Symbol:
Usp18
Name:
ubiquitin specific peptidase 18
RGD ID:
1359153
Description:
Predicted to enable ISG15-specific peptidase activity; cysteine-type deubiquitinase activity; and molecular adaptor activity. Predicted to be involved in several processes, including antiviral innate immune response; regulation of defense response; and response to stilbenoid. Predicted to act upstream of or within response to bacterium. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be active in cytosol and nucleus. Orthologous to several human genes including USP18 (ubiquitin specific peptidase 18); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC100359614; LOC312688; similar to ubiquitin specific protease UBP43; ubiquitin specific peptidase 18-like; ubl carboxyl-terminal hydrolase 18
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 156,143,770 - 156,171,292 (+) NCBI GRCr8 mRatBN7.2 4 154,471,634 - 154,499,154 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 154,471,592 - 154,499,144 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 160,737,808 - 160,765,283 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 156,521,289 - 156,548,767 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 155,144,802 - 155,172,259 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 153,812,312 - 153,834,374 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 153,805,993 - 153,834,430 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 220,901,558 - 220,922,139 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 157,692,720 - 157,694,884 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 143,317,875 - 143,338,351 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp18 Rat (-)-alpha-phellandrene increases expression ISO USP18 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of USP18 mRNA CTD PMID:25075043 Usp18 Rat (1->4)-beta-D-glucan multiple interactions ISO Usp18 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP18 mRNA CTD PMID:36331819 Usp18 Rat 1,2-dimethylhydrazine increases expression ISO Usp18 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of USP18 mRNA CTD PMID:22206623 Usp18 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO Usp18 (Mus musculus) 6480464 Dinitrochlorobenzene results in increased expression of USP18 mRNA CTD PMID:19647056 Usp18 Rat 17beta-estradiol multiple interactions ISO USP18 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of USP18 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of USP18 mRNA CTD PMID:19619570 and PMID:30165855 Usp18 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of USP18 mRNA CTD PMID:35192832 Usp18 Rat 17beta-estradiol affects expression ISO Usp18 (Mus musculus) 6480464 Estradiol affects the expression of USP18 mRNA CTD PMID:39298647 Usp18 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of USP18 mRNA CTD PMID:32741896 Usp18 Rat 17beta-estradiol increases expression ISO Usp18 (Mus musculus) 6480464 Estradiol results in increased expression of USP18 mRNA CTD PMID:19484750 Usp18 Rat 17beta-estradiol increases expression ISO USP18 (Homo sapiens) 6480464 Estradiol results in increased expression of USP18 mRNA CTD PMID:19619570 and PMID:21185374 Usp18 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of USP18 mRNA CTD PMID:32741896 Usp18 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO USP18 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Usp18 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Usp18 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Usp18 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO USP18 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of USP18 mRNA CTD PMID:19619570 Usp18 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP18 mRNA CTD PMID:33387578 Usp18 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP18 mRNA CTD PMID:34747641 Usp18 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Usp18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of USP18 mRNA CTD PMID:21889950 and PMID:26290441 Usp18 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP18 mRNA CTD PMID:21570461 and PMID:26377647 Usp18 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Usp18 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP18 mRNA CTD PMID:19770486 Usp18 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO USP18 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP18 mRNA CTD PMID:19619570 Usp18 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Usp18 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of USP18 mRNA CTD PMID:16214954 Usp18 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of USP18 mRNA CTD PMID:21346803 Usp18 Rat 2-hydroxypropanoic acid