.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
c-Jun N-terminal kinase kinase 2; dual specificity mitogen-activated protein kinase kinase 7; JNK kinase 2; JNK-activating kinase 2; JNKK; JNKK 2; Jnkk2; MAP kinase kinase 7; MAPK/ERK kinase 7; MAPKK 7; Mapkk7; MEK 7; Mek7; Mkk7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 7,389,032 - 7,398,377 (+) NCBI GRCr8 mRatBN7.2 12 2,591,312 - 2,600,534 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 2,591,219 - 2,604,222 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 3,239,383 - 3,248,497 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 3,862,974 - 3,872,088 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 2,626,083 - 2,635,208 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 2,546,278 - 2,555,310 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 2,548,218 - 2,555,164 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 4,698,912 - 4,708,078 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 1,545,407 - 1,552,353 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 4,407,043 - 4,413,990 (+) NCBI Celera Cytogenetic Map 12 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map2k7 Rat (S)-nicotine multiple interactions ISO Map2k7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Map2k7 Rat 1,2-dimethylhydrazine decreases expression ISO Map2k7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MAP2K7 mRNA CTD PMID:22206623 Map2k7 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Map2k7 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Map2k7 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Map2k7 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Map2k7 Rat 17alpha-ethynylestradiol increases expression ISO Map2k7 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MAP2K7 mRNA CTD PMID:17942748 Map2k7 Rat 17alpha-ethynylestradiol multiple interactions ISO Map2k7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAP2K7 mRNA CTD PMID:17942748 Map2k7 Rat 17beta-estradiol multiple interactions ISO Map2k7 (Mus musculus) 6480464 ESR1 protein promotes the reaction [Estradiol results in decreased expression of MAP2K7 mRNA] CTD PMID:25210133 Map2k7 Rat 17beta-estradiol decreases expression ISO Map2k7 (Mus musculus) 6480464 Estradiol results in decreased expression of MAP2K7 mRNA CTD PMID:25210133 Map2k7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Map2k7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAP2K7 mRNA CTD PMID:17942748 Map2k7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAP2K7 mRNA CTD PMID:32109520 Map2k7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHRR protein binds to MAP2K7 gene] CTD PMID:28681081 Map2k7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Map2k7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP2K7 mRNA CTD PMID:21570461 Map2k7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Map2k7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP2K7 mRNA CTD PMID:19770486 Map2k7 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Map2k7 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of MAP2K7 mRNA CTD PMID:19285098 and PMID:26251327 Map2k7 Rat 4,4'-diaminodiphenylmethane increases expression ISO Map2k7 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MAP2K7 mRNA CTD PMID:18648102 Map2k7 Rat 5-fluorouracil decreases expression ISO MAP2K7 (Homo sapiens) 155630595 5-fluorouracil decreases expression of MAP2K7 protein in tongue squamous carcinoma cells RGD Map2k7 Rat afimoxifene decreases response to substance ISO MAP2K7 (Homo sapiens) 6480464 MAP2K7 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Map2k7 Rat aflatoxin B1 increases methylation ISO MAP2K7 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MAP2K7 intron CTD PMID:30157460 Map2k7 Rat alpha-Chaconine multiple interactions ISO Map2k7 (Mus musculus) 6480464 alpha-chaconine inhibits the reaction [lipopolysaccharide and Escherichia coli O111 B4 results in increased phosphorylation of MAP2K7 protein] CTD PMID:25913072 Map2k7 Rat andrographolide multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 andrographolide inhibits the reaction [VEGFA protein results in increased phosphorylation of MAP2K7 protein] CTD PMID:24814888 Map2k7 Rat arsane multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MAP2K7 mRNA CTD PMID:39836092 Map2k7 Rat arsenic atom multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MAP2K7 mRNA CTD PMID:39836092 Map2k7 Rat atrazine increases expression ISO MAP2K7 (Homo sapiens) 6480464 Atrazine results in increased expression of MAP2K7 mRNA CTD PMID:22378314 Map2k7 Rat benzo[a]pyrene increases methylation ISO MAP2K7 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MAP2K7 promoter CTD PMID:27901495 Map2k7 