Symbol:
Mysm1
Name:
myb-like, SWIRM and MPN domains 1
RGD ID:
1311787
Description:
Predicted to enable deubiquitinase activity; histone binding activity; and transcription coactivator activity. Predicted to be involved in chromatin remodeling; positive regulation of transcription by RNA polymerase II; and regulation of hemopoiesis. Predicted to act upstream of or within pigmentation; regulation of cell migration; and regulation of hair follicle development. Predicted to be located in nucleolus and nucleoplasm. Predicted to be part of protein-containing complex. Human ortholog(s) of this gene implicated in diabetic retinopathy. Orthologous to human MYSM1 (Myb like, SWIRM and MPN domains 1); PARTICIPATES IN histone modification pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
deubiquitinase MYSM1; histone H2A deubiquitinase MYSM1; LOC298247; RGD1311787; similar to KIAA1915 protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYSM1 (Myb like, SWIRM and MPN domains 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mysm1 (myb-like, SWIRM and MPN domains 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mysm1 (Myb like, SWIRM and MPN domains 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MYSM1 (Myb like, SWIRM and MPN domains 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYSM1 (Myb like, SWIRM and MPN domains 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mysm1 (Myb like, SWIRM and MPN domains 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MYSM1 (Myb like, SWIRM and MPN domains 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYSM1 (Myb like, SWIRM and MPN domains 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mysm1 (Myb like, SWIRM and MPN domains 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Mysm1 (myb-like, SWIRM and MPN domains 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MYSM1 (Myb like, SWIRM and MPN domains 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mysm1 (Myb-like, SWIRM and MPN domains 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mysm1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 114,877,112 - 114,981,463 (-) NCBI GRCr8 mRatBN7.2 5 109,761,345 - 109,826,652 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 109,776,286 - 109,819,967 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 5 113,902,115 - 113,939,083 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 113,906,803 - 113,939,127 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 117,841,917 - 117,892,263 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 115,249,981 - 115,282,319 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 115,255,206 - 115,362,678 (-) NCBI Celera 5 108,403,783 - 108,440,731 (-) NCBI Celera Cytogenetic Map 5 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mysm1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MYSM1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of MYSM1 mRNA CTD PMID:22079256 Mysm1 Rat 1,2-dimethylhydrazine decreases expression ISO Mysm1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MYSM1 mRNA CTD PMID:22206623 Mysm1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mysm1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYSM1 mRNA CTD PMID:19770486 Mysm1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mysm1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MYSM1 mRNA CTD PMID:21570461 Mysm1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO MYSM1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of MYSM1 mRNA CTD PMID:22298810 Mysm1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MYSM1 mRNA CTD PMID:21346803 Mysm1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MYSM1 mRNA CTD PMID:21346803 Mysm1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Mysm1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of MYSM1 mRNA CTD PMID:20188158 Mysm1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MYSM1 mRNA CTD PMID:30047161 Mysm1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of MYSM1 mRNA CTD PMID:30047161 Mysm1 Rat benzo[a]pyrene decreases expression ISO Mysm1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MYSM1 mRNA CTD PMID:19770486 Mysm1 Rat benzo[a]pyrene increases expression ISO Mysm1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MYSM1 mRNA CTD PMID:22228805 Mysm1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of MYSM1 mRNA CTD PMID:21839799 Mysm1 Rat bis(2-chloroethyl) sulfide decreases expression ISO Mysm1 (Mus musculus) 6480464 Mustard Gas results in decreased expression of MYSM1 mRNA CTD PMID:26392148 Mysm1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MYSM1 mRNA CTD PMID:25181051 and PMID:30816183 Mysm1 Rat bisphenol A decreases expression ISO Mysm1 (Mus musculus) 6480464 bisphenol A results in decreased expression of MYSM1 mRNA CTD PMID:32156529 Mysm1 Rat bisphenol F multiple interactions ISO MYSM1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of MYSM1 gene CTD PMID:31601247 Mysm1 Rat cadmium dichloride increases