Usp18 (ubiquitin specific peptidase 18)

Gene: Usp18 (ubiquitin specific peptidase 18) Rattus norvegicus

Analyze

Symbol:

Usp18

Name:

ubiquitin specific peptidase 18

RGD ID:

1359153

Description:

Predicted to enable ISG15-specific peptidase activity; cysteine-type deubiquitinase activity; and molecular adaptor activity. Predicted to be involved in antiviral innate immune response; regulation of defense response; and response to stilbenoid. Predicted to act upstream of or within response to bacterium. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be active in cytosol and nucleus. Orthologous to several human genes including USP18 (ubiquitin specific peptidase 18); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100359614; LOC312688; similar to ubiquitin specific protease UBP43; ubiquitin specific peptidase 18-like; ubl carboxyl-terminal hydrolase 18

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	156,143,770 - 156,171,292 (+)	NCBI		GRCr8
mRatBN7.2	4	154,471,634 - 154,499,154 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	154,471,592 - 154,499,144 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	160,737,808 - 160,765,283 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	156,521,289 - 156,548,767 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	155,144,802 - 155,172,259 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	153,812,312 - 153,834,374 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	153,805,993 - 153,834,430 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	220,901,558 - 220,922,139 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	157,692,720 - 157,694,884 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	143,317,875 - 143,338,351 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acute Lung Injury (ISO)

Aicardi-Goutieres syndrome (ISO)

Chronic Hepatitis C (ISO)

DiGeorge syndrome (ISO)

genetic disease (ISO)

immunodeficiency 51 (ISO)

leiomyosarcoma (ISO)

Lung Neoplasms (ISO)

Neurodevelopmental Disorders (ISO)

Polyarteritis Nodosa, Childhood-Onset (ISO)

Pseudo-TORCH Syndrome 2 (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxynon-2-enal (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

Actein (EXP)

all-trans-retinoic acid (ISO)

alpha-phellandrene (ISO)

aluminium atom (ISO)

aluminium(0) (ISO)

arsane (ISO)

arsenic atom (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroprene (EXP)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dichloromethane (ISO)

dieldrin (EXP)

diethyl maleate (EXP)

diethylstilbestrol (EXP)

dioxygen (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

ethylbenzene (ISO)

flutamide (EXP)

folic acid (ISO)

fumonisin B1 (ISO)

Genipin (ISO)

gentamycin (EXP)

GW 4064 (ISO)

indometacin (ISO)

inulin (ISO)

iohexol (ISO)

iopamidol (ISO)

lead diacetate (EXP)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (EXP)

methapyrilene (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

o-xylene (ISO)

orphenadrine (EXP)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenformin (EXP)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tenofovir disoproxil fumarate (EXP)

tert-butyl hydroperoxide (ISO)

testosterone (EXP)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tofacitinib (ISO)

toluene (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

trichloroethene (EXP,ISO)

trovafloxacin (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

zidovudine (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antiviral innate immune response (ISO)

negative regulation of type I interferon-mediated signaling pathway (ISO)

proteolysis (IEA)

regulation of inflammatory response (ISO)

response to bacterium (ISO)

response to stilbenoid (ISO)

Cellular Component

cytosol (IBA,ISO)

intracellular membrane-bounded organelle (ISO)

nucleus (IBA,ISO)

Molecular Function

cysteine-type deubiquitinase activity (IBA)

ISG15-specific peptidase activity (ISO)

molecular adaptor activity (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	UBP43 (USP18) specifically removes ISG15 from conjugated proteins.	Malakhov MP, etal., J Biol Chem 2002 Mar 22;277(12):9976-81. Epub 2002 Jan 11.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Hepatic IFNL4 expression is associated with non-response to interferon-based therapy through the regulation of basal interferon-stimulated gene expression in chronic hepatitis C patients.	Murakawa M, etal., J Med Virol. 2017 Jul;89(7):1241-1247. doi: 10.1002/jmv.24763. Epub 2017 Feb 27.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:16139798	PMID:16382139	PMID:17086191	PMID:23012479	PMID:27325888	PMID:37356565

Genomics

Comparative Map Data

Usp18
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	156,143,770 - 156,171,292 (+)	NCBI		GRCr8
mRatBN7.2	4	154,471,634 - 154,499,154 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	154,471,592 - 154,499,144 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	160,737,808 - 160,765,283 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	156,521,289 - 156,548,767 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	155,144,802 - 155,172,259 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	153,812,312 - 153,834,374 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	153,805,993 - 153,834,430 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	220,901,558 - 220,922,139 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	157,692,720 - 157,694,884 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	143,317,875 - 143,338,351 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

