Symbol:
Yod1
Name:
YOD1 deubiquitinase
RGD ID:
1359726
Description:
Predicted to enable K48-linked deubiquitinase activity; cysteine-type deubiquitinase activity; and ubiquitin protein ligase binding activity. Predicted to be involved in several processes, including ERAD pathway; negative regulation of retrograde protein transport, ER to cytosol; and protein deubiquitination. Predicted to be located in cytoplasm. Orthologous to human YOD1 (YOD1 deubiquitinase); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
HIV-induced protein-7-like protease; hshin7; MGC124915; ubiquitin thioesterase OTU1; YOD1 OTU deubiquinating enzyme 1 homolog; YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae); YOD1 OTU deubiquitinating enzyme 1 homologue; YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
YOD1 (YOD1 deubiquitinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Yod1 (YOD1 deubiquitinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
YOD1 (YOD1 deubiquitinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
YOD1 (YOD1 deubiquitinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
YOD1 (YOD1 deubiquitinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Yod1 (YOD1 deubiquitinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
LHFPL7 (LHFPL tetraspan subfamily member 7) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Yod1 (YOD1 deubiquitinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
YOD1 (YOD1 deubiquitinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
yod1 (YOD1 deubiquitinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
OTU1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4603
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
yod1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 44,727,319 - 44,733,933 (+) NCBI GRCr8 mRatBN7.2 13 42,175,047 - 42,181,661 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 42,174,820 - 42,177,205 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 44,781,884 - 44,783,601 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 46,070,028 - 46,071,745 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 43,314,718 - 43,316,435 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 47,441,296 - 47,443,013 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 47,440,803 - 47,443,188 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 52,529,960 - 52,531,677 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 43,653,274 - 43,654,991 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 43,667,316 - 43,669,034 (+) NCBI Celera 13 42,526,067 - 42,527,784 (+) NCBI Celera Cytogenetic Map 13 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Yod1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of YOD1 mRNA] CTD PMID:31150632 Yod1 Rat (1->4)-beta-D-glucan multiple interactions ISO Yod1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of YOD1 mRNA CTD PMID:36331819 Yod1 Rat 1,2-dimethylhydrazine decreases expression ISO Yod1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of YOD1 mRNA CTD PMID:22206623 Yod1 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of YOD1 mRNA CTD PMID:32145629 Yod1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO YOD1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of YOD1 mRNA CTD PMID:22298810 Yod1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of YOD1 mRNA CTD PMID:32109520 and PMID:33387578 Yod1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Yod1 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of YOD1 mRNA CTD PMID:25975270 Yod1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Yod1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of YOD1 mRNA CTD PMID:21570461 Yod1 Rat 2-hydroxypropanoic acid decreases expression ISO YOD1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of YOD1 mRNA CTD PMID:30851411 Yod1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Yod1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of YOD1 mRNA CTD PMID:20188158 Yod1 Rat 4,4'-sulfonyldiphenol increases expression ISO Yod1 (Mus musculus) 6480464 bisphenol S results in increased expression of YOD1 mRNA CTD PMID:39298647 Yod1 Rat aflatoxin B1 increases expression ISO Yod1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of YOD1 mRNA CTD PMID:19770486 Yod1 Rat aflatoxin M1 decreases expression ISO YOD1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of YOD1 mRNA CTD PMID:30928695 Yod1 Rat aristolochic acid A decreases expression ISO YOD1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of YOD1 mRNA CTD PMID:33212167 Yod1 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of YOD1 gene CTD PMID:33854195 Yod1 Rat benzo[a]pyrene increases expression ISO YOD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of YOD1 mRNA CTD PMID:20064835 Yod1 Rat benzo[a]pyrene decreases methylation ISO YOD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of YOD1 promoter CTD PMID:27901495 Yod1 Rat benzo[a]pyrene diol epoxide I increases expression ISO YOD1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Yod1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Yod1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of YOD1 mRNA CTD PMID:33754040 Yod1 Rat bisphenol A decreases expression ISO YOD1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of YOD1 mRNA CTD PMID:20678512 Yod1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of YOD1 mRNA CTD PMID:32145629 Yod1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of YOD1 mRNA CTD PMID:30816183 and PMID:32528016 Yod1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of YOD1 mRNA CTD PMID:25181051 Yod1 Rat bisphenol F increases expression ISO Yod1 (Mus musculus) 6480464 bisphenol F results in increased expression of