expression ISO MYSM1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MYSM1 mRNA CTD PMID:38568856 Mysm1 Rat carbon nanotube decreases expression ISO Mysm1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mysm1 Rat CGP 52608 multiple interactions ISO MYSM1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MYSM1 gene] CTD PMID:28238834 Mysm1 Rat chlorpyrifos decreases expression ISO Mysm1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of MYSM1 mRNA CTD PMID:37019170 Mysm1 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of MYSM1 mRNA CTD PMID:29108742 Mysm1 Rat Dibutyl phosphate affects expression ISO MYSM1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MYSM1 mRNA CTD PMID:37042841 Mysm1 Rat dichloromethane decreases expression ISO Mysm1 (Mus musculus) 6480464 Methylene Chloride results in decreased expression of MYSM1 mRNA CTD PMID:28392392 Mysm1 Rat doxorubicin decreases expression ISO MYSM1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MYSM1 mRNA CTD PMID:29803840 Mysm1 Rat endosulfan increases expression ISO MYSM1 (Homo sapiens) 6480464 Endosulfan results in increased expression of MYSM1 mRNA CTD PMID:26615145 Mysm1 Rat formaldehyde increases expression ISO MYSM1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of MYSM1 mRNA CTD PMID:20655997 Mysm1 Rat FR900359 affects phosphorylation ISO MYSM1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of MYSM1 protein CTD PMID:37730182 Mysm1 Rat fulvestrant multiple interactions ISO MYSM1 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of MYSM1 gene CTD PMID:31601247 Mysm1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MYSM1 mRNA CTD PMID:33387578 Mysm1 Rat irinotecan decreases expression ISO MYSM1 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of MYSM1 mRNA CTD PMID:18927307 Mysm1 Rat levonorgestrel multiple interactions ISO MYSM1 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of MYSM1 mRNA CTD PMID:19074003 Mysm1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MYSM1 mRNA CTD PMID:30047161 Mysm1 Rat methyl methanesulfonate increases expression ISO MYSM1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of MYSM1 mRNA CTD PMID:23649840 Mysm1 Rat miconazole decreases expression ISO Mysm1 (Mus musculus) 6480464 Miconazole results in decreased expression of MYSM1 mRNA CTD PMID:27462272 Mysm1 Rat phenobarbital affects expression ISO Mysm1 (Mus musculus) 6480464 Phenobarbital affects the expression of MYSM1 mRNA CTD PMID:23091169 Mysm1 Rat potassium chromate increases expression ISO MYSM1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of MYSM1 mRNA CTD PMID:22079256 Mysm1 Rat potassium chromate multiple interactions ISO MYSM1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of MYSM1 mRNA CTD PMID:22079256 Mysm1 Rat propiconazole decreases expression ISO Mysm1 (Mus musculus) 6480464 propiconazole results in decreased expression of MYSM1 mRNA CTD PMID:21278054 Mysm1 Rat quercetin decreases phosphorylation ISO MYSM1 (Homo sapiens) 6480464 Quercetin results in decreased phosphorylation of MYSM1 protein CTD PMID:35688186 Mysm1 Rat sodium arsenate increases expression ISO Mysm1 (Mus musculus) 6480464 sodium arsenate results in increased expression of MYSM1 mRNA CTD PMID:21795629 Mysm1 Rat sodium arsenite affects expression ISO MYSM1 (Homo sapiens) 6480464 sodium arsenite affects the expression of MYSM1 mRNA CTD PMID:29319823 Mysm1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of MYSM1 mRNA CTD PMID:30047161 Mysm1 Rat sulforaphane decreases expression ISO Mysm1 (Mus musculus) 6480464 sulforaphane results in decreased expression of MYSM1 mRNA CTD PMID:30529165 Mysm1 Rat sunitinib increases expression ISO MYSM1 (Homo sapiens) 6480464 Sunitinib results in increased expression of MYSM1 mRNA CTD PMID:31533062 Mysm1 Rat testosterone undecanoate multiple interactions ISO MYSM1 (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in decreased expression of MYSM1 mRNA CTD PMID:19074003 Mysm1 Rat thapsigargin increases expression ISO Mysm1 (Mus musculus) 6480464 Thapsigargin results in increased expression of MYSM1 protein CTD PMID:24648495 Mysm1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MYSM1 mRNA CTD PMID:34492290 Mysm1 Rat titanium dioxide decreases methylation ISO Mysm1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MYSM1 gene and titanium dioxide results in decreased methylation of MYSM1 promoter CTD PMID:35295148 Mysm1 Rat triphenyl phosphate affects expression ISO MYSM1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MYSM1 mRNA CTD PMID:37042841 Mysm1 Rat troglitazone decreases expression ISO Mysm1 (Mus musculus) 6480464 troglitazone results in decreased expression of MYSM1 mRNA CTD PMID:28973697 Mysm1 Rat tungsten decreases expression ISO Mysm1 (Mus musculus) 6480464 Tungsten results in decreased expression of MYSM1 mRNA CTD PMID:30912803 Mysm1 Rat valproic acid decreases expression ISO MYSM1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MYSM1 mRNA CTD PMID:23179753 Mysm1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of MYSM1 mRNA CTD PMID:29427782 Mysm1 Rat vincristine increases expression ISO MYSM1 (Homo sapiens) 6480464 Vincristine results in increased expression of MYSM1 mRNA CTD PMID:23649840
