Symbol:
Otub1
Name:
OTU deubiquitinase, ubiquitin aldehyde binding 1
RGD ID:
1311329
Description:
Predicted to enable several functions, including ubiquitin protein ligase binding activity; ubiquitin-like protein peptidase activity; and ubiquitin-protein transferase inhibitor activity. Involved in cellular response to interleukin-1. Predicted to be located in cytoplasm and membrane. Orthologous to human OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1); PARTICIPATES IN ataxia telangiectasia-mutated (ATM) signaling pathway; INTERACTS WITH 2,4-dinitrotoluene; 4,4'-sulfonyldiphenol; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
deubiquitinating enzyme OTUB1; LOC293705; OTU domain, ubiquitin aldehyde binding 1; OTU domain-containing ubiquitin aldehyde-binding protein 1; otubain-1; ubiquitin thioesterase OTUB1; ubiquitin-specific-processing protease OTUB1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1) HGNC
Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Otub1 (OTU domain, ubiquitin aldehyde binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Otub1 (OTU deubiquitinase, ubiquitin aldehyde binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Otub1 (OTU deubiquitinase, ubiquitin aldehyde binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Otub1 (OTU deubiquitinase, ubiquitin aldehyde binding 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
OTUB1 (OTU deubiquitinase, ubiquitin aldehyde binding 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Otub1 (OTU domain, ubiquitin aldehyde binding 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
otub1b (OTU deubiquitinase, ubiquitin aldehyde binding 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
otub1a (OTU deubiquitinase, ubiquitin aldehyde binding 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
otub-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4968
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 213,816,400 - 213,824,679 (-) NCBI GRCr8 mRatBN7.2 1 204,387,215 - 204,395,495 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 204,387,215 - 204,395,483 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 212,737,134 - 212,745,426 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 219,832,446 - 219,840,723 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 212,523,497 - 212,531,775 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 222,451,674 - 222,459,952 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 222,451,674 - 222,459,952 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 229,442,242 - 229,450,521 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 209,871,581 - 209,879,518 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 210,030,010 - 210,044,513 (-) NCBI Celera 1 201,919,929 - 201,928,118 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Otub1 Rat 1,2-dimethylhydrazine increases expression ISO Otub1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of OTUB1 mRNA CTD PMID:22206623 Otub1 Rat 17beta-estradiol increases expression ISO Otub1 (Mus musculus) 6480464 Estradiol results in increased expression of OTUB1 mRNA CTD PMID:39298647 Otub1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO OTUB1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Otub1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Otub1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Otub1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of OTUB1 mRNA CTD PMID:21346803 Otub1 Rat 2,6-dimethoxyphenol multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization of OTUB1 protein CTD PMID:38598786 Otub1 Rat 2-palmitoylglycerol increases expression ISO OTUB1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of OTUB1 mRNA CTD PMID:37199045 Otub1 Rat 4,4'-sulfonyldiphenol increases expression ISO Otub1 (Mus musculus) 6480464 bisphenol S results in increased expression of OTUB1 mRNA CTD PMID:39298647 Otub1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of OTUB1 mRNA CTD PMID:36041667 Otub1 Rat 4-hydroxynon-2-enal multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [[BGN mRNA alternative form binds to OTUB1 protein] which binds to and results in decreased ubiquitination of and results in increased stability of SLC7A11 protein] which results in decreased abundance of 4-hydroxy-2-nonenal CTD PMID:35234341 Otub1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of OTUB1 mRNA CTD PMID:38685447 Otub1 Rat benzo[a]pyrene increases mutagenesis ISO OTUB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of OTUB1 gene CTD PMID:25435355 Otub1 Rat benzo[a]pyrene affects methylation ISO OTUB1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of OTUB1 promoter CTD PMID:27901495 Otub1 Rat beta-lapachone decreases expression ISO OTUB1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of OTUB1 mRNA CTD PMID:38218311 Otub1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Otub1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of OTUB1 mRNA CTD PMID:33754040 Otub1 Rat bisphenol A increases expression ISO Otub1 (Mus musculus) 6480464 bisphenol A results in increased expression of OTUB1 mRNA CTD PMID:26063408 Otub1 Rat bisphenol A increases expression ISO OTUB1 (Homo sapiens) 6480464 bisphenol A results in increased expression of OTUB1 protein CTD PMID:37567409 Otub1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of OTUB1 mRNA CTD PMID:36041667 Otub1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of OTUB1 mRNA CTD PMID:25181051 Otub1 Rat Bisphenol A diglycidyl ether affects splicing ISO Otub1 (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of OTUB1 mRNA CTD PMID:36464114 Otub1 Rat bisphenol AF increases expression ISO OTUB1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of OTUB1 protein CTD PMID:34186270 Otub1 Rat bisphenol AF affects splicing ISO Otub1 (Mus musculus) 6480464 bisphenol AF affects the splicing of OTUB1 mRNA CTD PMID:36464114 Otub1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of OTUB1 mRNA CTD PMID:36041667 Otub1 Rat caffeine decreases phosphorylation ISO OTUB1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of OTUB1 protein CTD PMID:35688186 Otub1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of OTUB1 mRNA CTD PMID:18668222 Otub1 Rat chlorpyrifos increases expression ISO Otub1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of OTUB1 mRNA CTD PMID:37019170 Otub1 Rat cobalt dichloride decreases expression ISO OTUB1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of OTUB1 mRNA CTD PMID:19376846 Otub1 Rat copper atom decreases expression ISO Otub1 (Mus musculus) 6480464 Copper results in decreased expression of OTUB1 protein CTD PMID:23882024 Otub1 Rat copper(0) decreases expression ISO Otub1 (Mus musculus) 6480464 Copper results in decreased expression of OTUB1 protein CTD PMID:23882024 Otub1 Rat coumarin increases phosphorylation ISO OTUB1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of OTUB1 protein CTD PMID:35688186 Otub1 Rat crocidolite asbestos decreases expression ISO Otub1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of OTUB1 mRNA CTD PMID:29279043 Otub1 Rat CU-O LINKAGE decreases expression ISO Otub1 (Mus musculus) 6480464 cupric oxide analog results in decreased expression of OTUB1 protein CTD PMID:23882024 Otub1 Rat curcumin decreases expression ISO OTUB1 (Homo sapiens) 6480464 Curcumin results in decreased expression of OTUB1 mRNA CTD PMID:38229314 Otub1 Rat DDE increases expression ISO OTUB1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of OTUB1 mRNA CTD PMID:38568856 Otub1 Rat diquat decreases expression ISO Otub1 (Mus musculus) 6480464 Diquat results in decreased expression of OTUB1 protein CTD PMID:36851058 Otub1 Rat diuron decreases expression ISO OTUB1 (Homo sapiens) 6480464 Diuron results in decreased expression of OTUB1 mRNA CTD PMID:35967413 Otub1 Rat dorsomorphin multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OTUB1 mRNA CTD PMID:27188386 Otub1 Rat enzyme inhibitor multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of OTUB1 protein CTD PMID:23301498 Otub1 Rat epoxiconazole decreases expression ISO Otub1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of OTUB1 mRNA CTD PMID:35436446 Otub1 Rat ethanol affects splicing ISO Otub1 (Mus musculus) 6480464 Ethanol affects the splicing of OTUB1 mRNA CTD PMID:30319688 Otub1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of OTUB1 mRNA CTD PMID:24136188 Otub1 Rat FR900359 increases phosphorylation ISO OTUB1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of OTUB1 protein CTD PMID:37730182 Otub1 Rat furfural multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Otub1 Rat glutathione multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [[BGN mRNA alternative form binds to OTUB1 protein] which binds to and results in decreased ubiquitination of and results in increased stability of SLC7A11 protein] which results in increased chemical synthesis of Glutathione CTD PMID:35234341 Otub1 Rat hydrogen peroxide multiple interactions ISO Otub1 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Otub1 Rat isoprenaline decreases expression ISO Otub1 (Mus musculus) 6480464 Isoproterenol results in decreased expression of OTUB1 mRNA CTD PMID:20003209 Otub1 Rat ivermectin decreases expression ISO OTUB1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of OTUB1 protein CTD PMID:32959892 Otub1 Rat lead diacetate increases expression ISO Otub1 (Mus musculus) 6480464 lead acetate results in increased expression of OTUB1 mRNA CTD PMID:21829687 Otub1 Rat lipopolysaccharide increases expression ISO Otub1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of OTUB1 mRNA CTD PMID:15919760 Otub1 Rat malonaldehyde multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [[BGN mRNA alternative form binds to OTUB1 protein] which binds to and results in decreased ubiquitination of and results in increased stability of SLC7A11 protein] which results in decreased abundance of Malondialdehyde CTD PMID:35234341 Otub1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of OTUB1 mRNA CTD PMID:38685447 Otub1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of OTUB1 mRNA CTD PMID:24136188 Otub1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of OTUB1 mRNA CTD PMID:24136188 Otub1 Rat paracetamol affects expression ISO Otub1 (Mus musculus) 6480464 Acetaminophen affects the expression of OTUB1 mRNA CTD PMID:17562736 Otub1 Rat progesterone affects expression ISO Otub1 (Mus musculus) 6480464 Progesterone affects the expression of OTUB1 mRNA CTD PMID:17251523 Otub1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of OTUB1 mRNA CTD PMID:28374803 Otub1 Rat SB 431542 multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Otub1 Rat sodium arsenate increases expression ISO Otub1 (Mus musculus) 6480464 sodium arsenate results in increased expression of OTUB1 mRNA CTD PMID:21795629 Otub1 Rat sodium arsenite increases expression ISO Otub1 (Mus musculus) 6480464 sodium arsenite results in increased expression of OTUB1 protein CTD PMID:29044176 Otub1 Rat sodium arsenite decreases expression ISO OTUB1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of OTUB1 mRNA CTD PMID:38568856 Otub1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of OTUB1 protein CTD PMID:29459688 Otub1 Rat sodium chloride multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of OTUB1 protein CTD PMID:38598786 Otub1 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of OTUB1 mRNA CTD PMID:19281266 Otub1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of OTUB1 protein CTD PMID:35544339 Otub1 Rat triphenyl phosphate affects expression ISO OTUB1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of OTUB1 mRNA CTD PMID:37042841 Otub1 Rat valproic acid increases methylation ISO OTUB1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of OTUB1 gene CTD PMID:29154799 Otub1 Rat valproic acid multiple interactions ISO OTUB1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OTUB1 mRNA CTD PMID:27188386 Otub1 Rat valproic acid decreases expression ISO OTUB1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of OTUB1 mRNA CTD PMID:23179753 more ... Otub1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of OTUB1 mRNA CTD PMID:19015723 Otub1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of OTUB1 mRNA CTD PMID:23034163