YOD1 mRNA CTD PMID:38685157 Yod1 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of YOD1 gene CTD PMID:33854195 Yod1 Rat chlorpyrifos decreases expression ISO Yod1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of YOD1 mRNA CTD PMID:37019170 Yod1 Rat copper atom multiple interactions ISO YOD1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of YOD1 mRNA CTD PMID:20971185 Yod1 Rat copper(0) multiple interactions ISO YOD1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of YOD1 mRNA CTD PMID:20971185 Yod1 Rat curcumin decreases expression ISO YOD1 (Homo sapiens) 6480464 Curcumin results in decreased expression of YOD1 mRNA CTD PMID:38229314 Yod1 Rat cyclosporin A increases expression ISO YOD1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of YOD1 mRNA CTD PMID:25562108 Yod1 Rat Dibutyl phosphate affects expression ISO YOD1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of YOD1 mRNA CTD PMID:37042841 Yod1 Rat dioxygen increases expression ISO Yod1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of YOD1 mRNA CTD PMID:22629407 Yod1 Rat dioxygen multiple interactions ISO Yod1 (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of YOD1 mRNA] CTD PMID:22629407 Yod1 Rat doxorubicin affects expression ISO YOD1 (Homo sapiens) 6480464 Doxorubicin affects the expression of YOD1 mRNA CTD PMID:29803840 Yod1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of YOD1 mRNA CTD PMID:29391264 Yod1 Rat epoxiconazole decreases expression ISO Yod1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of YOD1 mRNA CTD PMID:35436446 Yod1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of YOD1 mRNA CTD PMID:24793618 Yod1 Rat folic acid decreases expression ISO Yod1 (Mus musculus) 6480464 Folic Acid results in decreased expression of YOD1 mRNA CTD PMID:25629700 Yod1 Rat FR900359 increases phosphorylation ISO YOD1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of YOD1 protein CTD PMID:37730182 Yod1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of YOD1 mRNA CTD PMID:33387578 Yod1 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of YOD1 gene CTD PMID:33854195 Yod1 Rat gold atom decreases expression ISO YOD1 (Homo sapiens) 6480464 Gold results in decreased expression of YOD1 mRNA CTD PMID:25523186 Yod1 Rat gold(0) decreases expression ISO YOD1 (Homo sapiens) 6480464 Gold results in decreased expression of YOD1 mRNA CTD PMID:25523186 Yod1 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of YOD1 gene CTD PMID:33854195 Yod1 Rat indometacin decreases expression ISO YOD1 (Homo sapiens) 6480464 Indomethacin results in decreased expression of YOD1 mRNA CTD PMID:16984733 Yod1 Rat iron dichloride increases expression ISO YOD1 (Homo sapiens) 6480464 ferrous chloride results in increased expression of YOD1 mRNA CTD PMID:35984750 Yod1 Rat lead(0) affects methylation ISO YOD1 (Homo sapiens) 6480464 Lead affects the methylation of YOD1 gene CTD PMID:31636367 Yod1 Rat melphalan increases expression ISO YOD1 (Homo sapiens) 6480464 Melphalan results in increased expression of YOD1 mRNA CTD PMID:22363485 Yod1 Rat methylisothiazolinone increases expression ISO YOD1 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of YOD1 mRNA CTD PMID:31629900 Yod1 Rat paracetamol affects expression ISO Yod1 (Mus musculus) 6480464 Acetaminophen affects the expression of YOD1 mRNA CTD PMID:17562736 Yod1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of YOD1 mRNA CTD PMID:33387578 Yod1 Rat pentachlorophenol increases expression ISO Yod1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of YOD1 mRNA CTD PMID:23892564 Yod1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO YOD1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of YOD1 mRNA CTD PMID:27153767 Yod1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Yod1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of YOD1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of YOD1 mRNA CTD PMID:36331819 Yod1 Rat perfluorooctanoic acid increases expression ISO YOD1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of YOD1 mRNA CTD PMID:23978341 Yod1 Rat phenobarbital increases expression ISO Yod1 (Mus musculus) 6480464 Phenobarbital results in increased expression of YOD1 mRNA CTD PMID:19270015 Yod1 Rat pirinixic acid multiple interactions ISO Yod1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of YOD1 mRNA CTD PMID:19710929 Yod1 Rat rac-lactic acid decreases expression ISO YOD1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of YOD1 mRNA CTD PMID:30851411 Yod1 Rat raloxifene multiple interactions ISO Yod1 (Mus musculus) 6480464 [SOD1 protein mutant form affects the susceptibility to Raloxifene Hydrochloride] which results in increased expression of YOD1 mRNA CTD PMID:33269387 Yod1 Rat raloxifene increases expression ISO Yod1 (Mus musculus) 6480464 Raloxifene Hydrochloride results in increased expression of YOD1 mRNA CTD PMID:33269387 Yod1 Rat sodium arsenite increases expression ISO YOD1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of YOD1 mRNA CTD PMID:38568856 Yod1 Rat sodium dodecyl sulfate increases expression ISO YOD1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of YOD1 mRNA CTD PMID:31734321 Yod1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of YOD1 mRNA] CTD PMID:31150632 Yod1 Rat tetrachloromethane increases expression ISO Yod1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of YOD1 mRNA CTD PMID:31919559 Yod1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of YOD1 mRNA CTD PMID:31150632 Yod1 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased methylation of YOD1 gene CTD PMID:33854195 Yod1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of YOD1 mRNA CTD PMID:34492290 Yod1 Rat thiram increases