Symbol:
Pik3cd
Name:
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta
RGD ID:
1310990
Description:
Predicted to enable 1-phosphatidylinositol-3-kinase activity and 1-phosphatidylinositol-4-phosphate 3-kinase activity. Involved in negative regulation of gene expression. Predicted to be located in cytosol. Predicted to be part of phosphatidylinositol 3-kinase complex, class IA. Predicted to be active in cytoplasm and plasma membrane. Used to study schizophrenia. Human ortholog(s) of this gene implicated in colorectal cancer; endometrial cancer; immunodeficiency 14; and schizophrenia. Orthologous to human PIK3CD (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; FasL mediated signaling pathway; phosphatidylinositol 3-kinase class I signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
catalytic phosphatidylinositol 3-kinase delta; LOC366508; phosphatidylinositol 3-kinase catalytic delta polypeptide; phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform; phosphoinositide-3-kinase, catalytic, delta polypeptide
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PIK3CD (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Pik3cd (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pik3cd (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PIK3CD (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PIK3CD (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pik3cd (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PIK3CD (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PIK3CD (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pik3cd (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PIK3CD (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pik3cd (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pik3cd (phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
age-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pi3K92E
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 165,377,994 - 165,426,620 (-) NCBI GRCr8 mRatBN7.2 5 160,094,952 - 160,142,962 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 160,094,952 - 160,120,930 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 162,811,574 - 162,837,548 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 164,630,975 - 164,656,844 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 164,587,341 - 164,613,203 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 166,602,053 - 166,628,028 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 166,602,053 - 166,628,028 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 170,248,202 - 170,274,177 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 166,735,274 - 166,761,189 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 166,747,134 - 166,774,251 (-) NCBI Celera 5 158,364,393 - 158,390,431 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pik3cd Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PIK3CD mRNA CTD PMID:22079256 Pik3cd Rat 1,2-dichloroethane decreases expression ISO Pik3cd (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PIK3CD mRNA CTD PMID:28960355 Pik3cd Rat 17beta-estradiol multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of PIK3CD mRNA CTD PMID:30165855 Pik3cd Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PIK3CD mRNA CTD PMID:32741896 Pik3cd Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PIK3CD mRNA CTD PMID:32741896 Pik3cd Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Pik3cd (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Pik3cd Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pik3cd (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PIK3CD gene] CTD PMID:20819909 Pik3cd Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3CD mRNA CTD PMID:33387578 Pik3cd Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PIK3CD mRNA CTD PMID:34747641 Pik3cd Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PIK3CD mRNA CTD PMID:32109520 Pik3cd Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pik3cd (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PIK3CD mRNA CTD PMID:20819909 Pik3cd Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pik3cd (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3CD mRNA CTD PMID:19465110 Pik3cd Rat 2-butoxyethanol decreases expression ISO Pik3cd (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of PIK3CD mRNA CTD PMID:19812364 Pik3cd Rat 3,3',5-triiodo-L-thyronine increases expression ISO Pik3cd (Mus musculus) 6480464 Triiodothyronine results in increased expression of PIK3CD mRNA CTD PMID:25172293 Pik3cd Rat 3-methylcholanthrene multiple interactions ISO Pik3cd (Mus musculus) 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of PIK3CD mRNA CTD PMID:23519560 Pik3cd Rat 4,4'-diaminodiphenylmethane increases expression ISO Pik3cd (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PIK3CD mRNA CTD PMID:18648102 Pik3cd Rat 