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 6-propyl-2-thiouracil (EXP) amitrole (EXP) benzo[a]pyrene (EXP,ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dichloromethane (ISO) doxorubicin (ISO) endosulfan (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) irinotecan (ISO) levonorgestrel (ISO) methimazole (EXP) methyl methanesulfonate (ISO) miconazole (ISO) phenobarbital (ISO) potassium chromate (ISO) propiconazole (ISO) quercetin (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) sunitinib (ISO) testosterone undecanoate (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tungsten (ISO) valproic acid (EXP,ISO) vincristine (ISO)
Mysm1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 114,877,112 - 114,981,463 (-) NCBI GRCr8 mRatBN7.2 5 109,761,345 - 109,826,652 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 109,776,286 - 109,819,967 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 5 113,902,115 - 113,939,083 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 113,906,803 - 113,939,127 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 117,841,917 - 117,892,263 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 115,249,981 - 115,282,319 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 115,255,206 - 115,362,678 (-) NCBI Celera 5 108,403,783 - 108,440,731 (-) NCBI Celera Cytogenetic Map 5 q33 NCBI
MYSM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 58,654,743 - 58,700,062 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 58,643,440 - 58,700,090 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 59,120,415 - 59,165,734 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 58,898,178 - 58,938,335 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 57,409,098 - 57,449,255 (-) NCBI Celera Cytogenetic Map 1 p32.1 NCBI HuRef 1 57,230,623 - 57,275,921 (-) NCBI HuRef CHM1_1 1 59,235,741 - 59,281,136 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 58,532,658 - 58,578,032 (-) NCBI T2T-CHM13v2.0
Mysm1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 94,830,274 - 94,867,392 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 94,830,277 - 94,867,337 (-) Ensembl GRCm39 Ensembl GRCm38 4 94,942,037 - 94,979,155 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 94,942,040 - 94,979,100 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 94,608,732 - 94,645,791 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 94,434,059 - 94,471,118 (-) NCBI MGSCv36 mm8 MGSCv36 4 92,679,679 - 92,716,946 (-) NCBI MGSCv36 mm8 Celera 4 93,309,750 - 93,362,518 (-) NCBI Celera Cytogenetic Map 4 C5 NCBI cM Map 4 43.34 NCBI
Mysm1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 1,185,174 - 1,220,848 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 1,185,184 - 1,226,709 (+) NCBI ChiLan1.0 ChiLan1.0
MYSM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 168,148,533 - 168,194,103 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 167,300,868 - 167,344,264 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 57,916,267 - 57,961,812 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 59,621,583 - 59,666,843 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 59,626,793 - 59,666,809 (-) Ensembl panpan1.1 panPan2
MYSM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 51,037,222 - 51,079,229 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 51,036,874 - 51,075,259 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 51,101,765 - 51,144,584 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 51,216,170 - 51,259,011 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 51,215,367 - 51,256,838 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 51,166,523 - 51,209,333 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 51,111,717 - 51,154,378 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 51,395,364 - 51,438,208 (+) NCBI UU_Cfam_GSD_1.0
Mysm1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 72,270,089 - 72,311,300 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 3,104,996 - 3,144,087 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 3,105,018 - 3,143,215 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MYSM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 153,756,182 - 153,795,535 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 153,755,209 - 153,798,412 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 141,363,206 - 141,387,318 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MYSM1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 74,284,627 - 74,323,651 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 74,284,665 - 74,323,088 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 43,034,948 - 43,078,496 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mysm1
.
