Symbol:
Usp28
Name:
ubiquitin specific peptidase 28
RGD ID:
1311555
Description:
Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in several processes, including intracellular signal transduction; protein deubiquitination involved in ubiquitin-dependent protein catabolic process; and response to ionizing radiation. Predicted to be located in nuclear body. Predicted to be part of protein-containing complex. Predicted to be active in cytosol and nucleus. Orthologous to human USP28 (ubiquitin specific peptidase 28); INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 3-hydroxyisovaleric acid.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
deubiquitinating enzyme; deubiquitinating enzyme 28; LOC315639; ubiquitin carboxyl-terminal hydrolase 28; ubiquitin specific protease 28; ubiquitin thioesterase 28; ubiquitin thiolesterase 28; ubiquitin-specific-processing protease 28
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
USP28 (ubiquitin specific peptidase 28) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Usp28 (ubiquitin specific peptidase 28) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Usp28 (ubiquitin specific peptidase 28) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
USP28 (ubiquitin specific peptidase 28) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
USP28 (ubiquitin specific peptidase 28) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp28 (ubiquitin specific peptidase 28) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
USP28 (ubiquitin specific peptidase 28) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
USP28 (ubiquitin specific peptidase 28) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Usp28 (ubiquitin specific peptidase 28) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
USP28 (ubiquitin specific peptidase 28)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Usp28 (ubiquitin specific peptidase 28)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp28 (ubiquitin specific peptidase 28)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
K02C4.3
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder)
Saccharomyces cerevisiae (baker's yeast):
UBP2
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):
usp28
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 58,222,258 - 58,282,711 (+) NCBI GRCr8 mRatBN7.2 8 49,325,766 - 49,386,229 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 49,325,867 - 49,386,229 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 54,831,791 - 54,892,095 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 53,110,659 - 53,170,968 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 50,974,908 - 51,035,219 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 53,295,188 - 53,355,572 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 53,295,222 - 53,355,572 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 52,245,642 - 52,305,922 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 52,280,014 - 52,324,051 (+) NCBI Celera 8 48,883,162 - 48,943,411 (+) NCBI Celera Cytogenetic Map 8 q23 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp28 Rat 1,2-dimethylhydrazine decreases expression ISO Usp28 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP28 mRNA CTD PMID:22206623 Usp28 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of USP28 mRNA CTD PMID:24140754 Usp28 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Usp28 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Usp28 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Usp28 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of USP28 mRNA CTD PMID:19465110 Usp28 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP28 mRNA CTD PMID:33387578 Usp28 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp28 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP28 mRNA CTD PMID:21570461 Usp28 Rat 2-hydroxypropanoic acid decreases expression ISO USP28 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of USP28 mRNA CTD PMID:30851411 Usp28 Rat 3-hydroxyisovaleric acid increases expression EXP 6480464 beta-hydroxyisovaleric acid results in increased expression of USP28 mRNA CTD PMID:24124592 Usp28 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of USP28 mRNA CTD PMID:24780913 and PMID:30047161 Usp28 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of USP28 mRNA CTD PMID:30047161 Usp28 Rat aristolochic acid A decreases expression ISO USP28 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP28 mRNA CTD PMID:33212167 Usp28 Rat arsenous acid increases expression ISO Usp28 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of USP28 mRNA CTD PMID:35676786 Usp28 Rat belinostat increases expression ISO USP28 (Homo sapiens) 6480464 belinostat results in increased expression of USP28 mRNA CTD PMID:26272509 Usp28 Rat belinostat multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386 Usp28 Rat benzo[a]pyrene increases mutagenesis