4,4'-sulfonyldiphenol decreases methylation ISO Pik3cd (Mus musculus) 6480464 bisphenol S results in decreased methylation of PIK3CD exon CTD PMID:33297965 Pik3cd Rat 4,4'-sulfonyldiphenol increases methylation ISO PIK3CD (Homo sapiens) 6480464 bisphenol S results in increased methylation of PIK3CD gene CTD PMID:31601247 Pik3cd Rat 4-hydroxynon-2-enal decreases expression ISO Pik3cd (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of PIK3CD mRNA CTD PMID:19191707 Pik3cd Rat 4-nitrophenol increases expression ISO Pik3cd (Mus musculus) 6480464 4-nitrophenol results in increased expression of PIK3CD mRNA CTD PMID:34673133 Pik3cd Rat 5-aza-2'-deoxycytidine increases expression ISO PIK3CD (Homo sapiens) 6480464 Decitabine results in increased expression of PIK3CD mRNA CTD PMID:17940511 Pik3cd Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PIK3CD mRNA CTD PMID:24780913 Pik3cd Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PIK3CD mRNA CTD PMID:31881176 Pik3cd Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PIK3CD mRNA CTD PMID:28959563 Pik3cd Rat aflatoxin B1 increases methylation ISO PIK3CD (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PIK3CD intron CTD PMID:30157460 Pik3cd Rat Aflatoxin B2 alpha increases methylation ISO PIK3CD (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PIK3CD intron CTD PMID:30157460 Pik3cd Rat all-trans-retinoic acid increases expression ISO PIK3CD (Homo sapiens) 6480464 Tretinoin results in increased expression of PIK3CD mRNA CTD PMID:15498508 and PMID:33167477 Pik3cd Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of PIK3CD mRNA CTD PMID:35163327 Pik3cd Rat antirheumatic drug decreases expression ISO PIK3CD (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PIK3CD mRNA CTD PMID:24449571 Pik3cd Rat arsane increases expression ISO PIK3CD (Homo sapiens) 6480464 Arsenic results in increased expression of PIK3CD mRNA CTD PMID:19945496 Pik3cd Rat arsane multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PIK3CD mRNA CTD PMID:39836092 Pik3cd Rat arsenic atom increases expression ISO PIK3CD (Homo sapiens) 6480464 Arsenic results in increased expression of PIK3CD mRNA CTD PMID:19945496 Pik3cd Rat arsenic atom multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PIK3CD mRNA CTD PMID:39836092 Pik3cd Rat atrazine increases expression ISO PIK3CD (Homo sapiens) 6480464 Atrazine results in increased expression of PIK3CD mRNA CTD PMID:22378314 Pik3cd Rat benzene multiple interactions ISO Pik3cd (Mus musculus) 6480464 TRP53 protein affects the reaction [Benzene results in increased expression of PIK3CD mRNA] and TRP53 protein promotes the reaction [Benzene results in increased expression of PIK3CD] CTD PMID:12928149 and PMID:15935813 Pik3cd Rat benzene increases expression ISO Pik3cd (Mus musculus) 6480464 Benzene results in increased expression of PIK3CD and Benzene results in increased expression of PIK3CD mRNA CTD PMID:12928149 and PMID:15935813 Pik3cd Rat benzo[a]pyrene decreases expression ISO PIK3CD (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PIK3CD mRNA CTD PMID:20064835 and PMID:20106945 Pik3cd Rat benzo[a]pyrene increases expression ISO PIK3CD (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PIK3CD mRNA CTD PMID:32234424 Pik3cd Rat benzo[a]pyrene affects methylation ISO PIK3CD (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PIK3CD 5' UTR and Benzo(a)pyrene affects the methylation of PIK3CD intron CTD PMID:27901495 and PMID:30157460 Pik3cd Rat benzo[a]pyrene decreases methylation ISO Pik3cd (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of PIK3CD exon and Benzo(a)pyrene results in decreased methylation of PIK3CD intron CTD PMID:27901495 Pik3cd Rat benzo[a]pyrene increases methylation ISO PIK3CD (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PIK3CD 3' UTR and Benzo(a)pyrene results in increased methylation of PIK3CD promoter CTD PMID:27901495 Pik3cd Rat benzo[a]pyrene increases expression ISO Pik3cd (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PIK3CD mRNA CTD PMID:22228805 Pik3cd Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PIK3CD mRNA CTD PMID:21839799 Pik3cd Rat benzo[a]pyrene decreases expression ISO Pik3cd (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PIK3CD mRNA CTD PMID:21569818 Pik3cd Rat benzo[e]pyrene increases methylation ISO PIK3CD (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of PIK3CD exon and benzo(e)pyrene results in increased methylation of PIK3CD intron CTD PMID:30157460 Pik3cd Rat bis(2-chloroethyl) sulfide increases expression ISO Pik3cd (Mus musculus) 6480464 Mustard Gas results in increased expression of PIK3CD mRNA CTD PMID:18955075 Pik3cd Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PIK3CD mRNA CTD PMID:25181051 more ... Pik3cd Rat bisphenol A decreases methylation ISO PIK3CD (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PIK3CD