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO Map2k7 (Mus musculus) 6480464 Mustard Gas results in increased phosphorylation of MAP2K7 protein CTD PMID:18200059 Map2k7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAP2K7 mRNA CTD PMID:25181051 Map2k7 Rat bisphenol A decreases methylation ISO MAP2K7 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of MAP2K7 gene CTD PMID:31601247 Map2k7 Rat bisphenol A decreases expression ISO Map2k7 (Mus musculus) 6480464 bisphenol A results in decreased expression of MAP2K7 mRNA CTD PMID:33221593 Map2k7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAP2K7 mRNA CTD PMID:30816183 and PMID:32528016 Map2k7 Rat bisphenol F decreases methylation ISO MAP2K7 (Homo sapiens) 6480464 bisphenol F results in decreased methylation of MAP2K7 gene CTD PMID:31601247 Map2k7 Rat bufalin decreases expression ISO MAP2K7 (Homo sapiens) 6480464 bufalin results in decreased expression of MAP2K7 protein CTD PMID:23949904 Map2k7 Rat butanal decreases expression ISO MAP2K7 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of MAP2K7 mRNA CTD PMID:26079696 Map2k7 Rat cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased phosphorylation of MAP2K7 protein and gamma-glutamylcysteine inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased phosphorylation of MAP2K7 protein] CTD PMID:34767868 Map2k7 Rat cadmium dichloride multiple interactions ISO Map2k7 (Mus musculus) 6480464 [MAP2K4 co-treated with MAP2K7] affects the reaction [Cadmium Chloride results in increased expression of HSPA1A protein] more ... CTD PMID:18348256 Map2k7 Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased phosphorylation of MAP2K7 protein and gamma-glutamylcysteine inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased phosphorylation of MAP2K7 protein] CTD PMID:34767868 Map2k7 Rat cadmium dichloride increases expression ISO MAP2K7 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MAP2K7 mRNA CTD PMID:12160620 Map2k7 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of MAP2K7 promoter CTD PMID:22457795 Map2k7 Rat caffeine multiple interactions ISO Map2k7 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Map2k7 Rat caffeine decreases phosphorylation ISO MAP2K7 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of MAP2K7 protein CTD PMID:35688186 Map2k7 Rat cannabidiol multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in decreased expression of MAP2K7 mRNA CTD PMID:30096889 Map2k7 Rat carbon nanotube increases expression ISO Map2k7 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MAP2K7 mRNA CTD PMID:25620056 Map2k7 Rat CGP 52608 multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MAP2K7 gene] CTD PMID:28238834 Map2k7 Rat chlorpyrifos increases expression ISO Map2k7 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MAP2K7 mRNA CTD PMID:37019170 Map2k7 Rat chromium(6+) multiple interactions ISO Map2k7 (Mus musculus) 6480464 MAP2K7 protein promotes the reaction [chromium hexavalent ion results in decreased expression of MYH6 mRNA] more ... CTD PMID:19654923 Map2k7 Rat chromium(6+) decreases response to substance ISO Map2k7 (Mus musculus) 6480464 MAP2K7 protein results in decreased susceptibility to chromium hexavalent ion CTD PMID:19654923 Map2k7 Rat copper atom multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAP2K7 mRNA CTD PMID:30911355 Map2k7 Rat copper(0) multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAP2K7 mRNA CTD PMID:30911355 Map2k7 Rat copper(II) chloride increases expression ISO MAP2K7 (Homo sapiens) 6480464 cupric chloride results in increased expression of MAP2K7 mRNA CTD PMID:38568856 Map2k7 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of MAP2K7 mRNA CTD PMID:27523638 Map2k7 Rat DDE decreases expression ISO MAP2K7 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MAP2K7 mRNA CTD PMID:38568856 Map2k7 Rat deguelin decreases expression ISO MAP2K7 (Homo sapiens) 6480464 deguelin results in decreased expression of MAP2K7 protein CTD PMID:25322282 Map2k7 Rat diallyl disulfide affects expression ISO MAP2K7 (Homo sapiens) 6480464 diallyl disulfide affects the expression of MAP2K7 protein CTD PMID:21695758 Map2k7 Rat Diallyl sulfide affects expression ISO MAP2K7 (Homo sapiens) 6480464 allyl sulfide affects the expression of MAP2K7 protein CTD PMID:21695758 Map2k7 Rat diallyl trisulfide multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 MAP2K7 protein affects the reaction [diallyl trisulfide results in increased degradation of FTL protein] and MAP2K7 protein affects the reaction [diallyl trisulfide results in increased phosphorylation of JUN protein] CTD PMID:16707465 Map2k7 Rat diallyl trisulfide affects expression ISO MAP2K7 (Homo sapiens) 6480464 diallyl trisulfide