ISO USP28 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of USP28 gene CTD PMID:25435355 Usp28 Rat benzo[a]pyrene decreases methylation ISO USP28 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of USP28 promoter CTD PMID:27901495 Usp28 Rat benzo[a]pyrene affects methylation ISO USP28 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of USP28 intron CTD PMID:30157460 Usp28 Rat benzo[a]pyrene decreases expression ISO Usp28 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of USP28 mRNA CTD PMID:22228805 Usp28 Rat beta-lapachone increases expression ISO USP28 (Homo sapiens) 6480464 beta-lapachone results in increased expression of USP28 mRNA CTD PMID:38218311 Usp28 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of USP28 mRNA CTD PMID:25181051 Usp28 Rat bisphenol A multiple interactions ISO USP28 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of USP28 gene CTD PMID:31601247 Usp28 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP28 mRNA CTD PMID:30816183 and PMID:32528016 Usp28 Rat Bisphenol A diglycidyl ether affects splicing ISO Usp28 (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of USP28 mRNA CTD PMID:36464114 Usp28 Rat bisphenol AF affects splicing ISO Usp28 (Mus musculus) 6480464 bisphenol AF affects the splicing of USP28 mRNA CTD PMID:36464114 Usp28 Rat bisphenol F decreases expression ISO Usp28 (Mus musculus) 6480464 bisphenol F results in decreased expression of USP28 mRNA CTD PMID:38685157 Usp28 Rat butanal decreases expression ISO USP28 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of USP28 mRNA CTD PMID:26079696 Usp28 Rat cadmium dichloride increases expression ISO USP28 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of USP28 mRNA CTD PMID:26472689 Usp28 Rat caffeine affects phosphorylation ISO USP28 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of USP28 protein CTD PMID:35688186 Usp28 Rat cantharidin decreases expression ISO Usp28 (Mus musculus) 6480464 Cantharidin results in decreased expression of USP28 mRNA CTD PMID:36907384 Usp28 Rat chloroquine increases expression ISO Usp28 (Mus musculus) 6480464 Chloroquine results in increased expression of USP28 mRNA CTD PMID:28134560 Usp28 Rat chloroquine multiple interactions ISO Usp28 (Mus musculus) 6480464 Chloroquine inhibits the reaction [lipopolysaccharide more ... CTD PMID:28134560 Usp28 Rat chlorpyrifos decreases expression ISO Usp28 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of USP28 mRNA CTD PMID:37019170 Usp28 Rat cordycepin increases expression ISO Usp28 (Mus musculus) 6480464 cordycepin results in increased expression of USP28 mRNA CTD PMID:32042022 Usp28 Rat diarsenic trioxide increases expression ISO Usp28 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of USP28 mRNA CTD PMID:35676786 Usp28 Rat Dibutyl phosphate affects expression ISO USP28 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP28 mRNA CTD PMID:37042841 Usp28 Rat diclofenac increases expression ISO Usp28 (Mus musculus) 6480464 Diclofenac results in increased expression of USP28 mRNA CTD PMID:26934552 Usp28 Rat dieldrin decreases response to substance ISO USP28 (Homo sapiens) 6480464 USP28 gene mutant form results in decreased susceptibility to Dieldrin CTD PMID:32421776 Usp28 Rat dioxygen decreases expression ISO USP28 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of USP28 mRNA and Oxygen deficiency results in decreased expression of USP28 protein CTD PMID:20046830 Usp28 Rat dioxygen multiple interactions ISO USP28 (Homo sapiens) 6480464 [HIF1A mRNA co-treated with EPAS1 mRNA] affects the reaction [Oxygen deficiency results in decreased expression of USP28 protein] more ... CTD PMID:20046830 Usp28 Rat dioxygen increases degradation ISO USP28 (Homo sapiens) 6480464 Oxygen deficiency results in increased degradation of USP28 protein CTD PMID:20046830 Usp28 Rat dorsomorphin multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Usp28 Rat entinostat increases expression ISO USP28 (Homo sapiens) 6480464 entinostat results in increased expression of USP28 mRNA CTD PMID:26272509 Usp28 Rat entinostat multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386 Usp28 Rat formaldehyde decreases expression ISO USP28 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of USP28 mRNA CTD PMID:23649840 Usp28 Rat FR900359 increases phosphorylation ISO USP28 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of USP28 protein CTD PMID:37730182 Usp28 Rat fulvestrant multiple interactions ISO USP28 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of USP28 gene CTD PMID:31601247 Usp28 Rat ivermectin decreases expression ISO USP28 (Homo sapiens) 6480464 Ivermectin results in decreased expression of USP28 protein CTD PMID:32959892 Usp28 Rat leflunomide decreases expression ISO USP28 (Homo sapiens) 6480464 leflunomide results in decreased expression of USP28 mRNA CTD PMID:28988120 Usp28 Rat maneb multiple interactions ISO