Predicted Target Of
Count of predictions: 11 Count of miRNA genes: 11 Interacting mature miRNAs: 11 Transcripts: ENSRNOT00000039554 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 1582212 Livw2 Liver weight QTL 2 3.5 0.0004 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 5 99016066 119085810 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 7394708 Emca11 Estrogen-induced mammary cancer QTL 11 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 99753548 113061097 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH142050
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 114,903,473 - 114,904,451 (+) Marker Load Pipeline mRatBN7.2 5 109,787,740 - 109,788,718 (+) MAPPER mRatBN7.2 Rnor_6.0 5 113,906,812 - 113,907,789 NCBI Rnor6.0 Rnor_5.0 5 117,853,358 - 117,854,335 UniSTS Rnor5.0 RGSC_v3.4 5 115,250,106 - 115,251,083 UniSTS RGSC3.4 Celera 5 108,408,478 - 108,409,455 UniSTS RH 3.4 Map 5 779.3 UniSTS Cytogenetic Map 5 q33 UniSTS
Mysm1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 109,793,011 - 109,793,628 (+) MAPPER mRatBN7.2 Rnor_6.0 5 113,912,083 - 113,912,699 NCBI Rnor6.0 Rnor_5.0 5 117,858,629 - 117,859,245 UniSTS Rnor5.0 Celera 5 108,413,749 - 108,414,365 UniSTS Cytogenetic Map 5 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039554 ⟹ ENSRNOP00000030043
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 109,776,286 - 109,819,967 (-) Ensembl Rnor_6.0 Ensembl 5 113,906,803 - 113,939,127 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102038 ⟹ ENSRNOP00000089875
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 109,785,138 - 109,819,967 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119743 ⟹ ENSRNOP00000097255
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 109,776,286 - 109,816,741 (-) Ensembl
RefSeq Acc Id:
XM_006238409 ⟹ XP_006238471
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,935,695 (-) NCBI mRatBN7.2 5 109,783,046 - 109,819,857 (-) NCBI Rnor_6.0 5 113,902,115 - 113,938,955 (-) NCBI Rnor_5.0 5 117,841,917 - 117,892,263 (-) NCBI
Sequence:
CGCAGAGCGGGGTCCTGCGGGCCGGGCTGTGCTAGGCAAGGGCCGGAGGATGCGGTTGGCCAAGGGTCCGTGTGGACGGCGTCAGGACCCGGGTTGCTCCTGGCCGGAAGTCGGCCGGGTCCACGGGT
hide sequence
RefSeq Acc Id:
XM_008763911 ⟹ XP_008762133
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,955,628 (-) NCBI mRatBN7.2 5 109,783,046 - 109,826,652 (-) NCBI Rnor_6.0 5 113,902,115 - 113,939,082 (-) NCBI
Sequence:
CGCCCCCGACCCGCCGCATCTCGCGGGATCTCACGAGTACGCCTGTGTCAAGTGCAGTCATGGA
hide sequence
RefSeq Acc Id:
XM_008763912 ⟹ XP_008762134
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,942,385 (-) NCBI mRatBN7.2 5 109,783,046 - 109,826,652 (-) NCBI Rnor_6.0 5 113,902,115 - 113,939,083 (-) NCBI
Sequence:
CCGCCCCCGACCCGCCGCATCTCGCGGGATCTCACGAGTACGCCTGTGTCAAGTGCAGTCATGGAAGCTGAGGAGGCGGATGTGGATGTGGAGGGAGATGTGGCGGCGGCAGCACAGCCGGGAAATGA
hide sequence
RefSeq Acc Id:
XM_008763913 ⟹ XP_008762135
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,942,385 (-) NCBI mRatBN7.2 5 109,783,046 - 109,826,652 (-) NCBI Rnor_6.0 5 113,902,115 - 113,939,083 (-) NCBI
Sequence:
CCGCCCCCGACCCGCCGCATCTCGCGGGATCTCACGAGTACGCCTGTGTCAAGTGCAGTCATGG
hide sequence
RefSeq Acc Id:
XM_008763914 ⟹ XP_008762136
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,942,385 (-) NCBI mRatBN7.2 5 109,783,046 - 109,826,652 (-) NCBI Rnor_6.0 5 113,902,115 - 113,939,082 (-) NCBI
Sequence:
CGCCCCCGACCCGCCGCATCTCGCGGGATCTCACGAGTACGCCTGTGTCAAGTGCAGTCATGGAAGCTGAGGAGGCGGATGTGGATGTGGAGGGAGATGTGGCGGCGGCAGCACAGCCGGGAAATGAT
hide sequence
RefSeq Acc Id:
XM_039111107 ⟹ XP_038967035
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,877,112 - 114,942,385 (-) NCBI mRatBN7.2 5 109,761,345 - 109,826,652 (-) NCBI
RefSeq Acc Id:
XM_039111109 ⟹ XP_038967037
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,942,385 (-) NCBI mRatBN7.2 5 109,783,046 - 109,826,652 (-) NCBI
RefSeq Acc Id:
XM_039111110 ⟹ XP_038967038