affects the expression of MAP2K7 protein CTD PMID:21695758 Map2k7 Rat diazinon increases methylation ISO MAP2K7 (Homo sapiens) 6480464 Diazinon results in increased methylation of MAP2K7 gene CTD PMID:22964155 Map2k7 Rat Dibutyl phosphate affects expression ISO MAP2K7 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MAP2K7 mRNA CTD PMID:37042841 Map2k7 Rat dicrotophos increases expression ISO MAP2K7 (Homo sapiens) 6480464 dicrotophos results in increased expression of MAP2K7 mRNA CTD PMID:28302478 Map2k7 Rat doxorubicin decreases expression ISO MAP2K7 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MAP2K7 mRNA CTD PMID:29803840 Map2k7 Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of MAP2K7 mRNA CTD PMID:31464424 Map2k7 Rat epoxiconazole decreases expression ISO Map2k7 (Mus musculus) 6480464 epoxiconazole results in decreased expression of MAP2K7 mRNA CTD PMID:35436446 Map2k7 Rat ethanol affects splicing ISO Map2k7 (Mus musculus) 6480464 Ethanol affects the splicing of MAP2K7 mRNA CTD PMID:30319688 Map2k7 Rat folic acid decreases expression ISO Map2k7 (Mus musculus) 6480464 Folic Acid results in decreased expression of MAP2K7 mRNA CTD PMID:25629700 Map2k7 Rat formaldehyde increases expression ISO MAP2K7 (Homo sapiens) 6480464 Formaldehyde results in increased expression of MAP2K7 mRNA CTD PMID:23649840 Map2k7 Rat hydrogen peroxide multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 ASK1 protein inhibits the reaction [Hydrogen Peroxide promotes the reaction [MAP3K5 protein binds to MAP2K7 protein]] and Hydrogen Peroxide promotes the reaction [MAP3K5 protein binds to MAP2K7 protein] CTD PMID:28939911 Map2k7 Rat L-gamma-glutamyl-L-cysteine multiple interactions EXP 6480464 gamma-glutamylcysteine inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased phosphorylation of MAP2K7 protein] CTD PMID:34767868 Map2k7 Rat methamphetamine decreases expression ISO Map2k7 (Mus musculus) 6480464 Methamphetamine results in decreased expression of MAP2K7 protein CTD PMID:16192988 Map2k7 Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 1-Methyl-4-phenylpyridinium promotes the reaction [MAP3K5 protein binds to MAP2K7 protein] and CIB1 protein inhibits the reaction [1-Methyl-4-phenylpyridinium promotes the reaction [MAP3K5 protein binds to MAP2K7 protein]] CTD PMID:28939911 Map2k7 Rat N-nitrosodiethylamine multiple interactions ISO Map2k7 (Mus musculus) 6480464 Diethylnitrosamine results in increased phosphorylation of and results in increased activity of MAP2K7 protein and MAPK14 protein inhibits the reaction [Diethylnitrosamine results in increased phosphorylation of and results in increased activity of MAP2K7 protein] CTD PMID:18691550 Map2k7 Rat nickel dichloride multiple interactions ISO Map2k7 (Mus musculus) 6480464 GADD45A protein inhibits the reaction [nickel chloride results in increased activity of MAP2K7 protein] CTD PMID:23536762 Map2k7 Rat nickel sulfate increases phosphorylation EXP 6480464 nickel sulfate results in increased phosphorylation of MAP2K7 protein CTD PMID:29567110 Map2k7 Rat nicotine multiple interactions ISO Map2k7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Map2k7 Rat nitrates multiple interactions ISO Map2k7 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MAP2K7 mRNA CTD PMID:35964746 Map2k7 Rat obeticholic acid decreases expression ISO MAP2K7 (Homo sapiens) 6480464 obeticholic acid results in decreased expression of MAP2K7 mRNA CTD PMID:27939613 Map2k7 Rat p-menthan-3-ol decreases expression ISO MAP2K7 (Homo sapiens) 6480464 Menthol results in decreased expression of MAP2K7 mRNA CTD PMID:26760959 Map2k7 Rat paracetamol increases expression ISO MAP2K7 (Homo sapiens) 6480464 Acetaminophen results in increased expression of MAP2K7 mRNA CTD PMID:22230336 Map2k7 Rat pentachlorophenol increases expression ISO Map2k7 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of MAP2K7 mRNA CTD PMID:23892564 Map2k7 Rat phlorizin increases expression ISO Map2k7 (Mus musculus) 6480464 Phlorhizin results in increased expression of MAP2K7 mRNA CTD PMID:22538082 Map2k7 Rat potassium chromate multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 MAP2K7 protein mutant form inhibits the reaction [potassium chromate(VI) results in increased phosphorylation of MAPK8 protein] CTD PMID:10910949 Map2k7 Rat potassium dichromate increases expression ISO Map2k7 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of MAP2K7 mRNA CTD PMID:23608068 Map2k7 Rat propiconazole decreases expression ISO Map2k7 (Mus musculus) 6480464 propiconazole results in decreased expression of MAP2K7 mRNA CTD PMID:21278054 Map2k7 Rat resveratrol multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of MAP2K7 mRNA CTD PMID:23557933 Map2k7 Rat