USP18
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	18,150,170 - 18,177,397 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	18,150,118 - 18,177,397 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	18,632,937 - 18,660,164 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	17,012,758 - 17,040,164 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	17,007,311 - 17,034,714	NCBI
Celera	22	2,251,821 - 2,269,866 (+)	NCBI		Celera
Cytogenetic Map	22	q11.21	NCBI
HuRef	22	2,445,183 - 2,472,579 (+)	NCBI		HuRef
CHM1_1	22	18,632,478 - 18,659,884 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	18,822,080 - 18,849,307 (+)	NCBI		T2T-CHM13v2.0

Usp18
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	121,222,865 - 121,247,876 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	121,222,865 - 121,247,876 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	121,245,906 - 121,270,917 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	121,245,906 - 121,270,917 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	121,195,924 - 121,220,935 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	121,211,575 - 121,236,536 (+)	NCBI		MGSCv36	mm8
Celera	6	123,079,923 - 123,105,170 (+)	NCBI		Celera
Cytogenetic Map	6	F1	NCBI
cM Map	6	57.17	NCBI

Usp18
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955454	6,171,569 - 6,203,091 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955454	6,171,575 - 6,200,879 (+)	NCBI	ChiLan1.0	ChiLan1.0

USP18
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	28,464,266 - 28,491,820 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	31,012,239 - 31,041,912 (+)	NCBI		NHGRI_mPanPan1

USP18
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	45,739,845 - 45,814,668 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	868,159 - 943,927 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	46,107,395 - 46,183,398 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	46,106,886 - 46,183,378 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	46,041,070 - 46,116,807 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	46,008,145 - 46,083,815 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	223,830 - 299,560 (-)	NCBI		UU_Cfam_GSD_1.0

Usp18
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	109,829,924 - 109,854,928 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936807	1,090,882 - 1,114,770 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936807	1,090,928 - 1,116,166 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

USP18
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	70,183,308 - 70,229,572 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	70,183,321 - 70,227,990 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	72,536,548 - 72,595,957 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Usp18
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624735	9,158,597 - 9,187,503 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Usp18
24 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	194
Count of miRNA genes:	143
Interacting mature miRNAs:	157
Transcripts:	ENSRNOT00000056174
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	147278504	167139601	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	148090542	168069246	Rat
61446	Coreg2	Compensatory renal growth QTL 2	3.5		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	4	148423102	157580971	Rat
1581574	Eae20	Experimental allergic encephalomyelitis QTL 20	7.8		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	153031106	158841762	Rat

Markers in Region

RH130260

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	154,498,940 - 154,499,122 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	153,834,161 - 153,834,342	NCBI	Rnor6.0
Rnor_5.0	4	220,921,926 - 220,922,107	UniSTS	Rnor5.0
RGSC_v3.4	4	157,694,671 - 157,694,852	UniSTS	RGSC3.4
Celera	4	143,338,138 - 143,338,319	UniSTS
RH 3.4 Map	4	993.9	UniSTS
Cytogenetic Map	4	q42	UniSTS

RH144655

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	154,479,755 - 154,479,909 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	153,814,052 - 153,814,205	NCBI	Rnor6.0
Rnor_5.0	4	220,903,298 - 220,903,451	UniSTS	Rnor5.0
Celera	4	143,319,615 - 143,319,768	UniSTS
RH 3.4 Map	4	994.2	UniSTS
Cytogenetic Map	4	q42	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		9	18	10	18	10				4	6	9
Low	3	22	39	31	1	31	8	11	56	17	31	2	8
Below cutoff		12							18	14	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233818	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000056174 ⟹ ENSRNOP00000053020

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	154,471,592 - 154,499,144 (+)	Ensembl
Rnor_6.0 Ensembl	4	153,805,993 - 153,834,430 (+)	Ensembl

RefSeq Acc Id:

NM_001014058 ⟹ NP_001014080

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	156,143,826 - 156,171,292 (+)	NCBI
mRatBN7.2	4	154,471,685 - 154,499,154 (+)	NCBI
Rnor_6.0	4	153,812,312 - 153,834,374 (+)	NCBI
Rnor_5.0	4	220,901,558 - 220,922,139 (+)	NCBI
RGSC_v3.4	4	157,692,720 - 157,694,884 (+)	RGD
Celera	4	143,317,875 - 143,338,351 (+)	RGD