increases expression ISO USP18 (Homo sapiens) 6480464 Lactic Acid results in increased expression of USP18 mRNA CTD PMID:30851411 Usp18 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:32119087 Usp18 Rat 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of USP18 mRNA CTD PMID:27914987 Usp18 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Usp18 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of USP18 mRNA CTD PMID:20188158 Usp18 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO USP18 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP18 mRNA CTD PMID:28628672 Usp18 Rat 3-methylcholanthrene decreases expression ISO Usp18 (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of USP18 mRNA CTD PMID:20713471 Usp18 Rat 3-methylcholanthrene increases expression ISO Usp18 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of USP18 mRNA CTD PMID:29554273 Usp18 Rat 4,4'-diaminodiphenylmethane affects expression ISO Usp18 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of USP18 mRNA CTD PMID:18648102 Usp18 Rat 4,4'-sulfonyldiphenol affects expression ISO Usp18 (Mus musculus) 6480464 bisphenol S affects the expression of USP18 mRNA CTD PMID:39298647 Usp18 Rat 4,4'-sulfonyldiphenol increases methylation ISO Usp18 (Mus musculus) 6480464 bisphenol S results in increased methylation of USP18 exon CTD PMID:33297965 Usp18 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO Usp18 (Mus musculus) 6480464 Oxazolone results in increased expression of USP18 mRNA CTD PMID:19647056 Usp18 Rat 4-hydroxynon-2-enal decreases expression ISO Usp18 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of USP18 mRNA CTD PMID:19191707 Usp18 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of USP18 mRNA CTD PMID:24780913 Usp18 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of USP18 mRNA CTD PMID:31881176 Usp18 Rat Actein increases expression EXP 6480464 actein results in increased expression of USP18 protein CTD PMID:29969672 Usp18 Rat all-trans-retinoic acid affects response to substance ISO USP18 (Homo sapiens) 6480464 USP18 protein affects the susceptibility to Tretinoin CTD PMID:20935222 Usp18 Rat all-trans-retinoic acid decreases expression ISO USP18 (Homo sapiens) 6480464 Tretinoin results in decreased expression of USP18 mRNA CTD PMID:16249480 and PMID:23724009 Usp18 Rat all-trans-retinoic acid decreases response to substance ISO Usp18 (Mus musculus) 6480464 USP18 protein results in decreased susceptibility to Tretinoin CTD PMID:22752428 Usp18 Rat all-trans-retinoic acid increases expression ISO USP18 (Homo sapiens) 6480464 Tretinoin results in increased expression of USP18 mRNA and Tretinoin results in increased expression of USP18 protein CTD PMID:20935222 and PMID:33167477 Usp18 Rat all-trans-retinoic acid increases expression ISO Usp18 (Mus musculus) 6480464 Tretinoin results in increased expression of USP18 mRNA CTD PMID:20935222 Usp18 Rat alpha-phellandrene increases expression ISO USP18 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of USP18 mRNA CTD PMID:25075043 Usp18 Rat aluminium atom decreases expression ISO Usp18 (Mus musculus) 6480464 Aluminum results in decreased expression of USP18 mRNA CTD PMID:37544489 Usp18 Rat aluminium(0) decreases expression ISO Usp18 (Mus musculus) 6480464 Aluminum results in decreased expression of USP18 mRNA CTD PMID:37544489 Usp18 Rat arsane multiple interactions ISO USP18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] which co-treated with Benzo(a)pyrene] results in increased expression of USP18 protein CTD PMID:32802178 Usp18 Rat arsenic atom multiple interactions ISO USP18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] which co-treated with Benzo(a)pyrene] results in increased expression of USP18 protein CTD PMID:32802178 Usp18 Rat benzene increases expression ISO USP18 (Homo sapiens) 6480464 Benzene results in increased expression of USP18 mRNA CTD PMID:20359517 Usp18 Rat benzo[a]pyrene decreases expression ISO Usp18 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of USP18 mRNA CTD PMID:20713471 Usp18 Rat benzo[a]pyrene multiple interactions ISO USP18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] which co-treated with Benzo(a)pyrene] results in increased expression of USP18 protein CTD PMID:32802178 Usp18 Rat benzo[a]pyrene increases expression ISO Usp18 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of USP18 mRNA CTD PMID:23735875 Usp18 Rat bis(2-ethylhexyl) phthalate increases expression ISO Usp18 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of USP18 mRNA CTD PMID:27405655 Usp18 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Usp18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of