Usp28 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of USP28 mRNA CTD PMID:36117858 Usp28 Rat mercury dibromide increases expression ISO USP28 (Homo sapiens) 6480464 mercuric bromide results in increased expression of USP28 mRNA CTD PMID:26272509 Usp28 Rat mercury dibromide multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386 Usp28 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of USP28 mRNA CTD PMID:30047161 Usp28 Rat methylmercury chloride increases expression ISO USP28 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of USP28 mRNA CTD PMID:28001369 Usp28 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO USP28 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [nickel sulfate results in decreased expression of USP28 protein] and benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Oxygen deficiency results in decreased expression of USP28 protein] CTD PMID:20046830 Usp28 Rat nickel atom decreases expression ISO USP28 (Homo sapiens) 6480464 Nickel results in decreased expression of USP28 mRNA CTD PMID:23195993 Usp28 Rat nickel sulfate decreases expression ISO USP28 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of USP28 protein CTD PMID:20046830 Usp28 Rat nickel sulfate multiple interactions ISO USP28 (Homo sapiens) 6480464 [HIF1A mRNA co-treated with EPAS1 mRNA] affects the reaction [nickel sulfate results in decreased expression of USP28 protein] more ... CTD PMID:20046830 Usp28 Rat p-chloromercuribenzoic acid increases expression ISO USP28 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of USP28 mRNA CTD PMID:26272509 Usp28 Rat p-chloromercuribenzoic acid multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386 Usp28 Rat panobinostat multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386 Usp28 Rat panobinostat increases expression ISO USP28 (Homo sapiens) 6480464 panobinostat results in increased expression of USP28 mRNA CTD PMID:26272509 Usp28 Rat paracetamol affects expression ISO Usp28 (Mus musculus) 6480464 Acetaminophen affects the expression of USP28 mRNA CTD PMID:17562736 Usp28 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of USP28 mRNA CTD PMID:33387578 Usp28 Rat paraquat multiple interactions ISO Usp28 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of USP28 mRNA CTD PMID:36117858 Usp28 Rat phenylmercury acetate increases expression ISO USP28 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of USP28 mRNA CTD PMID:26272509 Usp28 Rat phenylmercury acetate multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386 Usp28 Rat potassium chromate increases expression ISO USP28 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of USP28 mRNA CTD PMID:22714537 Usp28 Rat rac-lactic acid decreases expression ISO USP28 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of USP28 mRNA CTD PMID:30851411 Usp28 Rat SB 431542 multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Usp28 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of USP28 mRNA CTD PMID:30047161 Usp28 Rat titanium dioxide decreases methylation ISO Usp28 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP28 gene and titanium dioxide results in decreased methylation of USP28 promoter CTD PMID:35295148 Usp28 Rat trichostatin A increases expression ISO USP28 (Homo sapiens) 6480464 trichostatin A results in increased expression of USP28 mRNA CTD PMID:24935251 and PMID:26272509 Usp28 Rat trichostatin A multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386 Usp28 Rat triclosan decreases expression ISO USP28 (Homo sapiens) 6480464 Triclosan results in decreased expression of USP28 mRNA CTD PMID:30510588 Usp28 Rat triphenyl phosphate affects expression ISO USP28 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP28 mRNA CTD PMID:37042841 Usp28 Rat valproic acid affects expression ISO Usp28 (Mus musculus) 6480464 Valproic Acid affects the expression of USP28 mRNA CTD PMID:17292431 Usp28 Rat valproic acid increases methylation ISO USP28 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of USP28 gene CTD PMID:29154799 Usp28 Rat valproic acid multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386 Usp28 Rat valproic acid increases expression ISO USP28 (Homo sapiens) 6480464 Valproic Acid results in increased expression of USP28 mRNA CTD PMID:23179753 more ... Usp28 Rat vorinostat multiple interactions ISO USP28 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of USP28 mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3-hydroxyisovaleric acid (EXP) 6-propyl-2-thiouracil (EXP) amitrole (EXP) aristolochic acid A (ISO) arsenous acid (ISO) belinostat (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) cantharidin (ISO) chloroquine (ISO) chlorpyrifos (ISO) cordycepin (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) dieldrin (ISO) dioxygen (ISO) dorsomorphin (ISO) entinostat (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) ivermectin (ISO) leflunomide (ISO) maneb (ISO) mercury dibromide (ISO) methimazole (EXP) methylmercury chloride (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel atom (ISO) nickel sulfate (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (ISO) phenylmercury acetate (ISO) potassium chromate (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sulfadimethoxine (EXP) titanium dioxide (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vorinostat (ISO)
Biological Process
cell population proliferation (ISO,ISS) cellular response to UV (ISO) DNA damage checkpoint signaling (IBA,ISO,ISS) DNA damage response (IEA,ISO) DNA repair (IEA) intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator (ISO,ISS) protein deubiquitination (IEA,ISO,ISS) protein deubiquitination involved in ubiquitin-dependent protein catabolic process (ISO) proteolysis (IEA) regulation of protein stability (IBA,ISO,ISS) response to ionizing radiation (ISO,ISS)
Usp28 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 58,222,258 - 58,282,711 (+) NCBI GRCr8 mRatBN7.2 8 49,325,766 - 49,386,229 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 49,325,867 - 49,386,229 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 54,831,791 - 54,892,095 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 53,110,659 - 53,170,968 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 50,974,908 - 51,035,219 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 53,295,188 - 53,355,572 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 53,295,222 - 53,355,572 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 52,245,642 - 52,305,922 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 52,280,014 - 52,324,051 (+) NCBI Celera 8 48,883,162 - 48,943,411 (+) NCBI Celera Cytogenetic Map 8 q23 NCBI
USP28 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 113,797,875 - 113,875,572 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 113,797,874 - 113,875,572 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 113,668,597 - 113,746,294 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 113,173,807 - 113,251,466 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 113,173,807 - 113,251,466 NCBI Celera 11 110,821,475 - 110,899,132 (-) NCBI Celera Cytogenetic Map 11 q23.2 NCBI HuRef 11 109,597,124 - 109,674,696 (-) NCBI HuRef CHM1_1 11 113,551,888 - 113,629,830 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 113,808,211 - 113,885,899 (-) NCBI T2T-CHM13v2.0
Usp28 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 48,896,577 - 48,953,817 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 48,896,675 - 48,953,817 (+) Ensembl GRCm39 Ensembl GRCm38 9 48,985,319 - 49,042,517 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 48,985,375 - 49,042,517 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 48,793,490 - 48,850,622 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 48,737,317 - 48,794,449 (+) NCBI MGSCv36 mm8 Celera 9 46,282,655 - 46,339,797 (+) NCBI Celera Cytogenetic Map 9 A5.3 NCBI cM Map 9 26.56 NCBI
Usp28 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 15,426,159 - 15,443,023 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 15,425,136 - 15,469,819 (-) NCBI ChiLan1.0 ChiLan1.0
USP28 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 114,541,035 - 114,618,841 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 115,635,396 - 115,713,169 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 108,676,566 - 108,754,372 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 112,519,147 - 112,595,076 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 112,517,693 - 112,595,585 (-) Ensembl panpan1.1 panPan2
USP28 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 19,431,313 - 19,480,709 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 19,435,451 - 19,479,640 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 19,338,576 - 19,404,153 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 19,435,675 - 19,501,359 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 19,437,389 - 19,501,355 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 19,499,600 - 19,565,243 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 19,400,925 - 19,465,977 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 19,448,052 - 19,514,120 (+) NCBI UU_Cfam_GSD_1.0
Usp28
USP28 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 41,417,564 - 41,480,994 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 41,417,560 - 41,481,044 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 46,178,504 - 46,217,852 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP28 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 105,175,116 - 105,257,163 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 105,175,067 - 105,257,102 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 20,764,288 - 20,844,351 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp28
.
Predicted Target Of
Count of predictions: 244 Count of miRNA genes: 90 Interacting mature miRNAs: 110 Transcripts: ENSRNOT00000009724, ENSRNOT00000067420 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 5684993 Bmd84 Bone mineral density QTL 84 4.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 8 42692684 50095447 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
BF413316
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 49,381,722 - 49,381,816 (+) MAPPER mRatBN7.2 Rnor_6.0 8 53,351,067 - 53,351,160 NCBI Rnor6.0 Rnor_5.0 8 51,965,118 - 51,965,211 UniSTS Rnor5.0 RGSC_v3.4 8 52,301,417 - 52,301,510 UniSTS RGSC3.4 Celera 8 48,938,906 - 48,938,999 UniSTS RH 3.4 Map 8 524.0 UniSTS Cytogenetic Map 8 q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009724 ⟹ ENSRNOP00000009724
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 49,340,687 - 49,386,229 (+) Ensembl Rnor_6.0 Ensembl 8 53,295,222 - 53,355,323 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000067420 ⟹ ENSRNOP00000060005
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 49,325,937 - 49,386,229 (+) Ensembl Rnor_6.0 Ensembl 8 53,295,292 - 53,355,572 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099397 ⟹ ENSRNOP00000090131
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 49,325,937 - 49,386,229 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102592 ⟹ ENSRNOP00000091262
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 49,325,867 - 49,386,229 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119039 ⟹ ENSRNOP00000083392
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 49,325,937 - 49,386,229 (+) Ensembl
RefSeq Acc Id:
NM_001108144 ⟹ NP_001101614
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,429 - 58,282,711 (+) NCBI mRatBN7.2 8 49,325,937 - 49,386,229 (+) NCBI Rnor_6.0 8 53,295,292 - 53,355,572 (+) NCBI Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI RGSC_v3.4 8 52,245,642 - 52,305,922 (+) RGD Celera 8 48,883,162 - 48,943,411 (+) RGD
Sequence:
GCCATGACTGCGGAGCTGCAGCAGGACGACGCGGCGGGGGCGGCGGACGGCCATGGCTCGAGCTGCCAGATGCTGTTAAATCAGCTGCGAGAAATCACGGGCATCCAGGATCCTTCCTTTCTTCATGA
hide sequence
RefSeq Acc Id:
XM_006243006 ⟹ XP_006243068
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,282,700 (+) NCBI mRatBN7.2 8 49,325,766 - 49,386,223 (+) NCBI Rnor_6.0 8 53,295,188 - 53,355,563 (+) NCBI Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI
Sequence:
GGCGGTGCCTCCCGGTACTCCGGGGCTTCGGGGGCGGCGGTGGTGGCGGTGGTGACCGCGGCGAAGACGACAACGAGAGTGGGGCTACACGCGGAGGCACCACGGCCATGACTGCGGAGCTGCAGCAG
hide sequence
RefSeq Acc Id:
XM_006243007 ⟹ XP_006243069
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,282,700 (+) NCBI mRatBN7.2 8 49,325,828 - 49,386,223 (+) NCBI Rnor_6.0 8 53,295,188 - 53,355,563 (+) NCBI Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI
Sequence:
GGCGGTGCCTCCCGGTACTCCGGGGCTTCGGGGGCGGCGGTGGTGGCGGTGGTGACCGCGGCGAAGACGACAACGAGAGTGGGGCTACACGCGGAGGCACCACGGCCATGACTGCGGAGCTGCAGCAG