expression ISO YOD1 (Homo sapiens) 6480464 Thiram results in increased expression of YOD1 mRNA CTD PMID:38568856 Yod1 Rat titanium dioxide decreases expression ISO Yod1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of YOD1 mRNA CTD PMID:29264374 Yod1 Rat titanium dioxide increases methylation ISO Yod1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of YOD1 promoter alternative form CTD PMID:35295148 Yod1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of YOD1 mRNA CTD PMID:33387578 Yod1 Rat trichostatin A decreases expression ISO YOD1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of YOD1 mRNA CTD PMID:24935251 Yod1 Rat urethane increases expression ISO YOD1 (Homo sapiens) 6480464 Urethane results in increased expression of YOD1 mRNA CTD PMID:28818685 Yod1 Rat valproic acid affects expression ISO Yod1 (Mus musculus) 6480464 Valproic Acid affects the expression of YOD1 mRNA CTD PMID:17963808 Yod1 Rat valproic acid decreases expression ISO YOD1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of YOD1 mRNA CTD PMID:23179753 and PMID:27188386
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) aflatoxin M1 (ISO) aristolochic acid A (ISO) azoxystrobin (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) chlorpyrifos (EXP,ISO) copper atom (ISO) copper(0) (ISO) curcumin (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) glyphosate (EXP) gold atom (ISO) gold(0) (ISO) imidacloprid (EXP) indometacin (ISO) iron dichloride (ISO) lead(0) (ISO) melphalan (ISO) methylisothiazolinone (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) rac-lactic acid (ISO) raloxifene (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) tetrachloromethane (EXP,ISO) thiabendazole (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) urethane (ISO) valproic acid (ISO)
Biological Process
endoplasmic reticulum unfolded protein response (IBA,ISO,ISS) ERAD pathway (IBA,ISO,ISS) macroautophagy (ISO,ISS) negative regulation of retrograde protein transport, ER to cytosol (ISO) protein K11-linked deubiquitination (ISO,ISS) protein K27-linked deubiquitination (ISO,ISS) protein K29-linked deubiquitination (ISO,ISS) protein K33-linked deubiquitination (ISO,ISS) protein K48-linked deubiquitination (ISO,ISS) protein K63-linked deubiquitination (ISO,ISS) proteolysis (IEA) response to unfolded protein (IEA)
Yod1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 44,727,319 - 44,733,933 (+) NCBI GRCr8 mRatBN7.2 13 42,175,047 - 42,181,661 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 42,174,820 - 42,177,205 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 44,781,884 - 44,783,601 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 46,070,028 - 46,071,745 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 43,314,718 - 43,316,435 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 47,441,296 - 47,443,013 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 47,440,803 - 47,443,188 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 52,529,960 - 52,531,677 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 43,653,274 - 43,654,991 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 43,667,316 - 43,669,034 (+) NCBI Celera 13 42,526,067 - 42,527,784 (+) NCBI Celera Cytogenetic Map 13 q13 NCBI
YOD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 207,043,849 - 207,053,116 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 207,043,849 - 207,052,980 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 207,217,194 - 207,226,461 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 205,283,817 - 205,291,045 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 180,468,698 - 180,475,926 (-) NCBI Celera Cytogenetic Map 1 q32.1 NCBI HuRef 1 177,914,550 - 177,923,681 (-) NCBI HuRef CHM1_1 1 208,489,805 - 208,498,936 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 206,309,040 - 206,318,351 (-) NCBI T2T-CHM13v2.0
Yod1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 130,645,064 - 130,652,093 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 130,645,064 - 130,652,095 (+) Ensembl GRCm39 Ensembl GRCm38 1 130,717,327 - 130,722,073 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 130,717,327 - 130,724,358 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 132,613,904 - 132,618,650 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 132,544,873 - 132,549,566 (+) NCBI MGSCv36 mm8 Celera 1 133,340,721 - 133,345,469 (+) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 56.89 NCBI
YOD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 6,185,650 - 6,194,005 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 6,190,752 - 6,193,284 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 5,749,059 - 5,757,297 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 5,874,444 - 5,882,763 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 5,874,444 - 5,882,058 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 5,808,168 - 5,816,424 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 5,909,780 - 5,918,003 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 5,949,935 - 5,958,184 (-) NCBI UU_Cfam_GSD_1.0
YOD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 67,672,651 - 67,681,826 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 67,672,640 - 67,681,889 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 74,057,174 - 74,061,141 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
YOD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 22,307,703 - 22,311,919 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 22,307,778 - 22,309,716 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 22,949,362 - 22,954,186 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Yod1
.