USP18 mRNA CTD PMID:39150890 Usp18 Rat bis(2-ethylhexyl) phthalate increases expression ISO USP18 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of USP18 mRNA CTD PMID:31163220 Usp18 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP18 mRNA CTD PMID:25181051 and PMID:35192832 Usp18 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of USP18 mRNA CTD PMID:32145629 Usp18 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP18 mRNA CTD PMID:30816183 and PMID:32528016 Usp18 Rat bisphenol A multiple interactions ISO USP18 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP18 mRNA CTD PMID:28628672 Usp18 Rat bisphenol A decreases methylation ISO Usp18 (Mus musculus) 6480464 bisphenol A results in decreased methylation of USP18 promoter CTD PMID:27312807 Usp18 Rat bisphenol A affects methylation EXP 6480464 bisphenol A affects the methylation of USP18 promoter CTD PMID:27415467 Usp18 Rat Butylbenzyl phthalate multiple interactions ISO Usp18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of USP18 mRNA CTD PMID:39150890 Usp18 Rat cadmium atom multiple interactions ISO Usp18 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of USP18 mRNA CTD PMID:31904401 Usp18 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of USP18 promoter CTD PMID:22457795 Usp18 Rat cadmium dichloride multiple interactions ISO Usp18 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of USP18 mRNA CTD PMID:31904401 Usp18 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of USP18 mRNA CTD PMID:25993096 Usp18 Rat carbon nanotube decreases expression ISO Usp18 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Usp18 Rat carbon nanotube increases expression ISO Usp18 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Usp18 Rat chlordecone decreases expression ISO Usp18 (Mus musculus) 6480464 Chlordecone results in decreased expression of USP18 mRNA CTD PMID:33711761 Usp18 Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of USP18 mRNA CTD PMID:23125180 Usp18 Rat chromium(6+) affects expression ISO Usp18 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of USP18 mRNA CTD PMID:28472532 Usp18 Rat cisplatin decreases response to substance ISO Usp18 (Mus musculus) 6480464 USP18 protein results in decreased susceptibility to Cisplatin CTD PMID:22752428 Usp18 Rat cisplatin multiple interactions ISO USP18 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of USP18 mRNA CTD PMID:27392435 Usp18 Rat cisplatin increases expression ISO USP18 (Homo sapiens) 6480464 Cisplatin results in increased expression of USP18 mRNA CTD PMID:27392435 Usp18 Rat clofibrate multiple interactions ISO Usp18 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of USP18 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of USP18 mRNA] CTD PMID:17585979 Usp18 Rat clofibrate decreases expression ISO Usp18 (Mus musculus) 6480464 Clofibrate results in decreased expression of USP18 mRNA CTD PMID:23811191 Usp18 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of USP18 mRNA CTD PMID:17602206 Usp18 Rat cobalt dichloride decreases expression ISO USP18 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of USP18 mRNA CTD PMID:19320972 Usp18 Rat copper(II) sulfate decreases expression ISO USP18 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of USP18 mRNA CTD PMID:19549813 Usp18 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of USP18 mRNA CTD PMID:27523638 Usp18 Rat cyclosporin A increases expression ISO USP18 (Homo sapiens) 6480464 Cyclosporine results in increased expression of USP18 mRNA CTD PMID:22147139 Usp18 Rat DDE increases expression ISO USP18 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of USP18 mRNA CTD PMID:38568856 Usp18 Rat dexamethasone multiple interactions ISO USP18 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP18 mRNA CTD PMID:28628672 Usp18 Rat Dibutyl phosphate affects expression ISO USP18 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP18 mRNA CTD PMID:37042841 Usp18 Rat dibutyl phthalate multiple interactions ISO Usp18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of USP18 mRNA CTD PMID:39150890 Usp18 Rat dichloromethane increases expression ISO USP18 (Homo sapiens) 6480464 Methylene Chloride results in increased expression of USP18 mRNA CTD PMID:20359517 Usp18 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of USP18 mRNA CTD PMID:34051100 Usp18 Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of USP18 mRNA CTD PMID:21161181 Usp18 Rat diethyl phthalate multiple interactions ISO Usp18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of USP18 mRNA CTD PMID:39150890 Usp18 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of USP18 mRNA CTD PMID:21658437 