sodium arsenite multiple interactions ISO MAP2K7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MAP2K7 mRNA and MAP2K7 mutant form inhibits the reaction [sodium arsenite results in increased expression of CDKN1A protein] CTD PMID:15734884 and PMID:39836092 Map2k7 Rat sodium arsenite increases expression ISO MAP2K7 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAP2K7 mRNA CTD PMID:38568856 Map2k7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MAP2K7 mRNA CTD PMID:34492290 Map2k7 Rat thiram increases expression ISO MAP2K7 (Homo sapiens) 6480464 Thiram results in increased expression of MAP2K7 mRNA CTD PMID:38568856 Map2k7 Rat titanium dioxide decreases methylation ISO Map2k7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MAP2K7 gene CTD PMID:35295148 Map2k7 Rat trichostatin A affects expression ISO MAP2K7 (Homo sapiens) 6480464 trichostatin A affects the expression of MAP2K7 mRNA CTD PMID:28542535 Map2k7 Rat triphenyl phosphate affects expression ISO MAP2K7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAP2K7 mRNA CTD PMID:37042841 Map2k7 Rat triptonide decreases expression ISO Map2k7 (Mus musculus) 6480464 triptonide results in decreased expression of MAP2K7 mRNA CTD PMID:33045310 Map2k7 Rat trovafloxacin multiple interactions ISO Map2k7 (Mus musculus) 6480464 [trovafloxacin co-treated with lipopolysaccharide and E coli O55-B5] results in decreased expression of MAP2K7 mRNA CTD PMID:18930950 Map2k7 Rat tunicamycin decreases expression ISO Map2k7 (Mus musculus) 6480464 Tunicamycin results in decreased expression of MAP2K7 mRNA CTD PMID:17127020 Map2k7 Rat urethane increases expression ISO MAP2K7 (Homo sapiens) 6480464 Urethane results in increased expression of MAP2K7 mRNA CTD PMID:28818685 Map2k7 Rat valproic acid decreases expression ISO MAP2K7 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MAP2K7 mRNA CTD PMID:23527032 Map2k7 Rat valproic acid increases methylation ISO MAP2K7 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAP2K7 gene CTD PMID:29154799 Map2k7 Rat vitamin E decreases expression ISO MAP2K7 (Homo sapiens) 6480464 Vitamin E results in decreased expression of MAP2K7 mRNA CTD PMID:19244175
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 5-fluorouracil (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) alpha-Chaconine (ISO) andrographolide (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bufalin (ISO) butanal (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) Cuprizon (EXP) DDE (ISO) deguelin (ISO) diallyl disulfide (ISO) Diallyl sulfide (ISO) diallyl trisulfide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) formaldehyde (ISO) hydrogen peroxide (ISO) L-gamma-glutamyl-L-cysteine (EXP) methamphetamine (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (ISO) nickel dichloride (ISO) nickel sulfate (EXP) nicotine (ISO) nitrates (ISO) obeticholic acid (ISO) p-menthan-3-ol (ISO) paracetamol (ISO) pentachlorophenol (ISO) phlorizin (ISO) potassium chromate (ISO) potassium dichromate (ISO) propiconazole (ISO) resveratrol (ISO) sodium arsenite (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vitamin E (ISO)
Biological Process
apoptotic process (IEA) cellular response to interleukin-1 (IEA,ISO) cellular response to lipopolysaccharide (IEA,ISO) cellular response to osmotic stress (IDA) cellular response to sorbitol (IEP) JNK cascade (IDA,IEA,ISO) MAPK cascade (IEA) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of ERK1 and ERK2 cascade (IEA,ISO,ISS) positive regulation of JNK cascade (IDA,IEA,ISO) positive regulation of JUN kinase activity (ISO) positive regulation of neuron apoptotic process (IMP) positive regulation of protein phosphorylation (IDA) positive regulation of telomere maintenance (IEA,ISO) protein phosphorylation (IDA) regulation of motor neuron apoptotic process (IEA,ISO) response to heat (IEA,ISO) response to osmotic stress (IDA,IEA,ISO) response to stress (IEA) response to tumor necrosis factor (IEA,ISO) response to UV (IEA,ISO) response to wounding (IEA,ISO) stress-activated MAPK cascade (IBA,IDA,IEA,ISO)
Molecular Function
ATP binding (IDA,IEA) enzyme binding (IEA,ISO) JUN kinase kinase activity (IBA,IDA,IEA,ISO) kinase activity (IEA) magnesium ion binding (IDA,IEA,ISO) MAP kinase activity (IEA,ISO) MAP kinase kinase activity (IDA,IEA,ISO) metal ion binding (IEA) mitogen-activated protein kinase kinase kinase binding (IPI) molecular function activator activity (ISO) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase activity (IEA) protein kinase binding (IEA,ISO) protein phosphatase binding (IEA,ISO) protein serine kinase activity (IEA) protein serine/threonine kinase activity (IEA) protein tyrosine kinase activity (IEA) transferase activity (IEA)
1.