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,935,587 (-) NCBI mRatBN7.2 5 109,783,046 - 109,819,856 (-) NCBI
RefSeq Acc Id:
XM_063288579 ⟹ XP_063144649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,981,463 (-) NCBI
RefSeq Acc Id:
XM_063288580 ⟹ XP_063144650
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,935,805 (-) NCBI
RefSeq Acc Id:
XM_063288581 ⟹ XP_063144651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,942,385 (-) NCBI
RefSeq Acc Id:
XM_063288582 ⟹ XP_063144652
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,898,779 - 114,935,692 (-) NCBI
RefSeq Acc Id:
XM_063288583 ⟹ XP_063144653
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 114,913,454 - 114,942,385 (-) NCBI
RefSeq Acc Id:
XP_006238471 ⟸ XM_006238409
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6B5I6 (UniProtKB/TrEMBL)
- Sequence:
MSILLLNDGNTASVFQDHYLDSTWRRENGCLPWTLDSTISDENRAVIEKMLLEEEYYLSNKSLPGKFWVNQKENDKKCTNSLQKTGKIMVRSPAKPSSYSVKWTIEEKKLFEQGLAKFGRRWTKIAAL
hide sequence
RefSeq Acc Id:
XP_008762134 ⟸ XM_008763912
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6B5I6 (UniProtKB/TrEMBL)
- Sequence:
MEAEEADVDVEGDVAAAAQPGNDGNTASVFQDHYLDSTWRRENGCLPWTLDSTISDENRAVIEK
hide sequence
RefSeq Acc Id:
XP_008762136 ⟸ XM_008763914
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6A9L8 (UniProtKB/TrEMBL), A0A8I6B5I6 (UniProtKB/TrEMBL)
- Sequence:
MEAEEADVDVEGDVAAAAQPGNDGNTASVFQDHYLDSTWRRENGCLPWTLDSTISDENRAVIEKMLLEEEYYLSNKSLPGKFWVNQKENDKKCTNRVRSPAKPSSYSVKWTIEEKKLFEQGLAKFGRR
hide sequence
RefSeq Acc Id:
XP_008762133 ⟸ XM_008763911
- Peptide Label:
isoform X1
- UniProtKB:
D4A7T9 (UniProtKB/TrEMBL), A0A8I6B5I6 (UniProtKB/TrEMBL)
- Sequence:
MEAEEADVDVEGDVAAAAQPGNDGNTASVFQDHYLDSTWRRENGCLPWTLDSTISDENRAVIEK
hide sequence
RefSeq Acc Id:
XP_008762135 ⟸ XM_008763913
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6B5I6 (UniProtKB/TrEMBL)
- Sequence:
MEAEEADVDVEGDVAAAAQPGNDGNTASVFQDHYLDSTWRRENGCLPWTLDSTISDENRAVIEKMLLEEEYYLSNKSLPGKFWVNQKENDKKCTNSLQKTGKIMVRSPAKPSSYSVKWTIEEKKLFEQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000030043 ⟸ ENSRNOT00000039554
RefSeq Acc Id:
XP_038967035 ⟸ XM_039111107
- Peptide Label:
isoform X1
- UniProtKB:
D4A7T9 (UniProtKB/TrEMBL), A0A8I6B5I6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038967037 ⟸ XM_039111109
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6B5I6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038967038 ⟸ XM_039111110
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6B5I6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000097255 ⟸ ENSRNOT00000119743
Ensembl Acc Id:
ENSRNOP00000089875 ⟸ ENSRNOT00000102038
RefSeq Acc Id:
XP_063144649 ⟸ XM_063288579
- Peptide Label:
isoform X1
- UniProtKB:
D4A7T9 (UniProtKB/TrEMBL), A0A8I6B5I6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144651 ⟸ XM_063288581
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6B5I6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144650 ⟸ XM_063288580
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063144652 ⟸ XM_063288582
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6B5I6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144653 ⟸ XM_063288583
- Peptide Label:
isoform X10
RGD ID: 13693848 Promoter ID: EPDNEW_R4368 Type: multiple initiation site Name: Mysm1_1 Description: myb-like, SWIRM and MPN domains 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 113,939,038 - 113,939,098 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Mysm1
myb-like, SWIRM and MPN domains 1
Mysm1_predicted
myb-like, SWIRM and MPN domains 1 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Mysm1_predicted
myb-like, SWIRM and MPN domains 1 (predicted)
RGD1311787_predicted
similar to KIAA1915 protein (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1311787_predicted
similar to KIAA1915 protein (predicted)
LOC298247_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC298247_predicted
similar to KIAA1915 protein (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