Usp18 Rat diisobutyl phthalate multiple interactions ISO Usp18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of USP18 mRNA CTD PMID:39150890 Usp18 Rat diisononyl phthalate multiple interactions ISO Usp18 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of USP18 mRNA CTD PMID:39150890 Usp18 Rat dioxygen multiple interactions EXP 6480464 [dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of USP18 mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of USP18 mRNA CTD PMID:33729688 Usp18 Rat dorsomorphin multiple interactions ISO USP18 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP18 mRNA CTD PMID:27188386 Usp18 Rat doxorubicin decreases expression ISO USP18 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of USP18 mRNA CTD PMID:29803840 Usp18 Rat ethylbenzene increases expression ISO USP18 (Homo sapiens) 6480464 ethylbenzene results in increased expression of USP18 mRNA CTD PMID:20359517 Usp18 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of USP18 mRNA CTD PMID:24136188 Usp18 Rat folic acid increases expression ISO Usp18 (Mus musculus) 6480464 Folic Acid results in increased expression of USP18 mRNA CTD PMID:25629700 Usp18 Rat fumonisin B1 increases expression ISO Usp18 (Mus musculus) 6480464 fumonisin B1 results in increased expression of USP18 mRNA CTD PMID:16221962 Usp18 Rat Genipin multiple interactions ISO Usp18 (Mus musculus) 6480464 genipin inhibits the reaction [Lipopolysaccharides results in increased expression of USP18 mRNA] CTD PMID:22687549 Usp18 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP18 mRNA CTD PMID:33387578 Usp18 Rat GW 4064 decreases expression ISO Usp18 (Mus musculus) 6480464 GW 4064 results in decreased expression of USP18 mRNA CTD PMID:26655953 Usp18 Rat indometacin multiple interactions ISO USP18 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP18 mRNA CTD PMID:28628672 Usp18 Rat inulin multiple interactions ISO Usp18 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of USP18 mRNA CTD PMID:36331819 Usp18 Rat iohexol decreases expression ISO USP18 (Homo sapiens) 6480464 Iohexol results in decreased expression of USP18 mRNA CTD PMID:29705293 Usp18 Rat iopamidol decreases expression ISO USP18 (Homo sapiens) 6480464 Iopamidol results in decreased expression of USP18 mRNA CTD PMID:29705293 Usp18 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of USP18 mRNA CTD PMID:22641619 Usp18 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of USP18 mRNA CTD PMID:35283115 Usp18 Rat lipopolysaccharide multiple interactions ISO Usp18 (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [Lipopolysaccharides results in increased expression of USP18 mRNA] and genipin inhibits the reaction [Lipopolysaccharides results in increased expression of USP18 mRNA] CTD PMID:22687549 and PMID:25890327 Usp18 Rat lipopolysaccharide increases expression ISO USP18 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of USP18 mRNA and Lipopolysaccharides results in increased expression of USP18 protein CTD PMID:33930521 and PMID:35811015 Usp18 Rat lipopolysaccharide multiple interactions ISO USP18 (Homo sapiens) 6480464 monophosphoryl lipid A inhibits the reaction [USP18 protein inhibits the reaction [Lipopolysaccharides results in decreased activity of CAT protein]] more ... CTD PMID:33930521 and PMID:35811015 Usp18 Rat lipopolysaccharide increases expression ISO Usp18 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of USP18 mRNA and Lipopolysaccharides results in increased expression of USP18 protein CTD PMID:22687549 more ... Usp18 Rat manganese atom increases expression ISO Usp18 (Mus musculus) 6480464 Manganese results in increased expression of USP18 mRNA CTD PMID:23499988 Usp18 Rat manganese(0) increases expression ISO Usp18 (Mus musculus) 6480464 Manganese results in increased expression of USP18 mRNA CTD PMID:23499988 Usp18 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of USP18 mRNA CTD PMID:28801915 Usp18 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of USP18 mRNA CTD PMID:30467583 Usp18 Rat methotrexate affects expression ISO Usp18 (Mus musculus) 6480464 Methotrexate affects the expression of USP18 mRNA CTD PMID:18502557 Usp18 Rat methylmercury chloride increases expression ISO USP18 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of USP18 mRNA CTD PMID:28001369 Usp18 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of USP18 mRNA CTD PMID:28801915 Usp18 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of USP18 mRNA CTD PMID:17602206 Usp18 Rat nickel atom increases expression ISO USP18 (Homo sapiens) 6480464 Nickel results in increased expression of USP18 mRNA CTD PMID:24768652 Usp18 Rat nickel sulfate