Stress- and cell type-dependent regulation of transfected c-Jun N-terminal kinase and mitogen-activated protein kinase kinase isoforms.
Butterfield L, etal., Biochem J. 1999 Mar 15;338 ( Pt 3):681-6.
2.
Combined high energy of extracorporeal shock wave and 5-FU effectively suppressed the proliferation and growth of tongue squamous cell carcinoma.
Chang CL, etal., Biomed Pharmacother. 2021 Oct;142:112036. doi: 10.1016/j.biopha.2021.112036. Epub 2021 Aug 16.
3.
Prognostic significance of autophagy-related genes within esophageal carcinoma.
Chen C, etal., BMC Cancer. 2020 Aug 24;20(1):797. doi: 10.1186/s12885-020-07303-4.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Activation of ASK1, downstream MAPKK and MAPK isoforms during cardiac ischaemia.
Harding SJ, etal., Biochim Biophys Acta. 2010 Sep;1802(9):733-40. doi: 10.1016/j.bbadis.2010.06.005. Epub 2010 Jun 13.
6.
The p38 kinases MKK4 and MKK6 suppress metastatic colonization in human ovarian carcinoma.
Hickson JA, etal., Cancer Res. 2006 Feb 15;66(4):2264-70.
7.
Genetic variants of JNK and p38α pathways and risk of non-small cell lung cancer in an Eastern Chinese population.
Jia M, etal., Int J Cancer. 2017 Feb 15;140(4):807-817. doi: 10.1002/ijc.30508. Epub 2016 Nov 16.
8.
The c-jun kinase/stress-activated pathway: regulation, function and role in human disease.
Johnson GL and Nakamura K, Biochim Biophys Acta. 2007 Aug;1773(8):1341-8. Epub 2007 Jan 4.
9.
Activated mitogen-activated protein kinase kinase 7 redistributes to the cytosol and binds to Jun N-terminal kinase-interacting protein 1 involving oxidative stress during early reperfusion in rat hippocampal CA1 region.
Li CH, etal., J Neurochem. 2005 Apr;93(2):290-8.
10.
JNK1/2 represses Lkb1-deficiency-induced lung squamous cell carcinoma progression.
Liu J, etal., Nat Commun. 2019 May 14;10(1):2148. doi: 10.1038/s41467-019-09843-1.
11.
Up-regulation of MKK4, MKK6 and MKK7 during prostate cancer progression: an important role for SAPK signalling in prostatic neoplasia.
Lotan TL, etal., J Pathol. 2007 Aug;212(4):386-94.
12.
An autophagy-related model of 4 key genes for predicting prognosis of patients with laryngeal cancer.
Luo MS, etal., Medicine (Baltimore). 2020 Jul 24;99(30):e21163. doi: 10.1097/MD.0000000000021163.
13.
The neuroprotective effects of K252a through inhibiting MLK3/MKK7/JNK3 signaling pathway on ischemic brain injury in rat hippocampal CA1 region.
Pan J, etal., Neuroscience. 2005;131(1):147-59.
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
17.
The MKK7 p.Glu116Lys Rare Variant Serves as a Predictor for Lung Cancer Risk and Prognosis in Chinese.
Qiu F, etal., PLoS Genet. 2016 Mar 30;12(3):e1005955. doi: 10.1371/journal.pgen.1005955. eCollection 2016 Mar.
18.
A tumor-associated splice-isoform of MAP2K7 drives dedifferentiation in MBNL1-low cancers via JNK activation.
Ray D, etal., Proc Natl Acad Sci U S A. 2020 Jul 14;117(28):16391-16400. doi: 10.1073/pnas.2002499117. Epub 2020 Jun 29.
19.
GOA pipeline
RGD automated data pipeline
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
JunD, not c-Jun, is the AP-1 transcription factor required for Ras-induced lung cancer.
Ruiz EJ, etal., JCI Insight. 2021 Jul 8;6(13). pii: e124985. doi: 10.1172/jci.insight.124985.
22.
MKK7 mediates miR-493-dependent suppression of liver metastasis of colon cancer cells.
Sakai H, etal., Cancer Sci. 2014 Apr;105(4):425-30. doi: 10.1111/cas.12380. Epub 2014 Mar 24.
23.
The stress kinase MKK7 couples oncogenic stress to p53 stability and tumor suppression.
Schramek D, etal., Nat Genet. 2011 Mar;43(3):212-9. doi: 10.1038/ng.767. Epub 2011 Feb 13.
24.
Mitogen-activated protein kinase kinase 7 is activated during low potassium-induced apoptosis in rat cerebellar granule neurons.
Trotter L, etal., Neurosci Lett. 2002 Mar 1;320(1-2):29-32.
25.
Suppression of metastatic colonization by the context-dependent activation of the c-Jun NH2-terminal kinase kinases JNKK1/MKK4 and MKK7.
Vander Griend DJ, etal., Cancer Res. 2005 Dec 1;65(23):10984-91.
26.
Disruption of signaling through SEK1 and MKK7 yields differential responses in hypoxic colon cancer cells treated with oxaliplatin.
Vasilevskaya IA, etal., Mol Pharmacol. 2008 Jul;74(1):246-54. doi: 10.1124/mol.107.044644. Epub 2008 Apr 24.
27.
MEKK1 controls neurite regrowth after experimental injury by balancing ERK1/2 and JNK2 signaling.
Waetzig V and Herdegen T, Mol Cell Neurosci. 2005 Sep;30(1):67-78.
28.
Inhibition of MLK3-MKK4/7-JNK1/2 pathway by Akt1 in exogenous estrogen-induced neuroprotection against transient global cerebral ischemia by a non-genomic mechanism in male rats.
Wang R, etal., J Neurochem. 2006 Dec;99(6):1543-54. Epub 2006 Oct 25.
29.
POSH acts as a scaffold for a multiprotein complex that mediates JNK activation in apoptosis.
Xu Z, etal., EMBO J. 2003 Jan 15;22(2):252-61.
30.
Delayed activation and regulation of MKK7 in hippocampal CA1 region following global cerebral ischemia in rats.
Zhang Q, etal., Life Sci. 2003 Nov 21;74(1):37-45.
31.
Crosstalk between PSD-95 and JIP1-mediated signaling modules: the mechanism of MLK3 activation in cerebral ischemia.
Zhang QX, etal., Biochemistry. 2007 Apr 3;46(13):4006-16. Epub 2007 Mar 10.
Map2k7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 7,389,032 - 7,398,377 (+) NCBI GRCr8 mRatBN7.2 12 2,591,312 - 2,600,534 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 2,591,219 - 2,604,222 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 3,239,383 - 3,248,497 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 3,862,974 - 3,872,088 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 2,626,083 - 2,635,208 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 2,546,278 - 2,555,310 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 2,548,218 - 2,555,164 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 4,698,912 - 4,708,078 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 1,545,407 - 1,552,353 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 4,407,043 - 4,413,990 (+) NCBI Celera Cytogenetic Map 12 p12 NCBI
MAP2K7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 7,903,877 - 7,914,478 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 7,903,843 - 7,914,478 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 7,968,762 - 7,979,363 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 7,874,765 - 7,885,363 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 7,874,764 - 7,885,362 NCBI Celera 19 7,839,967 - 7,850,565 (+) NCBI Celera Cytogenetic Map 19 p13.2 NCBI HuRef 19 7,639,009 - 7,649,623 (+) NCBI HuRef CHM1_1 19 7,968,237 - 7,978,836 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 7,904,832 - 7,915,433 (+) NCBI T2T-CHM13v2.0