gene CTD PMID:31601247 Pik3cd Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of PIK3CD gene CTD PMID:28505145 Pik3cd Rat bisphenol A decreases methylation ISO Pik3cd (Mus musculus) 6480464 bisphenol A results in decreased methylation of PIK3CD promoter CTD PMID:27312807 Pik3cd Rat buta-1,3-diene decreases expression ISO Pik3cd (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of PIK3CD mRNA CTD PMID:29038090 Pik3cd Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of PIK3CD mRNA CTD PMID:19167457 Pik3cd Rat cadmium dichloride affects expression ISO Pik3cd (Mus musculus) 6480464 Cadmium Chloride affects the expression of PIK3CD mRNA CTD PMID:18974090 Pik3cd Rat calcium atom affects transport ISO Pik3cd (Mus musculus) 6480464 PIK3CD protein affects the transport of Calcium CTD PMID:16179367 Pik3cd Rat calcium(0) affects transport ISO Pik3cd (Mus musculus) 6480464 PIK3CD protein affects the transport of Calcium CTD PMID:16179367 Pik3cd Rat cannabidiol multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in decreased expression of PIK3CD mRNA and [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of PIK3CD mRNA CTD PMID:30096889 and PMID:32992648 Pik3cd Rat cannabidiol decreases expression ISO PIK3CD (Homo sapiens) 6480464 Cannabidiol results in decreased expression of PIK3CD mRNA CTD PMID:31801206 Pik3cd Rat carbamazepine affects expression ISO PIK3CD (Homo sapiens) 6480464 Carbamazepine affects the expression of PIK3CD mRNA CTD PMID:24752500 Pik3cd Rat carmustine affects response to substance ISO PIK3CD (Homo sapiens) 6480464 PIK3CD mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Pik3cd Rat celastrol decreases expression ISO PIK3CD (Homo sapiens) 6480464 celastrol results in decreased expression of PIK3CD mRNA CTD PMID:17010675 Pik3cd Rat chlormequat chloride increases expression EXP 6480464 Chlormequat results in increased expression of PIK3CD protein CTD PMID:34958886 Pik3cd Rat chloroprene decreases expression ISO Pik3cd (Mus musculus) 6480464 Chloroprene results in decreased expression of PIK3CD mRNA CTD PMID:23125180 Pik3cd Rat chlorpyrifos increases methylation EXP 6480464 Chlorpyrifos results in increased methylation of PIK3CD gene CTD PMID:32905263 Pik3cd Rat chlorpyrifos increases expression ISO Pik3cd (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PIK3CD mRNA CTD PMID:37019170 Pik3cd Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PIK3CD mRNA CTD PMID:32905263 Pik3cd Rat cisplatin decreases expression ISO PIK3CD (Homo sapiens) 6480464 Cisplatin results in decreased expression of PIK3CD mRNA CTD PMID:27594783 Pik3cd Rat cobalt dichloride decreases expression ISO PIK3CD (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PIK3CD mRNA CTD PMID:26314263 Pik3cd Rat copper atom multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of PIK3CD mRNA CTD PMID:30911355 Pik3cd Rat copper(0) multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of PIK3CD mRNA CTD PMID:30911355 Pik3cd Rat copper(II) sulfate increases expression ISO PIK3CD (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PIK3CD mRNA CTD PMID:19549813 Pik3cd Rat crocidolite asbestos increases expression ISO PIK3CD (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of PIK3CD mRNA CTD PMID:25757056 Pik3cd Rat diclofenac affects expression ISO PIK3CD (Homo sapiens) 6480464 Diclofenac affects the expression of PIK3CD mRNA CTD PMID:24752500 Pik3cd Rat dicrotophos increases expression ISO PIK3CD (Homo sapiens) 6480464 dicrotophos results in increased expression of PIK3CD mRNA CTD PMID:28302478 Pik3cd Rat dioxygen multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of PIK3CD mRNA and [Oxygen co-treated with Ozone] results in decreased expression of PIK3CD mRNA CTD PMID:32992648 Pik3cd Rat diquat decreases expression ISO Pik3cd (Mus musculus) 6480464 Diquat results in decreased expression of PIK3CD mRNA CTD PMID:36851058 Pik3cd Rat Doramectin decreases expression EXP 6480464 doramectin results in decreased expression of PIK3CD mRNA CTD PMID:35137919 Pik3cd Rat elemental selenium increases expression ISO PIK3CD (Homo sapiens) 6480464 Selenium results in increased expression of PIK3CD mRNA CTD PMID:19244175 Pik3cd Rat elemental selenium multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PIK3CD mRNA CTD PMID:19244175 Pik3cd Rat entinostat increases expression ISO PIK3CD (Homo sapiens) 6480464 entinostat results in increased expression of PIK3CD mRNA CTD PMID:27188386 Pik3cd Rat ethanol multiple interactions ISO Pik3cd (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PIK3CD mRNA CTD PMID:30319688 Pik3cd Rat ethyl methanesulfonate decreases expression ISO PIK3CD (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PIK3CD mRNA CTD PMID:23649840 Pik3cd Rat fonofos increases methylation ISO PIK3CD (Homo sapiens) 6480464 Fonofos results in increased methylation of