increases expression ISO USP18 (Homo sapiens) 6480464 nickel sulfate results in increased expression of USP18 mRNA CTD PMID:22714537 Usp18 Rat o-xylene increases expression ISO USP18 (Homo sapiens) 6480464 2-xylene results in increased expression of USP18 mRNA CTD PMID:20359517 Usp18 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of USP18 mRNA CTD PMID:23665939 Usp18 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of USP18 mRNA CTD PMID:25729387 Usp18 Rat paracetamol multiple interactions ISO Usp18 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of USP18 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of USP18 mRNA] CTD PMID:17585979 Usp18 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of USP18 mRNA CTD PMID:33387578 Usp18 Rat paracetamol decreases expression ISO USP18 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of USP18 mRNA CTD PMID:29067470 Usp18 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of USP18 mRNA CTD PMID:32680482 Usp18 Rat pentachlorophenol increases expression ISO Usp18 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of USP18 mRNA CTD PMID:23892564 Usp18 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp18 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP18 mRNA more ... CTD PMID:36331819 Usp18 Rat perfluorooctanoic acid decreases expression ISO USP18 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of USP18 mRNA CTD PMID:37738295 Usp18 Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of USP18 mRNA CTD PMID:31324951 Usp18 Rat phenobarbital multiple interactions ISO Usp18 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of USP18 mRNA] CTD PMID:19482888 Usp18 Rat phenobarbital increases expression ISO Usp18 (Mus musculus) 6480464 Phenobarbital results in increased expression of USP18 mRNA CTD PMID:19482888 Usp18 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Usp18 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of USP18 mRNA CTD PMID:31904401 Usp18 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Usp18 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of USP18 mRNA CTD PMID:28903501 Usp18 Rat propiconazole increases expression ISO Usp18 (Mus musculus) 6480464 propiconazole results in increased expression of USP18 mRNA CTD PMID:21278054 Usp18 Rat rac-lactic acid increases expression ISO USP18 (Homo sapiens) 6480464 Lactic Acid results in increased expression of USP18 mRNA CTD PMID:30851411 Usp18 Rat resveratrol multiple interactions ISO Usp18 (Mus musculus) 6480464 resveratrol inhibits the reaction [Dietary Fats affects the expression of USP18 mRNA] CTD PMID:17086191 Usp18 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of USP18 mRNA CTD PMID:28374803 Usp18 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO USP18 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of USP18 mRNA] CTD PMID:35811015 Usp18 Rat SB 431542 multiple interactions ISO USP18 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP18 mRNA CTD PMID:27188386 Usp18 Rat silver atom affects expression ISO Usp18 (Mus musculus) 6480464 Silver affects the expression of USP18 mRNA CTD PMID:27131904 Usp18 Rat silver(0) affects expression ISO Usp18 (Mus musculus) 6480464 Silver affects the expression of USP18 mRNA CTD PMID:27131904 Usp18 Rat sodium arsenite multiple interactions ISO USP18 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] which co-treated with Benzo(a)pyrene] results in increased expression of USP18 protein CTD PMID:32802178 Usp18 Rat Soman increases expression EXP 6480464 Soman results in increased expression of USP18 mRNA CTD PMID:19281266 Usp18 Rat succimer multiple interactions ISO Usp18 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of USP18 mRNA CTD PMID:21641980 Usp18 Rat sunitinib increases expression ISO USP18 (Homo sapiens) 6480464 Sunitinib results in increased expression of USP18 mRNA CTD PMID:31533062 Usp18 Rat tamoxifen affects expression ISO Usp18 (Mus musculus) 6480464 Tamoxifen affects the expression of USP18 mRNA CTD PMID:20937368 Usp18 Rat temozolomide increases expression ISO USP18 (Homo sapiens) 6480464 Temozolomide results in increased expression of USP18 mRNA CTD PMID:31758290 Usp18 Rat tenofovir disoproxil fumarate increases expression EXP 6480464 Tenofovir results in increased expression of USP18 mRNA CTD PMID:37852574 Usp18 Rat tert-butyl hydroperoxide increases expression ISO Usp18 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of USP18 mRNA CTD PMID:15003993 Usp18 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of USP18 mRNA CTD PMID:32741896 Usp18 Rat tetraphene decreases expression ISO Usp18 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of USP18 mRNA CTD