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (ISO) amitrole (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) bisphenol F (EXP) caffeine (ISO) chlorpyrifos (EXP,ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) coumarin (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) curcumin (ISO) DDE (ISO) diquat (ISO) diuron (ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) flutamide (EXP) FR900359 (ISO) furfural (ISO) glutathione (ISO) hydrogen peroxide (ISO) isoprenaline (ISO) ivermectin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) malonaldehyde (ISO) methimazole (EXP) nefazodone (EXP) nimesulide (EXP) paracetamol (ISO) progesterone (ISO) rotenone (EXP) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) Soman (EXP) thapsigargin (EXP) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP)
Otub1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 213,816,400 - 213,824,679 (-) NCBI GRCr8 mRatBN7.2 1 204,387,215 - 204,395,495 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 204,387,215 - 204,395,483 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 212,737,134 - 212,745,426 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 219,832,446 - 219,840,723 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 212,523,497 - 212,531,775 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 222,451,674 - 222,459,952 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 222,451,674 - 222,459,952 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 229,442,242 - 229,450,521 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 209,871,581 - 209,879,518 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 210,030,010 - 210,044,513 (-) NCBI Celera 1 201,919,929 - 201,928,118 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
OTUB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 63,986,438 - 63,998,412 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 63,985,853 - 64,001,811 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 63,753,910 - 63,765,884 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 63,509,901 - 63,522,468 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 63,510,460 - 63,522,463 NCBI Celera 11 61,080,100 - 61,092,667 (+) NCBI Celera Cytogenetic Map 11 q13.1 NCBI HuRef 11 60,082,024 - 60,094,513 (+) NCBI HuRef CHM1_1 11 63,636,649 - 63,649,224 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 63,976,132 - 63,988,115 (+) NCBI T2T-CHM13v2.0
Otub1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 7,175,571 - 7,183,649 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 7,175,567 - 7,183,681 (-) Ensembl GRCm39 Ensembl GRCm38 19 7,198,206 - 7,206,284 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 7,198,202 - 7,206,316 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 7,272,696 - 7,280,774 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 7,265,250 - 7,273,328 (-) NCBI MGSCv36 mm8 Celera 19 6,975,017 - 6,983,084 (-) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 5.27 NCBI
Otub1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 21,047,184 - 21,055,616 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 21,047,184 - 21,055,596 (-) NCBI ChiLan1.0 ChiLan1.0
OTUB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 65,212,054 - 65,225,024 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 66,257,229 - 66,270,198 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 59,342,820 - 59,355,386 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 62,690,542 - 62,702,739 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 62,690,542 - 62,706,542 (+) Ensembl panpan1.1 panPan2
OTUB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 40,225,531 - 40,226,507 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 40,225,474 - 40,226,612 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 53,034,387 - 53,041,481 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 51,640,620 - 51,647,898 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 54,078,482 - 54,086,513 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 54,078,490 - 54,086,562 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 53,181,634 - 53,188,897 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 52,757,302 - 52,764,567 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 53,541,625 - 53,548,912 (-) NCBI UU_Cfam_GSD_1.0
Otub1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 8,712,639 - 8,721,576 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 5,153,993 - 5,173,046 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 5,154,988 - 5,163,919 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
OTUB1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 8,087,829 - 8,095,609 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 8,088,528 - 8,095,555 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 7,205,414 - 7,212,452 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OTUB1
Otub1
.
Predicted Target Of
Count of predictions: 154 Count of miRNA genes: 113 Interacting mature miRNAs: 133 Transcripts: ENSRNOT00000028752 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
RH132561
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 204,387,415 - 204,387,608 (+) MAPPER mRatBN7.2 Rnor_6.0 1 222,451,875 - 222,452,067 NCBI Rnor6.0 Rnor_5.0 1 229,442,443 - 229,442,635 UniSTS Rnor5.0 RGSC_v3.4 1 209,871,782 - 209,871,974 UniSTS RGSC3.4 Celera 1 201,920,130 - 201,920,322 UniSTS RH 3.4 Map 1 1521.1 UniSTS Cytogenetic Map 1 q43 UniSTS
RH142168
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 204,388,079 - 204,388,415 (+) MAPPER mRatBN7.2 mRatBN7.2 7 14,196,502 - 14,196,708 (+) MAPPER mRatBN7.2 Rnor_6.0 7 18,280,689 - 18,280,894 NCBI Rnor6.0 Rnor_6.0 1 222,452,539 - 222,452,874 NCBI Rnor6.0 Rnor_5.0 7 18,453,070 - 18,453,275 UniSTS Rnor5.0 Rnor_5.0 1 229,443,107 - 229,443,442 UniSTS Rnor5.0 RGSC_v3.4 1 209,872,446 - 209,872,781 UniSTS RGSC3.4 RGSC_v3.4 7 15,904,746 - 15,904,951 UniSTS RGSC3.4 Celera 7 13,102,078 - 13,102,283 UniSTS Celera 1 201,920,794 - 201,921,129 UniSTS RH 3.4 Map 7 68.0 UniSTS Cytogenetic Map 1 q43 UniSTS Cytogenetic Map 7 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028752 ⟹ ENSRNOP00000028752
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,387,215 - 204,395,478 (-) Ensembl Rnor_6.0 Ensembl 1 222,451,674 - 222,459,952 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095568 ⟹ ENSRNOP00000090096
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,388,032 - 204,395,477 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101186 ⟹ ENSRNOP00000088887
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,387,232 - 204,395,483 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114563 ⟹ ENSRNOP00000077159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,387,880 - 204,395,481 (-) Ensembl
RefSeq Acc Id:
NM_001106332 ⟹ NP_001099802
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,816,400 - 213,824,679 (-) NCBI mRatBN7.2 1 204,387,215 - 204,395,495 (-) NCBI Rnor_6.0 1 222,451,674 - 222,459,952 (-) NCBI Rnor_5.0 1 229,442,242 - 229,450,521 (-) NCBI RGSC_v3.4 1 209,871,581 - 209,879,518 (-) RGD Celera 1 201,919,929 - 201,928,118 (-) RGD
Sequence:
ATCGCCAGTGCAGCGCTGTTTAAAGATGGCGGCGGAGGAACCTCAGCAGCAGAAGCAGGAGCCGCTGGGCAGCGATTCCGAAGGTGTTAACTGTCTAGCCTATGATGAAGCCATTATGGCTCAGCAAG
hide sequence
RefSeq Acc Id:
NP_001099802 ⟸ NM_001106332
- UniProtKB:
B2RYG6 (UniProtKB/Swiss-Prot), A0A8L2QFR7 (UniProtKB/TrEMBL)
- Sequence:
MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000028752 ⟸ ENSRNOT00000028752
Ensembl Acc Id:
ENSRNOP00000077159 ⟸ ENSRNOT00000114563
Ensembl Acc Id:
ENSRNOP00000088887 ⟸ ENSRNOT00000101186
Ensembl Acc Id:
ENSRNOP00000090096 ⟸ ENSRNOT00000095568
RGD ID: 13690718 Promoter ID: EPDNEW_R1243 Type: multiple initiation site Name: Otub1_1 Description: OTU deubiquitinase, ubiquitin aldehyde binding 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 222,459,946 - 222,460,006 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-03-13
Otub1
OTU deubiquitinase, ubiquitin aldehyde binding 1
Otub1
OTU domain, ubiquitin aldehyde binding 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Otub1
OTU domain, ubiquitin aldehyde binding 1
Otub1_predicted
OTU domain, ubiquitin aldehyde binding 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Otub1_predicted
OTU domain, ubiquitin aldehyde binding 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