Map2k7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 4,288,740 - 4,297,897 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 4,288,865 - 4,301,423 (+) Ensembl GRCm39 Ensembl GRCm39 Ensembl 8 4,288,740 - 4,297,897 (+) Ensembl GRCm39 Ensembl GRCm38 8 4,238,740 - 4,247,897 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 4,238,865 - 4,251,423 (+) Ensembl GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 4,238,740 - 4,247,897 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 4,238,740 - 4,247,897 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 4,238,990 - 4,246,173 (+) NCBI MGSCv36 mm8 Celera 8 4,439,329 - 4,448,486 (+) NCBI Celera Cytogenetic Map 8 A1.1 NCBI cM Map 8 1.99 NCBI
Map2k7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955563 1,352,638 - 1,361,598 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955563 1,352,638 - 1,361,598 (-) NCBI ChiLan1.0 ChiLan1.0
MAP2K7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 12,586,639 - 12,597,308 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 11,702,668 - 11,714,508 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 7,205,124 - 7,215,776 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 8,058,431 - 8,068,555 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 8,057,598 - 8,066,512 (+) Ensembl panpan1.1 panPan2
MAP2K7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 52,594,450 - 52,604,236 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 52,594,536 - 52,602,150 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 52,396,989 - 52,406,782 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 53,122,659 - 53,132,453 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 53,122,690 - 53,132,448 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 52,325,934 - 52,335,725 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 52,770,533 - 52,780,328 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 53,001,904 - 53,011,707 (+) NCBI UU_Cfam_GSD_1.0
Map2k7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 212,942,983 - 212,952,496 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 4,882,184 - 4,892,071 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 4,882,191 - 4,891,807 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAP2K7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 71,298,325 - 71,308,124 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 71,299,010 - 71,308,432 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 71,699,410 - 71,708,529 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP2K7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 7,355,387 - 7,365,944 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 7,355,434 - 7,364,398 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 448,367 - 458,990 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map2k7
.
Predicted Target Of
Count of predictions: 83 Count of miRNA genes: 75 Interacting mature miRNAs: 82 Transcripts: ENSRNOT00000061821 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 7243862 Mcs30 Mammary carcinoma susceptibility QTL 30 8.62 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 12 797729 8525593 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1300174 Bw15 Body weight QTL 15 2.93 body mass (VT:0001259) body weight loss (CMO:0001399) 12 1 9318387 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000061821 ⟹ ENSRNOP00000058535
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 2,591,219 - 2,600,396 (+) Ensembl Rnor_6.0 Ensembl 12 2,548,218 - 2,555,164 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084460 ⟹ ENSRNOP00000072160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 2,591,478 - 2,604,222 (+) Ensembl Rnor_6.0 Ensembl 12 2,548,218 - 2,555,164 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104881 ⟹ ENSRNOP00000086269
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 2,591,219 - 2,604,222 (+) Ensembl
RefSeq Acc Id:
NM_001025425 ⟹ NP_001020596
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 7,389,267 - 7,398,377 (+) NCBI mRatBN7.2 12 2,591,424 - 2,600,534 (+) NCBI Rnor_6.0 12 2,548,218 - 2,555,164 (-) NCBI Rnor_5.0 12 4,698,912 - 4,708,078 (-) NCBI RGSC_v3.4 12 1,545,407 - 1,552,353 (-) RGD Celera 12 4,407,043 - 4,413,990 (+) RGD