PMID:26377693 Usp18 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of USP18 mRNA CTD PMID:23411599 Usp18 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of USP18 mRNA CTD PMID:34492290 Usp18 Rat titanium dioxide increases expression ISO Usp18 (Mus musculus) 6480464 titanium dioxide results in increased expression of USP18 mRNA CTD PMID:23557971 and PMID:27760801 Usp18 Rat titanium dioxide decreases methylation ISO Usp18 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP18 gene CTD PMID:35295148 Usp18 Rat tofacitinib decreases expression ISO USP18 (Homo sapiens) 6480464 tofacitinib results in decreased expression of USP18 mRNA CTD PMID:25487280 Usp18 Rat toluene increases expression ISO USP18 (Homo sapiens) 6480464 Toluene results in increased expression of USP18 mRNA CTD PMID:20359517 and PMID:28245982 Usp18 Rat toluene 2,4-diisocyanate increases expression ISO Usp18 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of USP18 mRNA CTD PMID:19647056 Usp18 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of USP18 mRNA CTD PMID:25729387 Usp18 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of USP18 mRNA CTD PMID:25729387 Usp18 Rat trichloroethene increases expression ISO USP18 (Homo sapiens) 6480464 Trichloroethylene results in increased expression of USP18 mRNA CTD PMID:20359517 Usp18 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of USP18 mRNA CTD PMID:33387578 Usp18 Rat triphenyl phosphate affects expression ISO USP18 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP18 mRNA CTD PMID:37042841 Usp18 Rat trovafloxacin increases expression ISO Usp18 (Mus musculus) 6480464 trovafloxacin results in increased expression of USP18 mRNA CTD PMID:35537566 Usp18 Rat tungsten increases expression ISO Usp18 (Mus musculus) 6480464 Tungsten results in increased expression of USP18 mRNA CTD PMID:30912803 Usp18 Rat tunicamycin increases expression ISO USP18 (Homo sapiens) 6480464 Tunicamycin results in increased expression of USP18 mRNA CTD PMID:38498338 Usp18 Rat urethane decreases expression ISO USP18 (Homo sapiens) 6480464 Urethane results in decreased expression of USP18 mRNA CTD PMID:28818685 Usp18 Rat valproic acid multiple interactions ISO USP18 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP18 mRNA CTD PMID:27188386 Usp18 Rat valproic acid increases expression ISO USP18 (Homo sapiens) 6480464 Valproic Acid results in increased expression of USP18 mRNA CTD PMID:28001369 Usp18 Rat zidovudine multiple interactions ISO USP18 (Homo sapiens) 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of USP18 mRNA CTD PMID:20370541 Usp18 Rat zinc atom increases expression ISO USP18 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of USP18 mRNA CTD PMID:18356318 Usp18 Rat zinc(0) increases expression ISO USP18 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of USP18 mRNA CTD PMID:18356318
(-)-alpha-phellandrene (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) Actein (EXP) all-trans-retinoic acid (ISO) alpha-phellandrene (ISO) aluminium atom (ISO) aluminium(0) (ISO) arsane (ISO) arsenic atom (ISO) benzene (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) chlordecone (ISO) chloroprene (EXP) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) clofibric acid (EXP) cobalt dichloride (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichloromethane (ISO) dieldrin (EXP) diethyl maleate (EXP) diethyl phthalate (ISO) diethylstilbestrol (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethylbenzene (ISO) flutamide (EXP) folic acid (ISO) fumonisin B1 (ISO) Genipin (ISO) gentamycin (EXP) GW 4064 (ISO) indometacin (ISO) inulin (ISO) iohexol (ISO) iopamidol (ISO) lead diacetate (EXP) lidocaine (EXP) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (EXP) methapyrilene (EXP) methotrexate (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) nickel sulfate (ISO) o-xylene (ISO) orphenadrine (EXP) oxaliplatin (EXP) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenformin (EXP) phenobarbital (ISO) phorbol 13-acetate 12-myristate (ISO) pregnenolone 16alpha-carbonitrile (ISO) propiconazole (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) Soman (EXP) succimer (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) tenofovir disoproxil fumarate (EXP) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) tofacitinib (ISO) toluene (ISO) toluene 2,4-diisocyanate (ISO) topotecan (EXP) trichloroethene (EXP,ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) tungsten (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) zidovudine (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
UBP43 (USP18) specifically removes ISG15 from conjugated proteins.
