Symbol:
Rpia
Name:
ribose 5-phosphate isomerase A
RGD ID:
1311377
Description:
Enables monosaccharide binding activity and ribose-5-phosphate isomerase activity. Involved in pentose-phosphate shunt, non-oxidative branch. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Orthologous to human RPIA (ribose 5-phosphate isomerase A); PARTICIPATES IN pentose phosphate pathway; ribose 5-phosphate isomerase deficiency pathway; transaldolase deficiency pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC362383; ribose-5-phosphate isomerase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 104,282,081 - 104,307,732 (-) NCBI GRCr8 mRatBN7.2 4 102,723,712 - 102,749,374 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 102,723,712 - 102,749,355 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 108,114,413 - 108,140,077 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 103,889,488 - 103,915,156 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 102,493,631 - 102,519,248 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 98,568,028 - 98,593,664 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 98,568,028 - 98,593,664 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 163,347,716 - 163,373,352 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 103,934,938 - 103,960,574 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 104,179,418 - 104,205,030 (-) NCBI Celera 4 91,899,774 - 91,925,410 (-) NCBI Celera Cytogenetic Map 4 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rpia Rat 1,2-dimethylhydrazine decreases expression ISO Rpia (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RPIA mRNA CTD PMID:22206623 Rpia Rat 17alpha-ethynylestradiol multiple interactions ISO Rpia (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RPIA mRNA CTD PMID:17942748 Rpia Rat 17beta-estradiol decreases expression ISO Rpia (Mus musculus) 6480464 Estradiol results in decreased expression of RPIA mRNA CTD PMID:39298647 Rpia Rat 17beta-estradiol increases expression ISO RPIA (Homo sapiens) 6480464 Estradiol results in increased expression of RPIA mRNA CTD PMID:31614463 Rpia Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RPIA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RPIA mRNA CTD PMID:20106945 Rpia Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rpia (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RPIA mRNA CTD PMID:21570461 Rpia Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RPIA mRNA CTD PMID:22298810 and PMID:34747641 Rpia Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rpia (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RPIA mRNA CTD PMID:17942748 Rpia Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RPIA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of RPIA mRNA CTD PMID:19684285 Rpia Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of RPIA mRNA CTD PMID:21346803 Rpia Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of RPIA mRNA CTD PMID:21346803 Rpia Rat 2-hydroxypropanoic acid decreases expression ISO RPIA (Homo sapiens) 6480464 Lactic Acid results in decreased expression of RPIA mRNA CTD PMID:30851411 Rpia Rat 2-methylcholine affects expression ISO RPIA (Homo sapiens) 6480464 beta-methylcholine affects the expression of RPIA mRNA CTD PMID:21179406 Rpia Rat 2-palmitoylglycerol increases expression ISO RPIA (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of RPIA mRNA CTD PMID:37199045 Rpia Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of RPIA protein CTD PMID:34915118 Rpia Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of RPIA mRNA CTD PMID:28628672 Rpia Rat 4,4'-diaminodiphenylmethane decreases expression ISO Rpia (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of RPIA mRNA CTD PMID:18648102 Rpia Rat 4,4'-sulfonyldiphenol decreases methylation ISO RPIA (Homo sapiens) 6480464 bisphenol S results in decreased methylation of RPIA gene CTD PMID:31601247 Rpia Rat 4-hydroxyphenyl retinamide decreases expression ISO Rpia (Mus musculus) 6480464 Fenretinide results in decreased expression of RPIA mRNA CTD PMID:28973697 Rpia Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RPIA mRNA CTD PMID:30047161 Rpia Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of RPIA mRNA CTD PMID:28959563 Rpia Rat Aflatoxin B2 alpha increases methylation ISO RPIA (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of RPIA intron CTD PMID:30157460 Rpia Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of RPIA mRNA CTD PMID:30047161 Rpia Rat aristolochic acid A decreases expression ISO RPIA (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RPIA mRNA CTD PMID:33212167 Rpia Rat bisphenol A increases expression ISO Rpia (Mus musculus) 6480464 bisphenol A results in increased expression of RPIA mRNA CTD PMID:21932408 Rpia Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RPIA mRNA CTD PMID:30816183 and PMID:32528016 Rpia Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RPIA mRNA CTD PMID:25181051 Rpia Rat bisphenol F multiple interactions ISO RPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of RPIA mRNA CTD PMID:28628672 Rpia Rat bisphenol F decreases expression ISO Rpia (Mus musculus) 6480464 bisphenol F results in decreased expression of RPIA mRNA CTD PMID:38685157 Rpia Rat cadmium dichloride decreases expression ISO RPIA (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of RPIA mRNA CTD PMID:38568856 Rpia Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of RPIA mRNA CTD PMID:20864626 Rpia Rat calcitriol multiple interactions ISO RPIA (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of RPIA mRNA CTD PMID:21592394 Rpia Rat calcitriol decreases expression ISO RPIA (Homo sapiens) 6480464 Calcitriol results in decreased expression of RPIA mRNA CTD PMID:21592394 Rpia Rat captan decreases expression ISO Rpia (Mus musculus) 6480464 Captan results in decreased expression of RPIA mRNA CTD PMID:31558096 Rpia Rat CGP 52608 multiple interactions ISO RPIA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RPIA gene] CTD PMID:28238834 Rpia Rat chlorpyrifos increases expression ISO Rpia (Mus musculus) 6480464 Chlorpyrifos results in increased expression of RPIA mRNA CTD PMID:37019170 Rpia Rat clofibrate increases expression ISO Rpia (Mus musculus) 6480464 Clofibrate results in increased expression of RPIA mRNA CTD PMID:23811191 Rpia Rat cobalt dichloride decreases expression ISO RPIA (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of RPIA mRNA CTD PMID:19320972 Rpia Rat DDE increases expression ISO RPIA (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of RPIA mRNA CTD PMID:38568856 Rpia Rat dexamethasone multiple interactions ISO RPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of RPIA mRNA CTD PMID:28628672 Rpia Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of RPIA mRNA CTD PMID:21266533 Rpia Rat disodium selenite increases expression ISO RPIA (Homo sapiens) 6480464 Sodium Selenite results in increased expression of RPIA mRNA CTD PMID:18175754 Rpia Rat enzyme inhibitor multiple interactions ISO RPIA (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of RPIA protein CTD PMID:23301498 Rpia Rat ethanol affects expression ISO Rpia (Mus musculus) 6480464 Ethanol affects the expression of RPIA mRNA CTD PMID:30319688 Rpia Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of RPIA mRNA CTD PMID:30307764 Rpia Rat finasteride decreases expression EXP 6480464 Finasteride results in decreased expression of RPIA mRNA CTD PMID:24136188 Rpia Rat folic acid decreases expression ISO Rpia (Mus musculus) 6480464 Folic Acid results in decreased expression of RPIA mRNA CTD PMID:25629700 Rpia Rat FR900359 increases phosphorylation ISO RPIA (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of RPIA protein CTD PMID:37730182 Rpia Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RPIA protein CTD PMID:22061828 Rpia Rat hydrogen cyanide decreases expression ISO Rpia (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of RPIA mRNA CTD PMID:33914522 Rpia Rat hydrogen peroxide affects expression ISO RPIA (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of RPIA mRNA CTD PMID:20044591 Rpia Rat indometacin multiple interactions ISO RPIA (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of RPIA mRNA CTD PMID:28628672 Rpia Rat ivermectin decreases expression ISO RPIA (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPIA protein CTD PMID:32959892 Rpia Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of RPIA mRNA CTD PMID:30047161 Rpia Rat methoxyacetic acid decreases expression EXP 6480464 methoxyacetic acid results in decreased expression of RPIA mRNA CTD PMID:20864626 Rpia Rat methyl methanesulfonate decreases expression ISO RPIA (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of RPIA mRNA CTD PMID:23649840 Rpia Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of RPIA mRNA CTD PMID:20864626 Rpia Rat methylseleninic acid decreases expression ISO RPIA (Homo sapiens) 6480464 methylselenic acid results in decreased expression of RPIA mRNA CTD PMID:18548127 Rpia Rat Monobutylphthalate decreases expression EXP 6480464 monobutyl phthalate results in decreased expression of RPIA mRNA CTD PMID:20864626 Rpia Rat nitrates multiple interactions ISO Rpia (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RPIA mRNA CTD PMID:35964746 Rpia Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of RPIA mRNA CTD PMID:27638505 Rpia Rat perfluorohexanesulfonic acid decreases expression ISO Rpia (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of RPIA mRNA CTD PMID:37995155 Rpia Rat perfluorooctane-1-sulfonic acid affects expression ISO Rpia (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of RPIA mRNA CTD PMID:19429403 Rpia Rat perfluorooctanoic acid affects expression ISO Rpia (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of RPIA mRNA CTD PMID:19429403 Rpia Rat phenobarbital affects expression ISO RPIA (Homo sapiens) 6480464 Phenobarbital affects the expression of RPIA mRNA CTD PMID:19159669 Rpia Rat phenobarbital increases expression ISO Rpia (Mus musculus) 6480464 Phenobarbital results in increased expression of RPIA mRNA CTD PMID:31836555 Rpia Rat pirinixic acid multiple interactions ISO Rpia (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of RPIA mRNA CTD PMID:19710929 Rpia Rat pirinixic acid increases expression ISO Rpia (Mus musculus) 6480464 pirinixic acid results in increased expression of RPIA mRNA CTD PMID:17426115 and PMID:18301758 Rpia Rat piroxicam decreases expression ISO RPIA (Homo sapiens) 6480464 Piroxicam results in decreased expression of RPIA mRNA CTD PMID:21858171 Rpia Rat potassium cyanide decreases expression ISO Rpia (Mus musculus) 6480464 Potassium Cyanide results in decreased expression of RPIA mRNA CTD PMID:33914522 Rpia Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of RPIA mRNA CTD PMID:30047161 Rpia Rat rac-lactic acid decreases expression ISO RPIA (Homo sapiens) 6480464 Lactic Acid results in decreased expression of RPIA mRNA CTD PMID:30851411 Rpia Rat sodium arsenite affects methylation ISO RPIA (Homo sapiens) 6480464 sodium arsenite affects the methylation of RPIA gene CTD PMID:28589171 Rpia Rat sodium arsenite decreases expression ISO RPIA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RPIA mRNA CTD PMID:38568856 Rpia Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of RPIA mRNA CTD PMID:24136188 Rpia Rat sunitinib increases expression ISO RPIA (Homo sapiens) 6480464 Sunitinib results in increased expression of RPIA mRNA CTD PMID:31533062 Rpia Rat T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of RPIA mRNA CTD PMID:26141394 Rpia Rat tamoxifen affects expression ISO Rpia (Mus musculus) 6480464 Tamoxifen affects the expression of RPIA mRNA CTD PMID:20937368 Rpia Rat temozolomide increases expression ISO RPIA (Homo sapiens) 6480464 Temozolomide results in increased expression of RPIA mRNA CTD PMID:31758290 Rpia Rat testosterone multiple interactions ISO RPIA (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of RPIA mRNA CTD PMID:21592394 Rpia Rat testosterone decreases expression ISO RPIA (Homo sapiens) 6480464 Testosterone results in decreased expression of RPIA mRNA CTD PMID:21592394 and PMID:33359661 Rpia Rat tetrachloromethane increases expression ISO Rpia (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of RPIA mRNA CTD PMID:31919559 Rpia Rat thapsigargin decreases expression ISO Rpia (Mus musculus) 6480464 Thapsigargin results in decreased expression of RPIA protein CTD PMID:24648495 Rpia Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of RPIA mRNA CTD PMID:34492290 Rpia Rat titanium dioxide decreases methylation ISO Rpia (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RPIA gene CTD PMID:35295148 Rpia Rat valproic acid affects expression ISO Rpia (Mus musculus) 6480464 Valproic Acid affects the expression of RPIA mRNA CTD PMID:17292431 Rpia Rat valproic acid increases expression ISO RPIA (Homo sapiens) 6480464 Valproic Acid results in increased expression of RPIA mRNA CTD PMID:29154799 Rpia Rat zinc atom decreases expression ISO RPIA (Homo sapiens) 6480464 Zinc results in decreased expression of RPIA protein CTD PMID:15984569 Rpia Rat zinc(0) decreases expression ISO RPIA (Homo sapiens) 6480464 Zinc results in decreased expression of RPIA protein CTD PMID:15984569
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 2-palmitoylglycerol (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) Aflatoxin B2 alpha (ISO) amitrole (EXP) aristolochic acid A (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) caffeine (EXP) calcitriol (ISO) captan (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) clofibrate (ISO) cobalt dichloride (ISO) DDE (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) disodium selenite (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenvalerate (EXP) finasteride (EXP) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) hydrogen cyanide (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) methimazole (EXP) methoxyacetic acid (EXP) methyl methanesulfonate (ISO) methylmercury chloride (EXP) methylseleninic acid (ISO) Monobutylphthalate (EXP) nitrates (ISO) p-toluidine (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) piroxicam (ISO) potassium cyanide (ISO) pregnenolone 16alpha-carbonitrile (EXP) rac-lactic acid (ISO) sodium arsenite (ISO) sulindac (EXP) sunitinib (ISO) T-2 toxin (EXP) tamoxifen (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Rpia Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 104,282,081 - 104,307,732 (-) NCBI GRCr8 mRatBN7.2 4 102,723,712 - 102,749,374 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 102,723,712 - 102,749,355 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 108,114,413 - 108,140,077 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 103,889,488 - 103,915,156 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 102,493,631 - 102,519,248 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 98,568,028 - 98,593,664 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 98,568,028 - 98,593,664 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 163,347,716 - 163,373,352 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 103,934,938 - 103,960,574 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 104,179,418 - 104,205,030 (-) NCBI Celera 4 91,899,774 - 91,925,410 (-) NCBI Celera Cytogenetic Map 4 q32 NCBI
RPIA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 88,691,673 - 88,750,929 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 88,691,673 - 88,750,929 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 88,991,191 - 89,050,446 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 88,772,291 - 88,831,567 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 88,830,465 - 88,889,707 NCBI Celera 2 87,738,845 - 87,795,148 (-) NCBI Celera Cytogenetic Map 2 p11.2 NCBI HuRef 2 87,913,138 - 87,969,437 (+) NCBI HuRef CHM1_1 2 88,920,696 - 88,980,049 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 88,703,670 - 88,759,952 (+) NCBI T2T-CHM13v2.0
Rpia Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 70,742,704 - 70,769,159 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 70,742,704 - 70,769,216 (-) Ensembl GRCm39 Ensembl GRCm38 6 70,765,720 - 70,792,175 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 70,765,720 - 70,792,232 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 70,715,714 - 70,742,169 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 70,695,280 - 70,721,734 (-) NCBI MGSCv36 mm8 Celera 6 72,851,114 - 72,877,569 (-) NCBI Celera Cytogenetic Map 6 C1 NCBI cM Map 6 32.06 NCBI
Rpia Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 106,978 - 135,612 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 107,297 - 135,577 (-) NCBI ChiLan1.0 ChiLan1.0
RPIA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 38,555,220 - 38,624,558 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 38,557,979 - 38,617,887 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 87,823,741 - 87,880,061 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 89,731,335 - 89,787,512 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 89,731,335 - 89,787,512 (+) Ensembl panpan1.1 panPan2
RPIA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 37,640,740 - 37,671,308 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 37,491,846 - 37,522,341 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 38,539,274 - 38,569,568 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 38,539,842 - 38,569,664 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 37,705,845 - 37,736,309 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 37,742,287 - 37,772,838 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 38,091,779 - 38,122,295 (-) NCBI UU_Cfam_GSD_1.0
Rpia Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 78,496,444 - 78,523,704 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936712 2,334,744 - 2,362,036 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936712 2,335,255 - 2,362,004 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPIA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 57,355,975 - 57,386,939 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 57,355,973 - 57,386,948 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 59,834,039 - 59,864,841 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RPIA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 18,015,873 - 18,071,177 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 18,016,740 - 18,071,013 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666080 1,707,353 - 1,762,443 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rpia
.
Predicted Target Of
Count of predictions: 90 Count of miRNA genes: 83 Interacting mature miRNAs: 86 Transcripts: ENSRNOT00000007927 Prediction methods: Miranda Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 2317587 Eae26 Experimental allergic encephalomyelitis QTL 26 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 4 88656681 103194984 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 8662350 Eae35 Experimental allergic encephalomyelitis QTL 35 6.2 blood tumor necrosis factor amount (VT:0008552) inflammatory exudate tumor necrosis factor level (CMO:0001435) 4 100834579 103761084 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat
RH129819
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 102,723,870 - 102,724,084 (+) MAPPER mRatBN7.2 Rnor_6.0 4 98,568,187 - 98,568,400 NCBI Rnor6.0 Rnor_5.0 4 163,347,875 - 163,348,088 UniSTS Rnor5.0 RGSC_v3.4 4 103,935,097 - 103,935,310 UniSTS RGSC3.4 Celera 4 91,899,933 - 91,900,146 UniSTS RH 3.4 Map 4 633.23 UniSTS Cytogenetic Map 4 q32 UniSTS
RPIA
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 104,290,079 - 104,290,827 (+) Marker Load Pipeline mRatBN7.2 4 102,731,716 - 102,732,464 (+) MAPPER mRatBN7.2 Rnor_6.0 4 98,576,027 - 98,576,774 NCBI Rnor6.0 Rnor_5.0 4 163,355,715 - 163,356,462 UniSTS Rnor5.0 RGSC_v3.4 4 103,942,937 - 103,943,684 UniSTS RGSC3.4 Celera 4 91,907,773 - 91,908,520 UniSTS Cytogenetic Map 4 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007927 ⟹ ENSRNOP00000007927
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 102,723,712 - 102,749,355 (-) Ensembl Rnor_6.0 Ensembl 4 98,568,028 - 98,593,664 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094761 ⟹ ENSRNOP00000097607
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 102,723,712 - 102,749,355 (-) Ensembl
RefSeq Acc Id:
NM_001108632 ⟹ NP_001102102
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 104,282,081 - 104,307,718 (-) NCBI mRatBN7.2 4 102,723,712 - 102,749,355 (-) NCBI Rnor_6.0 4 98,568,028 - 98,593,664 (-) NCBI Rnor_5.0 4 163,347,716 - 163,373,352 (-) NCBI RGSC_v3.4 4 103,934,938 - 103,960,574 (-) RGD Celera 4 91,899,774 - 91,925,410 (-) RGD
Sequence:
GCGGCCGCAGAGGCTGGAGCGAGGCGGCGGGATGCAGCGCCCCGGGCCCTTCAGCACCCTCTACGGGCGGGTCCTGGCCCCACTGCCCGGGCGGGCCGGGGGCGCGGCCTCGGGTGGGGGCGGGAACA
hide sequence
RefSeq Acc Id:
XM_006236628 ⟹ XP_006236690
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 104,282,100 - 104,307,732 (-) NCBI mRatBN7.2 4 102,723,731 - 102,749,374 (-) NCBI Rnor_6.0 4 98,568,047 - 98,593,664 (-) NCBI Rnor_5.0 4 163,347,716 - 163,373,352 (-) NCBI
Sequence:
GCGGCCGCAGAGGCTGGAGCGAGGCGGCGGGATGCAGCGCCCCGGGCCCTTCAGCACCCTCTAC
hide sequence
RefSeq Acc Id:
NP_001102102 ⟸ NM_001108632
- UniProtKB:
D4A7L6 (UniProtKB/TrEMBL), A6IA59 (UniProtKB/TrEMBL)
- Sequence:
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNNWGLSGSHVQLPGRTQSETRGDKGGSSAGGPAPSTMSKAEEAKKLASHTAVENHVKNNQVLGIGSGSTIVHAVQRIAERVKQENLDLICIPTSFQA
hide sequence
RefSeq Acc Id:
XP_006236690 ⟸ XM_006236628
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AS52 (UniProtKB/TrEMBL)
- Sequence:
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNNWGLSGSHVQLPGRTQSETRGDKGGSSAGGPA
hide sequence
Ensembl Acc Id:
ENSRNOP00000007927 ⟸ ENSRNOT00000007927
Ensembl Acc Id:
ENSRNOP00000097607 ⟸ ENSRNOT00000094761
RGD ID: 13693105 Promoter ID: EPDNEW_R3630 Type: single initiation site Name: Rpia_1 Description: ribose 5-phosphate isomerase A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 98,593,658 - 98,593,718 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Rpia
ribose 5-phosphate isomerase A
Rpia_predicted
ribose 5-phosphate isomerase A (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Rpia_predicted
ribose 5-phosphate isomerase A (predicted)
Symbol and Name status set to approved
70820 APPROVED