Predicted Target Of
Count of predictions: 139 Count of miRNA genes: 107 Interacting mature miRNAs: 123 Transcripts: ENSRNOT00000030476 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1300163 Cardf1 Cardiac cell morphology QTL 1 4.18 aorta morphology trait (VT:0000272) artery lesion measurement (CMO:0000975) 13 11929449 45417941 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61339 Bp24 Blood pressure QTL 24 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 5994668 44807491 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 2303032 Bp328 Blood pressure QTL 328 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 41184022 45417941 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 2302275 Gluco37 Glucose level QTL 37 3.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 13 11929449 46193066 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 2301962 Cm72 Cardiac mass QTL 72 4.12 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 13 31241331 58363171 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 738036 Lnnr4 Liver neoplastic nodule remodeling QTL 4 3.64 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 1 42356786 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
RH144599
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 42,173,824 - 42,173,999 (+) MAPPER mRatBN7.2 Rnor_6.0 13 47,439,808 - 47,439,982 NCBI Rnor6.0 Rnor_5.0 13 52,528,472 - 52,528,646 UniSTS Rnor5.0 RGSC_v3.4 13 43,651,786 - 43,651,960 UniSTS RGSC3.4 Celera 13 42,524,579 - 42,524,753 UniSTS RH 3.4 Map 13 111.2 UniSTS Cytogenetic Map 13 q13 UniSTS Cytogenetic Map 13 q24-q25 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030476 ⟹ ENSRNOP00000031836
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 42,174,820 - 42,177,205 (+) Ensembl Rnor_6.0 Ensembl 13 47,440,803 - 47,443,188 (+) Ensembl
RefSeq Acc Id:
NM_001008889 ⟹ NP_001008889
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 44,727,319 - 44,733,933 (+) NCBI mRatBN7.2 13 42,175,047 - 42,181,661 (+) NCBI Rnor_6.0 13 47,441,296 - 47,443,013 (+) NCBI Rnor_5.0 13 52,529,960 - 52,531,677 (+) NCBI RGSC_v3.4 13 43,653,274 - 43,654,991 (+) RGD Celera 13 42,526,067 - 42,527,784 (+) RGD
Sequence:
ATGTGGCGGCTCCGCTGCAAGGCCAAGGGTGGCACCCACGTTTTGCAGGGTCTTTCCAACCGGACCCGCTTACGGGAACTGCAGGGCCAAATCGCCGCTATCACCGGCATCGCTCCTGGCAGTCAGCG
hide sequence
RefSeq Acc Id:
NP_001008889 ⟸ NM_001008889
- UniProtKB:
Q32Q05 (UniProtKB/Swiss-Prot), Q6IE74 (UniProtKB/Swiss-Prot)
- Sequence:
MWRLRCKAKGGTHVLQGLSNRTRLRELQGQIAAITGIAPGSQRILVGYPPECLDLSDRDITLGDLPIQSGDMLIVEEDQTRPKASPAFSKHGAPSYVRETLPVLTRTAVPADNSCLFTSVYYVVEGGV
hide sequence
Ensembl Acc Id:
ENSRNOP00000031836 ⟸ ENSRNOT00000030476
RGD ID: 13698787 Promoter ID: EPDNEW_R9312 Type: single initiation site Name: Yod1_1 Description: YOD1 deubiquitinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 47,440,780 - 47,440,840 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-06-14
Yod1
YOD1 deubiquitinase
Yod1
YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-23
Yod1
YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
Yod1
YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Yod1
YOD1 OTU deubiquitinating enzyme 1 homologue (S. cerevisiae)
hshin7
HIV-induced protein-7-like protease
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-07-29
hshin7
HIV-induced protein-7-like protease
Symbol and Name status set to provisional
70820 PROVISIONAL