Malakhov MP, etal., J Biol Chem 2002 Mar 22;277(12):9976-81. Epub 2002 Jan 11.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Hepatic IFNL4 expression is associated with non-response to interferon-based therapy through the regulation of basal interferon-stimulated gene expression in chronic hepatitis C patients.
Murakawa M, etal., J Med Virol. 2017 Jul;89(7):1241-1247. doi: 10.1002/jmv.24763. Epub 2017 Feb 27.
5.
GOA pipeline
RGD automated data pipeline
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Usp18 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 156,143,770 - 156,171,292 (+) NCBI GRCr8 mRatBN7.2 4 154,471,634 - 154,499,154 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 154,471,592 - 154,499,144 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 160,737,808 - 160,765,283 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 156,521,289 - 156,548,767 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 155,144,802 - 155,172,259 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 153,812,312 - 153,834,374 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 153,805,993 - 153,834,430 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 220,901,558 - 220,922,139 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 157,692,720 - 157,694,884 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 143,317,875 - 143,338,351 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
USP18 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 18,150,170 - 18,177,397 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 18,149,843 - 18,177,397 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 18,632,937 - 18,660,164 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 17,012,758 - 17,040,164 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 17,007,311 - 17,034,714 NCBI Celera 22 2,251,821 - 2,269,866 (+) NCBI Celera Cytogenetic Map 22 q11.21 NCBI HuRef 22 2,445,183 - 2,472,579 (+) NCBI HuRef CHM1_1 22 18,632,478 - 18,659,884 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 18,822,080 - 18,849,307 (+) NCBI T2T-CHM13v2.0
Usp18 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 121,222,865 - 121,247,876 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 121,222,865 - 121,247,876 (+) Ensembl GRCm39 Ensembl GRCm38 6 121,245,906 - 121,270,917 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 121,245,906 - 121,270,917 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 121,195,924 - 121,220,935 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 121,211,575 - 121,236,536 (+) NCBI MGSCv36 mm8 Celera 6 123,079,923 - 123,105,170 (+) NCBI Celera Cytogenetic Map 6 F1 NCBI cM Map 6 57.17 NCBI
Usp18 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 6,171,569 - 6,203,091 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 6,171,575 - 6,200,879 (+) NCBI ChiLan1.0 ChiLan1.0
USP18 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 28,464,266 - 28,491,820 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 31,012,239 - 31,041,912 (+) NCBI NHGRI_mPanPan1
USP18 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 45,739,845 - 45,814,668 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 868,159 - 943,927 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 46,107,395 - 46,183,398 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 46,106,886 - 46,183,378 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 46,041,070 - 46,116,807 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 46,008,145 - 46,083,815 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 223,830 - 299,560 (-) NCBI UU_Cfam_GSD_1.0
Usp18 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 109,829,924 - 109,854,928 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936807 1,090,882 - 1,114,770 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936807 1,090,928 - 1,116,166 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP18 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 70,183,308 - 70,229,572 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 70,183,321 - 70,227,990 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 72,536,548 - 72,595,957 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
Usp18
.