Sequence:

show sequence

GCTTCGGTGCTTGAGAGGGTCCTTTCTGGCTTGTGTAGACCCTTCCTGGAAGTGAAGTTGTGGA
ATCCTGACCTCCAGTCCTGCCCGTTCCAAGCGTGGGGTTTGGGTGTGATCACTAATGGGCAAAG
GGTTTGGGCTCCTGAGGAAAACCTGCCAGTCAGTTGTGGCTAATCCTCAGCAGCACTCAGCTCT
GGAGGAAGAGAAGAACATGAAGAGGAAGAGAGTGCTGTCTAGAGAGCTCTGCAGTGCCTGGGAC
CGCCCTCATGGTTTCGTTGGGTTACACAACATCGGTCAGACATGTTGCCTTAACTCCTTGATTC
AGGTGTTCATGATGAATGTGGACTTCAGGATGGTATTGAAGAGGATAACAGTGCCACGAGGGGC
AGAAGAACAGAAGAGAAGTGTCCCCTTCCAGCTGCTTTTGCTGCTGGAGAAGATGCAGGACAGC
CGGCAGAAGGCAGTGCTGCCCACGGAGCTCGTTCAGTGCCTCCAGAAATACAACGTGCCATTGT
TTGTCCAGCACGATGCTGCTCATCTCTTCCTTACAATCTGGAACCTGACTAAGGACCAGATCAC
GGACATAGACTTGGCAGAGCGGCTGCAGGATCTGTTCACAATCTGGACCGAGGAGTCCCTGATG
TGCGTGGGCTGTGGAGCAGAGAGCAGCAGGAGGGGCAAGTTGCTCACTCTCTCTCTTCCTCTTT
TTGATATGGATTCAAAGCCCCTAAAAACACTGGAGGATGCCTTGAGATGTTTCTTCCAGCCCAA
AGAGTTAGCAAGCTCAGACAAGTGCTTCTGTGAGACCTGCGGGAAGAAGACGCCTTGCAAACAG
GCTCAGAAGCTGACTGGTTTCCCTCAGACCCTGACCATCCACCTCATGAGATTCTCTGTCAGGA
ACTCACAGACAGTAAAGATCTGCCACTCAGTGTACTTCCCGCAGAGCTTGGATTTCAGTCAGAT
TCTGCCAACCACGGATCAGTCTGAGATACACTATGAACTCTTTGCTGTGATTGCCCATGTTGGG
ATGGCAGACTTCGGTCATTACTGTGCCTACATCCGGAATCCCGTGGATGGAGAATGGTTCTGCT
TCAATGATTCACATGTTTGTTGGGTGACCTGGAAGGATGTCCAGTGTACCTATGGGGATCACAT
ATATCGTTGGAGGGAAACTGCCTATCTCTTGGTTTACATGAAGACTGGATCCTGACAGATATAC
TCACACCTTCAGAGAGTGACAGACTCTTTTCTCCTCTCCTGTACCCACATCTGCTGCATTTCAA
CGAGAATCGTAATTTAAAAACCATAATTAAGCCCTATTTATAAGCAAGGATTATTATTATTGCT
GTGGCTTGGCTGTAGTTTGTCTCCCAACAGCTCACACACAGAAGGCTTGGTCTTTAGTATGGAG
GCGTTTGGGTGACAGAACTTTTAAGGGACAGGGCCCAGTGGGAGGTAATCAGTTCATGGGATCT
CTCTTCTGTGCACTAATAGTTCCTTTTCTGTTTCTCCGTGGTGATGCAAACAGGGTGATCCAAC
ATGCCAGTGCCAAGCTGGTTGGATCCTCTAGCTTTCAAAATTCCAAGTCAAATAAATGTTATTA
CACACTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039107665 ⟹ XP_038963593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	156,143,789 - 156,171,292 (+)	NCBI
mRatBN7.2	4	154,471,648 - 154,499,154 (+)	NCBI

RefSeq Acc Id:

XM_039107666 ⟹ XP_038963594

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	156,143,770 - 156,166,202 (+)	NCBI
mRatBN7.2	4	154,471,634 - 154,493,887 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014080	(Get FASTA)	NCBI Sequence Viewer
	XP_038963593	(Get FASTA)	NCBI Sequence Viewer
	XP_038963594	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79101	(Get FASTA)	NCBI Sequence Viewer
	EDM02017	(Get FASTA)	NCBI Sequence Viewer
	EDM02018	(Get FASTA)	NCBI Sequence Viewer
	EDM02019	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053020
	ENSRNOP00000053020.3

RefSeq Acc Id:

NP_001014080 ⟸ NM_001014058

- UniProtKB:

Q6AYC7 (UniProtKB/TrEMBL), F1LNS1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGKGFGLLRKTCQSVVANPQQHSALEEEKNMKRKRVLSRELCSAWDRPHGFVGLHNIGQTCCLN
SLIQVFMMNVDFRMVLKRITVPRGAEEQKRSVPFQLLLLLEKMQDSRQKAVLPTELVQCLQKYN
VPLFVQHDAAHLFLTIWNLTKDQITDIDLAERLQDLFTIWTEESLMCVGCGAESSRRGKLLTLS
LPLFDMDSKPLKTLEDALRCFFQPKELASSDKCFCETCGKKTPCKQAQKLTGFPQTLTIHLMRF
SVRNSQTVKICHSVYFPQSLDFSQILPTTDQSEIHYELFAVIAHVGMADFGHYCAYIRNPVDGE
WFCFNDSHVCWVTWKDVQCTYGDHIYRWRETAYLLVYMKTGS

hide sequence

RefSeq Acc Id:

ENSRNOP00000053020 ⟸ ENSRNOT00000056174

RefSeq Acc Id:	XP_038963594 ⟸ XM_039107666
- Peptide Label:	isoform X2
- UniProtKB:	A6ILC0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038963593 ⟸ XM_039107665
- Peptide Label:	isoform X1
- UniProtKB:	A6ILC1 (UniProtKB/TrEMBL)

Protein Domains

USP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYC7-F1-model_v2	AlphaFold	Q6AYC7	1-362	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693363

Promoter ID:

EPDNEW_R3887

Type:

multiple initiation site

Name:

Usp18_1

Description:

ubiquitin specific peptidase 18

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	153,805,985 - 153,806,045	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359153	AgrOrtholog
BioCyc Gene	G2FUF-43181	BioCyc
Ensembl Genes	ENSRNOG00000037198	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000056174	ENTREZGENE
	ENSRNOT00000056174.5	UniProtKB/TrEMBL
Gene3D-CATH	Cysteine proteinases	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7124857	IMAGE-MGC_LOAD
InterPro	Papain_like_cys_pep_sf	UniProtKB/TrEMBL
	Pept_C19ubi-hydrolase_C_CS	UniProtKB/TrEMBL
	Peptidase_C19	UniProtKB/TrEMBL
	UCH/PAN2	UniProtKB/TrEMBL
KEGG Report	rno:312688	UniProtKB/TrEMBL
MGC_CLONE	MGC:94088	IMAGE-MGC_LOAD
NCBI Gene	312688	ENTREZGENE
PANTHER	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE	UniProtKB/TrEMBL
	UBL CARBOXYL-TERMINAL HYDROLASE 18-RELATED	UniProtKB/TrEMBL
Pfam	UCH	UniProtKB/TrEMBL
PhenoGen	Usp18	PhenoGen
PROSITE	UCH_2_1	UniProtKB/TrEMBL
	UCH_2_2	UniProtKB/TrEMBL
	UCH_2_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000037198	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/TrEMBL
UniProt	A6ILC0	ENTREZGENE, UniProtKB/TrEMBL
	A6ILC1	ENTREZGENE, UniProtKB/TrEMBL
	A6ILC2_RAT	UniProtKB/TrEMBL
	F1LNS1	ENTREZGENE
	Q6AYC7	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	F1LNS1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	Usp18	ubiquitin specific peptidase 18	LOC100359614	ubiquitin specific peptidase 18-like	Data merged from RGD:2699571	737654	PROVISIONAL
2010-07-02	LOC100359614	ubiquitin specific peptidase 18-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-30	Usp18	ubiquitin specific peptidase 18	LOC312688	similar to ubiquitin specific protease UBP43	Symbol and Name updated	1299863	APPROVED
2005-07-29	LOC312688	similar to ubiquitin specific protease UBP43			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM