Symbol:
Mgst2
Name:
microsomal glutathione S-transferase 2
RGD ID:
1311218
Description:
Enables glutathione peroxidase activity; glutathione transferase activity; and leukotriene-C4 synthase activity. Involved in response to lipopolysaccharide. Predicted to be located in intracellular membrane-bounded organelle and plasma membrane. Predicted to be active in endoplasmic reticulum and nuclear envelope. Orthologous to human MGST2 (microsomal glutathione S-transferase 2); PARTICIPATES IN glutathione metabolic pathway; phase I biotransformation pathway via cytochrome P450; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC295037
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 137,821,787 - 137,866,664 (+) NCBI GRCr8 GRCr8 Ensembl 2 137,836,140 - 137,866,661 (+) Ensembl GRCr8 Ensembl mRatBN7.2 2 135,679,524 - 135,715,828 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 135,693,557 - 135,715,828 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 142,269,446 - 142,291,715 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 140,381,704 - 140,403,975 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 135,013,740 - 135,035,919 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 140,708,396 - 140,727,381 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 140,708,397 - 140,727,281 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 160,180,714 - 160,202,851 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 140,546,939 - 140,568,616 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 130,188,760 - 130,210,429 (+) NCBI Celera RGSC_v3.1 2 140,497,066 - 140,518,579 (+) NCBI Cytogenetic Map 2 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mgst2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MGST2 mRNA] CTD PMID:31150632 Mgst2 Rat 1,1-dichloroethene increases expression ISO Mgst2 (Mus musculus) 6480464 vinylidene chloride results in increased expression of MGST2 mRNA CTD PMID:26682919 Mgst2 Rat 1,2-dimethylhydrazine multiple interactions ISO Mgst2 (Mus musculus) 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MGST2 mRNA CTD PMID:22206623 Mgst2 Rat 1,2-dimethylhydrazine decreases expression ISO Mgst2 (Mus musculus) 6480464 1,2-Dimethylhydrazine results in decreased expression of MGST2 mRNA CTD PMID:22206623 Mgst2 Rat 1-naphthyl isothiocyanate multiple interactions ISO MGST2 (Homo sapiens) 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of MGST2 mRNA CTD PMID:27344345 Mgst2 Rat 17beta-estradiol increases expression ISO MGST2 (Homo sapiens) 6480464 Estradiol results in increased expression of MGST2 mRNA CTD PMID:19167446 Mgst2 Rat 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) multiple interactions ISO MGST2 (Homo sapiens) 6480464 [CYP3A4 protein affects the susceptibility to 2,2'-methylenebis(4-methyl-6-tert-butylphenol)] which affects the expression of MGST2 mRNA CTD PMID:38160208 Mgst2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO MGST2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MGST2 mRNA CTD PMID:15056799|PMID:20106945|PMID:21632981 Mgst2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MGST2 mRNA CTD PMID:34747641 Mgst2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mgst2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MGST2 mRNA CTD PMID:21570461 Mgst2 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of MGST2 mRNA CTD PMID:21346803 Mgst2 Rat 2-acetamidofluorene multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of MGST2 mRNA; [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] more ... CTD PMID:14656948|PMID:16158176 Mgst2 Rat 2-methylcholine affects expression ISO MGST2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of MGST2 mRNA CTD PMID:21179406 Mgst2 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO MGST2 (Homo sapiens) 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of MGST2 mRNA CTD PMID:23146750 Mgst2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MGST2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Mgst2 Rat 3-methylcholanthrene multiple interactions ISO MGST2 (Homo sapiens) 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to MGST2 promoter] CTD PMID:20348232 Mgst2 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1,2-dithiol-3-thione results in increased expression of MGST2 mRNA CTD PMID:19162173 Mgst2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO MGST2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Mgst2 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO Mgst2 (Mus musculus) 6480464 Oxazolone results in decreased expression of MGST2 mRNA CTD PMID:21404309 Mgst2 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of MGST2 mRNA CTD PMID:21346803 Mgst2 Rat 4-hydroxyphenyl retinamide increases expression ISO Mgst2 (Mus musculus) 6480464 Fenretinide results in increased expression of MGST2 mRNA CTD PMID:28973697 Mgst2 Rat 5-aza-2'-deoxycytidine affects expression ISO MGST2 (Homo sapiens) 6480464 Decitabine affects the expression of MGST2 mRNA CTD PMID:23300844 Mgst2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MGST2 mRNA CTD PMID:24780913|PMID:25825206 Mgst2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MGST2 mRNA CTD PMID:31881176 Mgst2 Rat aflatoxin B1 increases methylation ISO MGST2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MGST2 intron CTD PMID:30157460 Mgst2 Rat all-trans-retinoic acid increases expression ISO MGST2 (Homo sapiens) 6480464 Tretinoin results in increased expression of MGST2 mRNA CTD PMID:33167477 Mgst2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MGST2 mRNA CTD PMID:35163327 Mgst2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of MGST2 mRNA CTD PMID:30779732 Mgst2 Rat atrazine increases expression EXP 6480464 Atrazine results in increased expression of MGST2 mRNA CTD PMID:28882082 Mgst2 Rat Azaspiracid increases expression ISO MGST2 (Homo sapiens) 6480464 azaspiracid results in increased expression of MGST2 mRNA CTD PMID:28939011 Mgst2 Rat Azoxymethane multiple interactions ISO Mgst2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of MGST2 more ... CTD PMID:29950665 Mgst2 Rat benzo[a]pyrene increases expression ISO MGST2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MGST2 mRNA CTD PMID:16545412 Mgst2 Rat benzo[a]pyrene increases methylation ISO MGST2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MGST2 promoter CTD PMID:27901495 Mgst2 Rat benzo[a]pyrene affects methylation ISO MGST2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MGST2 intron CTD PMID:30157460 Mgst2 Rat benzo[a]pyrene decreases expression ISO MGST2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MGST2 mRNA CTD PMID:26238291 Mgst2 Rat benzo[a]pyrene increases expression ISO Mgst2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MGST2 mRNA CTD PMID:20713471|PMID:25908611 Mgst2 Rat benzo[a]pyrene decreases expression ISO Mgst2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MGST2 mRNA CTD PMID:20127859 Mgst2 Rat bifenthrin decreases expression ISO Mgst2 (Mus musculus) 6480464 bifenthrin results in decreased expression of MGST2 mRNA CTD PMID:26071804 Mgst2 Rat bilirubin IXalpha decreases expression ISO MGST2 (Homo sapiens) 6480464 Bilirubin results in decreased expression of MGST2 mRNA CTD PMID:20196124 Mgst2 Rat bis(2-ethylhexyl) phthalate increases expression ISO MGST2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of MGST2 mRNA CTD PMID:31163220 Mgst2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Mgst2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of MGST2 mRNA CTD PMID:34319233 Mgst2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MGST2 mRNA CTD PMID:25181051 Mgst2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MGST2 mRNA CTD PMID:32145629 Mgst2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MGST2 mRNA CTD PMID:30903817 Mgst2 Rat bisphenol A affects expression ISO MGST2 (Homo sapiens) 6480464 bisphenol A affects the expression of MGST2 mRNA CTD PMID:30903817 Mgst2 Rat busulfan decreases response to substance ISO MGST2 (Homo sapiens) 6480464 MGST2 protein results in decreased susceptibility to Busulfan CTD PMID:15779864 Mgst2 Rat cadmium dichloride decreases expression ISO MGST2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MGST2 mRNA CTD PMID:38568856 Mgst2 Rat carbon nanotube decreases expression ISO Mgst2 (Mus musculus) 6480464 Nanotubes, Carbon analog results in decreased expression of MGST2 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Mgst2 Rat carmustine affects response to substance ISO MGST2 (Homo sapiens) 6480464 MGST2 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Mgst2 Rat chenodeoxycholic acid multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Mgst2 Rat chlordecone decreases expression ISO Mgst2 (Mus musculus) 6480464 Chlordecone results in decreased expression of MGST2 mRNA CTD PMID:29980752 Mgst2 Rat chloroprene increases expression ISO Mgst2 (Mus musculus) 6480464 Chloroprene results in increased expression of MGST2 mRNA CTD PMID:23125180 Mgst2 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of MGST2 mRNA CTD PMID:17452286 Mgst2 Rat chlorpyrifos decreases expression ISO Mgst2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of MGST2 mRNA CTD PMID:37019170 Mgst2 Rat chlorpyrifos increases expression ISO Mgst2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MGST2 mRNA CTD PMID:32715474 Mgst2 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of MGST2 mRNA CTD PMID:19440498 Mgst2 Rat choline multiple interactions ISO Mgst2 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression more ... CTD PMID:20938992|PMID:29127188 Mgst2 Rat cisplatin affects expression ISO MGST2 (Homo sapiens) 6480464 Cisplatin affects the expression of MGST2 mRNA CTD PMID:23300844 Mgst2 Rat cisplatin increases expression ISO MGST2 (Homo sapiens) 6480464 Cisplatin results in increased expression of MGST2 mRNA CTD PMID:27392435 Mgst2 Rat cisplatin multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of MGST2 mRNA CTD PMID:27392435 Mgst2 Rat cisplatin multiple interactions ISO Mgst2 (Mus musculus) 6480464 [Cisplatin co-treated with RELB mutant form co-treated with TNF protein] results in decreased expression of more ... CTD PMID:23625948 Mgst2 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of MGST2 mRNA CTD PMID:22465980 Mgst2 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of MGST2 mRNA CTD PMID:22465980 Mgst2 Rat copper(II) sulfate decreases expression ISO MGST2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MGST2 mRNA CTD PMID:19549813 Mgst2 Rat corn oil increases expression EXP 6480464 Corn Oil results in increased expression of MGST2 mRNA CTD PMID:22760963 Mgst2 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of MGST2 mRNA CTD PMID:15755911 Mgst2 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of MGST2 mRNA CTD PMID:18480146 Mgst2 Rat cyclosporin A decreases expression ISO MGST2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MGST2 mRNA CTD PMID:20106945|PMID:25562108 Mgst2 Rat cyclosporin A multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Mgst2 Rat deoxycholic acid multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Mgst2 Rat dexamethasone multiple interactions ISO MGST2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Mgst2 Rat dextran sulfate multiple interactions ISO Mgst2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of MGST2 more ... CTD PMID:29950665 Mgst2 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of MGST2 mRNA CTD PMID:17452286 Mgst2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of MGST2 mRNA CTD PMID:21266533 Mgst2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of MGST2 mRNA CTD PMID:24893172 Mgst2 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of MGST2 mRNA CTD PMID:19440498 Mgst2 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of MGST2 mRNA CTD PMID:36653537 Mgst2 Rat dioxygen multiple interactions ISO Mgst2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MGST2 mRNA CTD PMID:30529165 Mgst2 Rat diuron decreases expression ISO MGST2 (Homo sapiens) 6480464 Diuron results in decreased expression of MGST2 mRNA CTD PMID:35967413 Mgst2 Rat dorsomorphin multiple interactions ISO MGST2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Mgst2 Rat entinostat increases expression ISO MGST2 (Homo sapiens) 6480464 entinostat results in increased expression of MGST2 mRNA CTD PMID:26272509 Mgst2 Rat entinostat multiple interactions ISO MGST2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Mgst2 Rat ethylparaben increases expression ISO MGST2 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of MGST2 mRNA CTD PMID:37690743 Mgst2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MGST2 mRNA CTD PMID:24136188 Mgst2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MGST2 mRNA CTD PMID:24136188 Mgst2 Rat folic acid multiple interactions ISO Mgst2 (Mus musculus) 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MGST2 mRNA; [Choline deficiency co-treated more ... CTD PMID:20938992|PMID:22206623|PMID:29127188 Mgst2 Rat glycochenodeoxycholic acid multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Mgst2 Rat glycocholic acid multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Mgst2 Rat glycodeoxycholic acid multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650|PMID:33819548 Mgst2 Rat hydrogen peroxide multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of MGST2 protein CTD PMID:18951874 Mgst2 Rat hydrogen peroxide increases expression ISO Mgst2 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of MGST2 mRNA CTD PMID:14729362|PMID:15003993 Mgst2 Rat indirubin decreases expression ISO MGST2 (Homo sapiens) 6480464 indirubin results in decreased expression of MGST2 mRNA CTD PMID:15056799 Mgst2 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of MGST2 mRNA CTD PMID:21396975 Mgst2 Rat indometacin multiple interactions ISO MGST2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Mgst2 Rat ivermectin decreases expression ISO MGST2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MGST2 protein CTD PMID:32959892 Mgst2 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of MGST2 mRNA CTD PMID:20080153 Mgst2 Rat ketoconazole increases expression ISO MGST2 (Homo sapiens) 6480464 Ketoconazole results in increased expression of MGST2 mRNA CTD PMID:36621641 Mgst2 Rat L-methionine multiple interactions ISO Mgst2 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression more ... CTD PMID:20938992|PMID:29127188 Mgst2 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of MGST2 mRNA CTD PMID:24136188 Mgst2 Rat melphalan decreases response to substance ISO MGST2 (Homo sapiens) 6480464 MGST2 protein results in decreased susceptibility to Melphalan CTD PMID:15779864 Mgst2 Rat methyl methanesulfonate increases expression ISO MGST2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of MGST2 mRNA CTD PMID:23649840 Mgst2 Rat microcystin-LR increases expression ISO Mgst2 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of MGST2 mRNA CTD PMID:37342990 Mgst2 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Mgst2 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of MGST2 mRNA CTD PMID:22401849 Mgst2 Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of MGST2 mRNA CTD PMID:38113427 Mgst2 Rat N-methyl-N'-nitro-N-nitrosoguanidine decreases expression ISO MGST2 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in decreased expression of MGST2 mRNA CTD PMID:12634122 Mgst2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of MGST2 mRNA; [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] more ... CTD PMID:14656948|PMID:16158176 Mgst2 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of MGST2 mRNA CTD PMID:24136188 Mgst2 Rat nefazodone multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:32152650|PMID:33819548 Mgst2 Rat nefazodone decreases expression ISO MGST2 (Homo sapiens) 6480464 nefazodone results in decreased expression of MGST2 mRNA CTD PMID:32152650 Mgst2 Rat nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of MGST2 mRNA CTD PMID:19440498 Mgst2 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of MGST2 mRNA CTD PMID:24136188 Mgst2 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of MGST2 mRNA CTD PMID:33484710 Mgst2 Rat nitroprusside affects expression EXP 6480464 Nitroprusside affects the expression of MGST2 mRNA CTD PMID:17496435 Mgst2 Rat okadaic acid decreases expression ISO MGST2 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of MGST2 mRNA CTD PMID:38832940 Mgst2 Rat ozone multiple interactions ISO Mgst2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Mgst2 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of MGST2 mRNA CTD PMID:27638505 Mgst2 Rat paracetamol decreases expression ISO MGST2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MGST2 mRNA CTD PMID:21420995|PMID:29067470 Mgst2 Rat paracetamol multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated more ... CTD PMID:33819548 Mgst2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MGST2 mRNA CTD PMID:30723492 Mgst2 Rat perfluorononanoic acid decreases expression ISO MGST2 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of MGST2 mRNA CTD PMID:32588087 Mgst2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mgst2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of MGST2 mRNA CTD PMID:36331819 Mgst2 Rat perfluorooctanoic acid multiple interactions ISO Mgst2 (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with Dietary Fats, Unsaturated] results in increased expression of MGST2 mRNA; PPARA more ... CTD PMID:20118188|PMID:23626681 Mgst2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MGST2 mRNA CTD PMID:35163327 Mgst2 Rat perfluorooctanoic acid increases expression ISO Mgst2 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of MGST2 mRNA CTD PMID:20118188|PMID:23626681 Mgst2 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of MGST2 mRNA CTD PMID:19162173 Mgst2 Rat phenobarbital affects expression ISO MGST2 (Homo sapiens) 6480464 Phenobarbital affects the expression of MGST2 mRNA CTD PMID:19159669 Mgst2 Rat phenylmercury acetate increases expression ISO MGST2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of MGST2 mRNA CTD PMID:26272509 Mgst2 Rat phenylmercury acetate multiple interactions ISO MGST2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Mgst2 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in decreased expression of MGST2 mRNA CTD PMID:33945839 Mgst2 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of MGST2 mRNA CTD PMID:22484513 Mgst2 Rat pirinixic acid increases expression ISO Mgst2 (Mus musculus) 6480464 pirinixic acid results in increased expression of MGST2 mRNA CTD PMID:23811191 Mgst2 Rat potassium chromate decreases expression ISO MGST2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MGST2 mRNA CTD PMID:22714537 Mgst2 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of MGST2 mRNA CTD PMID:19162173 Mgst2 Rat prochloraz increases expression EXP 6480464 prochloraz results in increased expression of MGST2 mRNA CTD PMID:25182419 Mgst2 Rat quercetin decreases expression ISO MGST2 (Homo sapiens) 6480464 Quercetin results in decreased expression of MGST2 mRNA CTD PMID:21632981 Mgst2 Rat SB 431542 multiple interactions ISO MGST2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Mgst2 Rat silicon dioxide decreases expression ISO MGST2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of MGST2 mRNA CTD PMID:25895662 Mgst2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of MGST2 mRNA CTD PMID:19281266 Mgst2 Rat streptozocin multiple interactions ISO Mgst2 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of MGST2 mRNA CTD PMID:29127188 Mgst2 Rat succimer multiple interactions ISO Mgst2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of MGST2 mRNA CTD PMID:21641980 Mgst2 Rat sulindac multiple interactions EXP 6480464 [Sulindac co-treated with lipopolysaccharide, E coli O55-B5] affects the expression of MGST2 mRNA CTD PMID:20371263 Mgst2 Rat sunitinib decreases expression ISO MGST2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of MGST2 mRNA CTD PMID:31533062 Mgst2 Rat temozolomide affects response to substance ISO MGST2 (Homo sapiens) 6480464 MGST2 mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Mgst2 Rat temozolomide increases expression ISO MGST2 (Homo sapiens) 6480464 Temozolomide results in increased expression of MGST2 mRNA CTD PMID:31758290 Mgst2 Rat tert-butyl hydroperoxide increases expression ISO Mgst2 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of MGST2 mRNA CTD PMID:14729362|PMID:15003993|PMID:15336504 Mgst2 Rat tert-butyl hydroperoxide decreases response to substance ISO Mgst2 (Mus musculus) 6480464 MGST2 protein results in decreased susceptibility to tert-Butylhydroperoxide CTD PMID:15003993 Mgst2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MGST2 mRNA CTD PMID:31150632 Mgst2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MGST2 mRNA] CTD PMID:31150632 Mgst2 Rat theophylline multiple interactions ISO MGST2 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of MGST2 protein CTD PMID:18951874 Mgst2 Rat thiram decreases expression ISO MGST2 (Homo sapiens) 6480464 Thiram results in decreased expression of MGST2 mRNA CTD PMID:38568856 Mgst2 Rat titanium dioxide affects expression ISO Mgst2 (Mus musculus) 6480464 titanium dioxide affects the expression of MGST2 mRNA CTD PMID:23557971 Mgst2 Rat titanium dioxide multiple interactions ISO Mgst2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of MGST2 more ... CTD PMID:29950665 Mgst2 Rat toluene 2,4-diisocyanate decreases expression ISO Mgst2 (Mus musculus) 6480464 Toluene 2,4-Diisocyanate results in decreased expression of MGST2 mRNA CTD PMID:21404309 Mgst2 Rat trichostatin A increases expression ISO MGST2 (Homo sapiens) 6480464 trichostatin A results in increased expression of MGST2 mRNA CTD PMID:24935251 Mgst2 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of MGST2 mRNA CTD PMID:30589522 Mgst2 Rat triphenyl phosphate affects expression ISO MGST2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MGST2 mRNA CTD PMID:37042841 Mgst2 Rat triptonide decreases expression ISO Mgst2 (Mus musculus) 6480464 triptonide results in decreased expression of MGST2 mRNA CTD PMID:33045310 Mgst2 Rat troglitazone increases expression ISO Mgst2 (Mus musculus) 6480464 troglitazone results in increased expression of MGST2 mRNA CTD PMID:28973697 Mgst2 Rat tungsten decreases expression ISO Mgst2 (Mus musculus) 6480464 Tungsten results in decreased expression of MGST2 mRNA CTD PMID:30912803 Mgst2 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of MGST2 mRNA CTD PMID:24136188 Mgst2 Rat valproic acid increases expression ISO MGST2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MGST2 mRNA CTD PMID:23179753|PMID:24935251|PMID:28001369 Mgst2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of MGST2 mRNA CTD PMID:19015723
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (ISO) 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2-acetamidofluorene (EXP) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amphetamine (EXP) atrazine (EXP) Azaspiracid (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bifenthrin (ISO) bilirubin IXalpha (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) busulfan (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) carmustine (ISO) chenodeoxycholic acid (ISO) chlordecone (ISO) chloroprene (ISO) chlorpyrifos (EXP,ISO) choline (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) corn oil (EXP) corticosterone (EXP) coumarin (EXP) cyclosporin A (ISO) deoxycholic acid (ISO) dexamethasone (ISO) dextran sulfate (ISO) diazinon (EXP) dibutyl phthalate (EXP) dieldrin (EXP) diethylstilbestrol (EXP) dioxygen (ISO) diuron (ISO) dorsomorphin (ISO) entinostat (ISO) ethylparaben (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hydrogen peroxide (ISO) indirubin (ISO) indole-3-methanol (EXP) indometacin (ISO) ivermectin (ISO) ketamine (EXP) ketoconazole (ISO) L-methionine (ISO) leflunomide (EXP) melphalan (ISO) methyl methanesulfonate (ISO) microcystin-LR (ISO) mono(2-ethylhexyl) phthalate (EXP,ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP,ISO) nickel atom (EXP) nimesulide (EXP) nitrofen (EXP) nitroprusside (EXP) okadaic acid (ISO) ozone (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (EXP,ISO) phenylmercury acetate (ISO) PhIP (EXP) piperonyl butoxide (EXP) pirinixic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) prochloraz (EXP) quercetin (ISO) SB 431542 (ISO) silicon dioxide (ISO) Soman (EXP) streptozocin (ISO) succimer (ISO) sulindac (EXP) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) theophylline (ISO) thiram (ISO) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP)
Molecular Function
enzyme activator activity (IEA) glutathione binding (IEA,ISO) glutathione peroxidase activity (IBA,IDA,IEA,ISO) glutathione transferase activity (IBA,IDA,IEA,ISO) identical protein binding (IEA,ISO) leukotriene-C4 synthase activity (IBA,IDA,IEA,ISO) lyase activity (IEA) oxidoreductase activity (IEA) protein binding (ISO) transferase activity (IEA)
Mgst2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 137,821,787 - 137,866,664 (+) NCBI GRCr8 GRCr8 Ensembl 2 137,836,140 - 137,866,661 (+) Ensembl GRCr8 Ensembl mRatBN7.2 2 135,679,524 - 135,715,828 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 135,693,557 - 135,715,828 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 142,269,446 - 142,291,715 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 140,381,704 - 140,403,975 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 135,013,740 - 135,035,919 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 140,708,396 - 140,727,381 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 140,708,397 - 140,727,281 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 160,180,714 - 160,202,851 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 140,546,939 - 140,568,616 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 130,188,760 - 130,210,429 (+) NCBI Celera RGSC_v3.1 2 140,497,066 - 140,518,579 (+) NCBI Cytogenetic Map 2 q26 NCBI
MGST2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 139,665,819 - 139,754,618 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 139,665,768 - 139,740,745 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 140,586,973 - 140,661,899 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 140,806,372 - 140,844,857 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 140,944,526 - 140,983,009 NCBI Celera 4 137,919,740 - 137,958,224 (+) NCBI Celera Cytogenetic Map 4 q31.1 NCBI HuRef 4 136,315,768 - 136,391,008 (+) NCBI HuRef CHM1_1 4 140,564,114 - 140,639,227 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 142,985,421 - 143,074,258 (+) NCBI T2T-CHM13v2.0
Mgst2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 51,544,179 - 51,590,096 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 51,567,781 - 51,590,098 (+) Ensembl GRCm39 Ensembl GRCm38 3 51,636,912 - 51,682,675 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 51,660,360 - 51,682,677 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 51,465,115 - 51,486,597 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 51,749,166 - 51,770,603 (+) NCBI MGSCv36 mm8 Celera 3 51,392,546 - 51,414,043 (+) NCBI Celera Cytogenetic Map 3 C NCBI cM Map 3 22.52 NCBI