Predicted Target Of
Count of predictions: 194 Count of miRNA genes: 143 Interacting mature miRNAs: 157 Transcripts: ENSRNOT00000056174 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 61446 Coreg2 Compensatory renal growth QTL 2 3.5 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 4 148423102 157580971 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1581574 Eae20 Experimental allergic encephalomyelitis QTL 20 7.8 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 4 153031106 158841762 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
RH130260
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 154,498,940 - 154,499,122 (+) MAPPER mRatBN7.2 Rnor_6.0 4 153,834,161 - 153,834,342 NCBI Rnor6.0 Rnor_5.0 4 220,921,926 - 220,922,107 UniSTS Rnor5.0 RGSC_v3.4 4 157,694,671 - 157,694,852 UniSTS RGSC3.4 Celera 4 143,338,138 - 143,338,319 UniSTS RH 3.4 Map 4 993.9 UniSTS Cytogenetic Map 4 q42 UniSTS
RH144655
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 156,151,896 - 156,152,050 (+) Marker Load Pipeline mRatBN7.2 4 154,479,755 - 154,479,909 (+) MAPPER mRatBN7.2 Rnor_6.0 4 153,814,052 - 153,814,205 NCBI Rnor6.0 Rnor_5.0 4 220,903,298 - 220,903,451 UniSTS Rnor5.0 Celera 4 143,319,615 - 143,319,768 UniSTS RH 3.4 Map 4 994.2 UniSTS Cytogenetic Map 4 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000056174 ⟹ ENSRNOP00000053020
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 154,471,592 - 154,499,144 (+) Ensembl Rnor_6.0 Ensembl 4 153,805,993 - 153,834,430 (+) Ensembl
RefSeq Acc Id:
NM_001014058 ⟹ NP_001014080
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 156,143,826 - 156,171,292 (+) NCBI mRatBN7.2 4 154,471,685 - 154,499,154 (+) NCBI Rnor_6.0 4 153,812,312 - 153,834,374 (+) NCBI Rnor_5.0 4 220,901,558 - 220,922,139 (+) NCBI RGSC_v3.4 4 157,692,720 - 157,694,884 (+) RGD Celera 4 143,317,875 - 143,338,351 (+) RGD
Sequence:
GCTTCGGTGCTTGAGAGGGTCCTTTCTGGCTTGTGTAGACCCTTCCTGGAAGTGAAGTTGTGGAATCCTGACCTCCAGTCCTGCCCGTTCCAAGCGTGGGGTTTGGGTGTGATCACTAATGGGCAAAG
hide sequence
RefSeq Acc Id:
XM_039107665 ⟹ XP_038963593
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 156,143,789 - 156,171,292 (+) NCBI mRatBN7.2 4 154,471,648 - 154,499,154 (+) NCBI
RefSeq Acc Id:
XM_039107666 ⟹ XP_038963594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 156,143,770 - 156,166,202 (+) NCBI mRatBN7.2 4 154,471,634 - 154,493,887 (+) NCBI
RefSeq Acc Id:
NP_001014080 ⟸ NM_001014058
- UniProtKB:
Q6AYC7 (UniProtKB/TrEMBL), F1LNS1 (UniProtKB/TrEMBL)
- Sequence:
MGKGFGLLRKTCQSVVANPQQHSALEEEKNMKRKRVLSRELCSAWDRPHGFVGLHNIGQTCCLNSLIQVFMMNVDFRMVLKRITVPRGAEEQKRSVPFQLLLLLEKMQDSRQKAVLPTELVQCLQKYN
hide sequence
Ensembl Acc Id:
ENSRNOP00000053020 ⟸ ENSRNOT00000056174
RefSeq Acc Id:
XP_038963594 ⟸ XM_039107666
- Peptide Label:
isoform X2
- UniProtKB:
A6ILC0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038963593 ⟸ XM_039107665
- Peptide Label:
isoform X1
- UniProtKB:
A6ILC1 (UniProtKB/TrEMBL)
RGD ID: 13693363 Promoter ID: EPDNEW_R3887 Type: multiple initiation site Name: Usp18_1 Description: ubiquitin specific peptidase 18 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 153,805,985 - 153,806,045 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-07-29
Usp18
ubiquitin specific peptidase 18
LOC100359614
ubiquitin specific peptidase 18-like
Data merged from RGD:2699571
737654 PROVISIONAL
2010-07-02
LOC100359614
ubiquitin specific peptidase 18-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-03-30
Usp18
ubiquitin specific peptidase 18
LOC312688
similar to ubiquitin specific protease UBP43
Symbol and Name updated
1299863 APPROVED
2005-07-29
LOC312688
similar to ubiquitin specific protease UBP43
Symbol and Name status set to provisional
70820 PROVISIONAL