Sequence:
ATGGCGGCGTCCTCCCTGGAGCAAAAGCTGTCCCGCCTGGAGGCCAAGCTGAAGCAGGAGAATCGTGAGGCCCGCAGGAGGATCGACCTCAACCTGGATATAAGCCCACAGCGGCCCAGGCCCACCTT
hide sequence
RefSeq Acc Id:
NM_001401207 ⟹ NP_001388136
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 7,389,267 - 7,398,377 (+) NCBI mRatBN7.2 12 2,591,424 - 2,600,534 (+) NCBI
RefSeq Acc Id:
XM_006248769 ⟹ XP_006248831
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 7,389,032 - 7,398,377 (+) NCBI mRatBN7.2 12 2,591,312 - 2,600,534 (+) NCBI Rnor_6.0 12 2,546,278 - 2,555,310 (-) NCBI Rnor_5.0 12 4,698,912 - 4,708,078 (-) NCBI
Sequence:
CGCGAGGCAGGGCGGGCACGAGCCGGGGTGGTCTAGGCAGGACGGCGGCTCGGCGGGGTCATCCTAGCGCAGGCGCAGTGCGGTGTTTGTCTACCCGGGACTGACGGGTGGCCTGGCGGTGAGCGGCG
hide sequence
RefSeq Acc Id:
XM_008768985 ⟹ XP_008767207
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 7,389,032 - 7,398,377 (+) NCBI mRatBN7.2 12 2,591,313 - 2,600,534 (+) NCBI Rnor_6.0 12 2,546,278 - 2,555,308 (-) NCBI
Sequence:
CGAGGCAGGGCGGGCACGAGCCGGGGTGGTCTAGGCAGGACGGCGGCTCGGCGGGGTCATCCTA
hide sequence
RefSeq Acc Id:
NP_001020596 ⟸ NM_001025425
- Peptide Label:
isoform 1
- UniProtKB:
Q4KSH7 (UniProtKB/Swiss-Prot), A6KQ65 (UniProtKB/TrEMBL), A6KQ61 (UniProtKB/TrEMBL)
- Sequence:
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPSRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGS
hide sequence
RefSeq Acc Id:
XP_006248831 ⟸ XM_006248769
- Peptide Label:
isoform X1
- UniProtKB:
A6KQ62 (UniProtKB/TrEMBL), A6KQ61 (UniProtKB/TrEMBL)
- Sequence:
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQLPLA
hide sequence
RefSeq Acc Id:
XP_008767207 ⟸ XM_008768985
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2UMW0 (UniProtKB/TrEMBL), A6KQ63 (UniProtKB/TrEMBL), A6KQ61 (UniProtKB/TrEMBL)
- Sequence:
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQH
hide sequence
Ensembl Acc Id:
ENSRNOP00000072160 ⟸ ENSRNOT00000084460
Ensembl Acc Id:
ENSRNOP00000058535 ⟸ ENSRNOT00000061821
Ensembl Acc Id:
ENSRNOP00000086269 ⟸ ENSRNOT00000104881
RefSeq Acc Id:
NP_001388136 ⟸ NM_001401207
- Peptide Label:
isoform 2
- UniProtKB:
D3XAM6 (UniProtKB/TrEMBL), A6KQ64 (UniProtKB/TrEMBL), A0A0G2K2A1 (UniProtKB/TrEMBL), A6KQ61 (UniProtKB/TrEMBL)
RGD ID: 13698383 Promoter ID: EPDNEW_R8907 Type: initiation region Name: Map2k7_1 Description: mitogen activated protein kinase kinase 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 2,555,234 - 2,555,294 EPDNEW
BioCyc Gene G2FUF-20352 BioCyc
Ensembl Genes ENSRNOG00000001047 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000061821 ENTREZGENE
ENSRNOT00000084460 ENTREZGENE
ENSRNOT00000104881 ENTREZGENE
ENSRNOT00000104881.1 UniProtKB/Swiss-Prot
Gene3D-CATH Phosphorylase Kinase, domain 1 UniProtKB/Swiss-Prot
Transferase(Phosphotransferase) domain 1 UniProtKB/Swiss-Prot
InterPro Dual_spec_MAPK_kinase UniProtKB/Swiss-Prot
Kinase-like_dom_sf UniProtKB/Swiss-Prot
Prot_kinase_dom UniProtKB/Swiss-Prot
Ser/Thr_kinase_AS UniProtKB/Swiss-Prot
KEGG Report rno:363855 UniProtKB/Swiss-Prot
NCBI Gene 363855 ENTREZGENE
PANTHER MITOGEN-ACTIVATED PROTEIN KINASE KINASE 5 UniProtKB/Swiss-Prot
PROTEIN KINASE DOMAIN-CONTAINING PROTEIN UniProtKB/Swiss-Prot
Pfam Pkinase UniProtKB/Swiss-Prot
PharmGKB MAP2K7 RGD
PhenoGen Map2k7 PhenoGen
PROSITE PROTEIN_KINASE_DOM UniProtKB/Swiss-Prot
PROTEIN_KINASE_ST UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000001047 RatGTEx
SMART S_TKc UniProtKB/Swiss-Prot
Superfamily-SCOP SSF56112 UniProtKB/Swiss-Prot
UniProt A0A0G2K2A1 ENTREZGENE, UniProtKB/TrEMBL
A0A8L2UMW0 ENTREZGENE, UniProtKB/TrEMBL
A6KQ61 ENTREZGENE, UniProtKB/TrEMBL
A6KQ62 ENTREZGENE, UniProtKB/TrEMBL
A6KQ63 ENTREZGENE, UniProtKB/TrEMBL
A6KQ64 ENTREZGENE, UniProtKB/TrEMBL
A6KQ65 ENTREZGENE, UniProtKB/TrEMBL
A6KQ66_RAT UniProtKB/TrEMBL
A6KQ67_RAT UniProtKB/TrEMBL
D3XAM6 ENTREZGENE
MP2K7_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-02-09
Map2k7
mitogen activated protein kinase kinase 7
Symbol and Name status set to provisional
70820 PROVISIONAL