hide sequence
RefSeq Acc Id:
XM_006243008 ⟹ XP_006243070
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,282,700 (+) NCBI mRatBN7.2 8 49,325,766 - 49,386,223 (+) NCBI Rnor_6.0 8 53,295,188 - 53,355,563 (+) NCBI Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI
Sequence:
GGCGGTGCCTCCCGGTACTCCGGGGCTTCGGGGGCGGCGGTGGTGGCGGTGGTGACCGCGGCGAAGACGACAACGAGAGTGGGGCTACACGCGGAGGCACCACGGCCATGACTGCGGAGCTGCAGCAG
hide sequence
RefSeq Acc Id:
XM_006243009 ⟹ XP_006243071
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,282,700 (+) NCBI mRatBN7.2 8 49,325,766 - 49,386,223 (+) NCBI Rnor_6.0 8 53,295,188 - 53,355,563 (+) NCBI Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI
Sequence:
GGCGGTGCCTCCCGGTACTCCGGGGCTTCGGGGGCGGCGGTGGTGGCGGTGGTGACCGCGGCGA
hide sequence
RefSeq Acc Id:
XM_006243010 ⟹ XP_006243072
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,282,700 (+) NCBI mRatBN7.2 8 49,325,828 - 49,386,223 (+) NCBI Rnor_6.0 8 53,295,188 - 53,355,563 (+) NCBI Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI
Sequence:
GGCGGTGCCTCCCGGTACTCCGGGGCTTCGGGGGCGGCGGTGGTGGCGGTGGTGACCGCGGCGAAGACGACAACGAGAGTGGGGCTACACGCGGAGGCACCACGGCCATGACTGCGGAGCTGCAGCAG
hide sequence
RefSeq Acc Id:
XM_006243011 ⟹ XP_006243073
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,258 - 58,282,700 (+) NCBI mRatBN7.2 8 49,325,766 - 49,386,223 (+) NCBI Rnor_6.0 8 53,295,188 - 53,355,563 (+) NCBI Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI
Sequence:
GGCGGTGCCTCCCGGTACTCCGGGGCTTCGGGGGCGGCGGTGGTGGCGGTGGTGACCGCGGCGA
hide sequence
RefSeq Acc Id:
XM_006243012 ⟹ XP_006243074
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,282,700 (+) NCBI mRatBN7.2 8 49,325,829 - 49,386,223 (+) NCBI Rnor_6.0 8 53,295,188 - 53,355,563 (+) NCBI Rnor_5.0 8 51,909,256 - 51,969,623 (+) NCBI
Sequence:
GGCGGTGCCTCCCGGTACTCCGGGGCTTCGGGGGCGGCGGTGGTGGCGGTGGTGACCGCGGCGA
hide sequence
RefSeq Acc Id:
XM_039081444 ⟹ XP_038937372
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,274,578 (+) NCBI mRatBN7.2 8 49,325,766 - 49,378,148 (+) NCBI
RefSeq Acc Id:
XM_039081445 ⟹ XP_038937373
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,254,864 - 58,282,700 (+) NCBI mRatBN7.2 8 49,358,382 - 49,386,223 (+) NCBI
RefSeq Acc Id:
XM_063265441 ⟹ XP_063121511
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,282,700 (+) NCBI
RefSeq Acc Id:
XM_063265442 ⟹ XP_063121512
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,222,289 - 58,282,700 (+) NCBI
RefSeq Acc Id:
XM_063265443 ⟹ XP_063121513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 58,254,867 - 58,282,700 (+) NCBI
RefSeq Acc Id:
NP_001101614 ⟸ NM_001108144
- UniProtKB:
A0A0H2UI12 (UniProtKB/TrEMBL), A0A8I6AFT3 (UniProtKB/TrEMBL)
- Sequence:
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDQRVKEPSHDTAATEPSEVEESATSKDLLAKVIDLTHDNKDDLQAAIALSLLESPNIQTDSRDLNRIHE
hide sequence
RefSeq Acc Id:
XP_006243071 ⟸ XM_006243009
- Peptide Label:
isoform X4
- UniProtKB:
A0A140TAA0 (UniProtKB/TrEMBL)