Mgst2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 4,014,810 - 4,037,901 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 4,006,054 - 4,049,497 (-) NCBI ChiLan1.0 ChiLan1.0
MGST2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 137,540,753 - 137,605,499 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 137,933,175 - 137,997,878 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 132,031,087 - 132,106,864 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 143,338,016 - 143,412,966 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 143,338,016 - 143,412,966 (+) Ensembl panpan1.1 panPan2
MGST2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 19 3,067,062 - 3,070,579 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 19 3,314,243 - 3,335,238 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 19 3,136,172 - 3,157,176 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 19 3,122,591 - 3,157,324 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 19 3,069,101 - 3,090,099 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 19 3,429,861 - 3,450,892 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 19 3,793,259 - 3,814,268 (-) NCBI UU_Cfam_GSD_1.0
Mgst2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 50,548,928 - 50,578,317 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936535 7,995,248 - 8,015,463 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936535 7,995,185 - 8,015,463 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MGST2 (Sus scrofa - pig)
MGST2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 86,629,691 - 86,666,912 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 86,629,642 - 86,666,857 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 66,152,315 - 66,189,340 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mgst2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 103 Count of miRNA genes: 92 Interacting mature miRNAs: 97 Transcripts: ENSRNOT00000017785 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 6907363 Bp357 Blood pressure QTL 357 4.1 0.002 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 129540907 174540907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1358360 Sradr2 Stress Responsive Adrenal Weight QTL 2 10.24 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 2 129164097 152195315 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 1581578 Cm49 Cardiac mass QTL 49 4.9 0.01 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 127447387 143657569 Rat 1598862 Glom9 Glomerulus QTL 9 3.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 2 92337601 137337601 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1598863 Cm65 Cardiac mass QTL 65 2.3 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 92337601 137337601 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1582257 Gluco21 Glucose level QTL 21 3.1 0.0035 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 118111229 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359035 Bp276 Blood pressure QTL 276 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 143657569 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 5135226 Leukc2 Leukocyte quantity QTL 2 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 2 118111229 149559726 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 738007 Anxrr7 Anxiety related response QTL 7 4.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 118189491 163189491 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354594 Despr10 Despair related QTL 10 2e-06 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 2 114654253 159654253 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 61438 Cia7 Collagen induced arthritis QTL 7 4.6 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 2 59324377 141596857 Rat
RH142268
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 137,865,782 - 137,866,538 (+) Marker Load Pipeline mRatBN7.2 2 135,714,946 - 135,715,702 (+) MAPPER mRatBN7.2 Rnor_6.0 2 140,726,500 - 140,727,255 NCBI Rnor6.0 Rnor_5.0 2 160,201,970 - 160,202,725 UniSTS Rnor5.0 RGSC_v3.4 2 140,567,735 - 140,568,490 UniSTS RGSC3.4 Celera 2 130,209,548 - 130,210,303 UniSTS RH 3.4 Map 2 848.3 UniSTS Cytogenetic Map 2 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000088846 ⟹ ENSRNOP00000068920
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 2 137,836,140 - 137,865,841 (+) Ensembl mRatBN7.2 Ensembl 2 135,693,695 - 135,715,807 (+) Ensembl Rnor_6.0 Ensembl 2 140,708,397 - 140,727,281 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100251 ⟹ ENSRNOP00000078333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 2 137,836,140 - 137,866,661 (+) Ensembl mRatBN7.2 Ensembl 2 135,693,557 - 135,715,828 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101526 ⟹ ENSRNOP00000081569