- Sequence:
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDQRVK
hide sequence
RefSeq Acc Id:
XP_006243068 ⟸ XM_006243006
- Peptide Label:
isoform X1
- UniProtKB:
A0A140TAA0 (UniProtKB/TrEMBL), A0A8I5ZWX4 (UniProtKB/TrEMBL)
- Sequence:
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDQRVKEPSHDTAATEPSEVEESATSKDLLAKVIDLTHDNKDDLQAAIALSLLESPNIQTDSRDLNRIHE
hide sequence
RefSeq Acc Id:
XP_006243069 ⟸ XM_006243007
- Peptide Label:
isoform X2
- UniProtKB:
A0A140TAA0 (UniProtKB/TrEMBL)
- Sequence:
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDQRVKEPSHDTAATEPSEVEESATSKDLLAKVIDLTHDNKDDLQAAIALSLLESPNIQTDSRDLNRIHE
hide sequence
RefSeq Acc Id:
XP_006243070 ⟸ XM_006243008
- Peptide Label:
isoform X3
- UniProtKB:
D2Y8W6 (UniProtKB/Swiss-Prot), D3ZJ96 (UniProtKB/Swiss-Prot), A0A8I6AFT3 (UniProtKB/TrEMBL)
- Sequence:
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDQRVKEPSHDTAATEPSEVEESATSKDLLAKVIDLTHDNKDDLQAAIALSLLESPNIQTDSRDLNRIHE
hide sequence
RefSeq Acc Id:
XP_006243072 ⟸ XM_006243010
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6AFT3 (UniProtKB/TrEMBL)
- Sequence:
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDQRVK
hide sequence
RefSeq Acc Id:
XP_006243074 ⟸ XM_006243012
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6AFT3 (UniProtKB/TrEMBL)
- Sequence:
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDQRVKEPSHDTAATEPSEVEESATSKDLLAKVIDLTHDNKDDLQAAIALSLLESPNIQTDSRDLNRIHE
hide sequence
RefSeq Acc Id:
XP_006243073 ⟸ XM_006243011
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6AFT3 (UniProtKB/TrEMBL)
- Sequence:
MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDQRVK
hide sequence
Ensembl Acc Id:
ENSRNOP00000060005 ⟸ ENSRNOT00000067420
Ensembl Acc Id:
ENSRNOP00000009724 ⟸ ENSRNOT00000009724
RefSeq Acc Id:
XP_038937372 ⟸ XM_039081444
- Peptide Label:
isoform X10
RefSeq Acc Id:
XP_038937373 ⟸ XM_039081445
- Peptide Label:
isoform X11
Ensembl Acc Id:
ENSRNOP00000091262 ⟸ ENSRNOT00000102592
Ensembl Acc Id:
ENSRNOP00000083392 ⟸ ENSRNOT00000119039
Ensembl Acc Id:
ENSRNOP00000090131 ⟸ ENSRNOT00000099397
RefSeq Acc Id:
XP_063121511 ⟸ XM_063265441
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6A8Q3 (UniProtKB/TrEMBL), A0A8I6AFT3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121512 ⟸ XM_063265442
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6AFT3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121513 ⟸ XM_063265443
- Peptide Label:
isoform X12
RGD ID: 13695958 Promoter ID: EPDNEW_R6464 Type: initiation region Name: Usp28_1 Description: ubiquitin specific peptidase 28 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 53,295,191 - 53,295,251 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Usp28
ubiquitin specific peptidase 28
Usp28_predicted
ubiquitin specific protease 28 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Usp28_predicted
ubiquitin specific protease 28 (predicted)
Symbol and Name status set to approved
70820 APPROVED