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 2 137,836,140 - 137,866,454 (+) Ensembl mRatBN7.2 Ensembl 2 135,693,557 - 135,715,618 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118372 ⟹ ENSRNOP00000090331
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 2 137,836,140 - 137,865,835 (+) Ensembl mRatBN7.2 Ensembl 2 135,693,557 - 135,714,999 (+) Ensembl
RefSeq Acc Id:
NM_001106430 ⟹ NP_001099900
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 137,844,393 - 137,866,664 (+) NCBI mRatBN7.2 2 135,693,556 - 135,715,828 (+) NCBI Rnor_6.0 2 140,708,396 - 140,727,381 (+) NCBI Rnor_5.0 2 160,180,714 - 160,202,851 (+) NCBI RGSC_v3.4 2 140,546,939 - 140,568,616 (+) RGD Celera 2 130,188,760 - 130,210,429 (+) RGD
Sequence:
CTTGAATCCTGCTTTTTTTTTTTTTTTTCCTTTCCCAACTCTGTTGACTCAACTCTGTTGCCTTTATAAGGGAGAAGATCAGCCCATCAGGGTCCTAAAGAGCCTTCGTTCTTCAGCTGGCTTCCTAC ATACAGTTCTGTGAAAGAGATCAGAGAGTGAAAGAAAGATGGCGGGGGATTCAAGCCTGCTGGCTGCAGTCTCCCTTCTCTCTGCCTGTCAGCAAAGTTATTTTGCTTTGCAAGTCGGACGAGTAAGA TTAAAATACAAGATCGCACCTCCAGCAGTCACGGGCTCTCTGGAGTTTGAGAGAATATTTCGCGCACAGCAAAACTCTTTGGAGTTTTATTCCGTATTCATCATATCGCTGTGGATGGCTGGATGGTA TTTCAATCAAGTTTTTGCAACCTGTCTGGGTCTCCTGTACATATACGCCCGTCACAAGTATTTCTGGGGCTATGCAGAAGCCGCTGAAAAAAGGATCATTGGTTTCCGGCTGAGCCTGGGCATTTTGG CCTTGCTGACTGTCCTCGCTGTCCTGGGGGTAGCAAGCAGATTCCTGGACGAATACCTGGACTTTCATGTTGCCAAGAAACTGAAGCGGCCCTTCTAAGTTTTTCTTCCCTTTCATGCTTGTAGAGGC CTCGGCACCACTCTGAAAACAATATGATGTCATGTGTGAAATAAAAACTTTTATTTGTCTTGCTGTG
hide sequence
RefSeq Acc Id:
XM_039102008 ⟹ XP_038957936
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 137,844,452 - 137,865,823 (+) NCBI mRatBN7.2 2 135,693,616 - 135,712,391 (+) NCBI
RefSeq Acc Id:
XM_063281573 ⟹ XP_063137643
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 137,844,159 - 137,866,660 (+) NCBI
RefSeq Acc Id:
XM_063281574 ⟹ XP_063137644
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 137,844,345 - 137,866,660 (+) NCBI
RefSeq Acc Id:
XM_063281575 ⟹ XP_063137645
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 137,836,108 - 137,866,660 (+) NCBI
RefSeq Acc Id:
XM_063281576 ⟹ XP_063137646
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 137,843,930 - 137,866,660 (+) NCBI
RefSeq Acc Id:
XM_063281577 ⟹ XP_063137647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 137,835,516 - 137,866,660 (+) NCBI
RefSeq Acc Id:
XM_063281578 ⟹ XP_063137648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 137,821,787 - 137,866,660 (+) NCBI
RefSeq Acc Id:
NP_001099900 ⟸ NM_001106430
- UniProtKB:
A0A8I5ZLK2 (UniProtKB/TrEMBL), A6JV75 (UniProtKB/TrEMBL)
- Sequence:
MAGDSSLLAAVSLLSACQQSYFALQVGRVRLKYKIAPPAVTGSLEFERIFRAQQNSLEFYSVFIISLWMAGWYFNQVFATCLGLLYIYARHKYFWGYAEAAEKRIIGFRLSLGILALLTVLAVLGVAS RFLDEYLDFHVAKKLKRPF
hide sequence
Ensembl Acc Id:
ENSRNOP00000068920 ⟸ ENSRNOT00000088846
RefSeq Acc Id:
XP_038957936 ⟸ XM_039102008
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZSH5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000078333 ⟸ ENSRNOT00000100251
Ensembl Acc Id:
ENSRNOP00000081569 ⟸ ENSRNOT00000101526
Ensembl Acc Id:
ENSRNOP00000090331 ⟸ ENSRNOT00000118372
RefSeq Acc Id:
XP_063137648 ⟸ XM_063281578
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZLK2 (UniProtKB/TrEMBL), A6JV75 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137647 ⟸ XM_063281577
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZLK2 (UniProtKB/TrEMBL), A6JV75 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137645 ⟸ XM_063281575
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZLK2 (UniProtKB/TrEMBL), A6JV75 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137646 ⟸ XM_063281576
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZLK2 (UniProtKB/TrEMBL), A6JV75 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137643 ⟸ XM_063281573
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZLK2 (UniProtKB/TrEMBL), A6JV75 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137644 ⟸ XM_063281574
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZLK2 (UniProtKB/TrEMBL), A6JV75 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Mgst2
microsomal glutathione S-transferase 2
Mgst2_predicted
microsomal glutathione S-transferase 2 (predicted)
'predicted' is removed
2292626
APPROVED
2005-01-12
Mgst2_predicted
microsomal glutathione S-transferase 2 (predicted)
Symbol and Name status set to approved
70820
APPROVED