PIK3CD promoter CTD PMID:22847954 Pik3cd Rat gedunin decreases expression ISO PIK3CD (Homo sapiens) 6480464 gedunin results in decreased expression of PIK3CD mRNA CTD PMID:17010675 Pik3cd Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of PIK3CD gene CTD PMID:28505145 Pik3cd Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PIK3CD mRNA CTD PMID:22061828 Pik3cd Rat glycyrrhetinate decreases activity ISO Pik3cd (Mus musculus) 6480464 18alpha-glycyrrhetinic acid results in decreased activity of PIK3CD protein CTD PMID:21644799 Pik3cd Rat glycyrrhetinic acid decreases activity ISO Pik3cd (Mus musculus) 6480464 18alpha-glycyrrhetinic acid results in decreased activity of PIK3CD protein CTD PMID:21644799 Pik3cd Rat glycyrrhizinic acid decreases activity ISO Pik3cd (Mus musculus) 6480464 Glycyrrhizic Acid results in decreased activity of PIK3CD protein CTD PMID:21644799 Pik3cd Rat IC-87114 multiple interactions ISO Pik3cd (Mus musculus) 6480464 IC 87114 inhibits the reaction [Toluene 2 and 4-Diisocyanate results in increased expression of PIK3CD protein] CTD PMID:33711354 Pik3cd Rat IC-87114 decreases activity ISO Pik3cd (Mus musculus) 6480464 IC 87114 results in decreased activity of PIK3CD protein CTD PMID:16179367 Pik3cd Rat idelalisib increases expression ISO Pik3cd (Mus musculus) 6480464 idelalisib results in increased expression of PIK3CD mRNA CTD PMID:31522336 Pik3cd Rat idelalisib multiple interactions ISO Pik3cd (Mus musculus) 6480464 idelalisib inhibits the reaction [TGFB1 protein results in decreased expression of PIK3CD mRNA] CTD PMID:31522336 Pik3cd Rat lead diacetate decreases expression ISO Pik3cd (Mus musculus) 6480464 lead acetate results in decreased expression of PIK3CD mRNA CTD PMID:33932463 Pik3cd Rat lipopolysaccharide multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of PIK3CD mRNA CTD PMID:35811015 Pik3cd Rat LY294002 decreases activity ISO Pik3cd (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased activity of PIK3CD protein CTD PMID:16179367 Pik3cd Rat LY294002 multiple interactions ISO Pik3cd (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [TGFB1 protein results in decreased expression of PIK3CD mRNA] CTD PMID:31522336 Pik3cd Rat LY294002 decreases expression ISO Pik3cd (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased expression of PIK3CD mRNA CTD PMID:31522336 Pik3cd Rat methapyrilene increases methylation ISO PIK3CD (Homo sapiens) 6480464 Methapyrilene results in increased methylation of PIK3CD exon and Methapyrilene results in increased methylation of PIK3CD intron CTD PMID:30157460 Pik3cd Rat methyl methanesulfonate decreases expression ISO PIK3CD (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PIK3CD mRNA CTD PMID:23649840 Pik3cd Rat N-nitrosodimethylamine increases expression ISO PIK3CD (Homo sapiens) 6480464 Dimethylnitrosamine results in increased expression of PIK3CD mRNA CTD PMID:17547211 Pik3cd Rat nickel atom increases expression ISO PIK3CD (Homo sapiens) 6480464 Nickel results in increased expression of PIK3CD mRNA CTD PMID:25583101 Pik3cd Rat obeticholic acid decreases expression ISO PIK3CD (Homo sapiens) 6480464 obeticholic acid results in decreased expression of PIK3CD mRNA CTD PMID:27939613 Pik3cd Rat ochratoxin A decreases expression ISO PIK3CD (Homo sapiens) 6480464 ochratoxin A metabolite results in decreased expression of PIK3CD mRNA and ochratoxin A results in decreased expression of PIK3CD mRNA CTD PMID:26314263 Pik3cd Rat ozone multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of PIK3CD mRNA and [Oxygen co-treated with Ozone] results in decreased expression of PIK3CD mRNA CTD PMID:32992648 Pik3cd Rat ozone multiple interactions ISO Pik3cd (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PIK3CD mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PIK3CD mRNA CTD PMID:34911549 Pik3cd Rat parathion increases methylation ISO PIK3CD (Homo sapiens) 6480464 Parathion results in increased methylation of PIK3CD promoter CTD PMID:22847954 Pik3cd Rat pentachlorophenol increases expression ISO Pik3cd (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PIK3CD mRNA CTD PMID:23892564 Pik3cd Rat phenol increases expression ISO PIK3CD (Homo sapiens) 6480464 Phenol results in increased expression of PIK3CD mRNA CTD PMID:17547211 Pik3cd Rat phorbol 13-acetate 12-myristate multiple interactions ISO Pik3cd (Mus musculus) 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of PIK3CD mRNA CTD PMID:23519560 Pik3cd Rat potassium chromate multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PIK3CD mRNA CTD PMID:22079256 Pik3cd Rat potassium chromate decreases expression ISO PIK3CD (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PIK3CD mRNA CTD PMID:22079256 Pik3cd Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of PIK3CD mRNA CTD PMID:35811015 Pik3cd Rat selenium atom increases expression ISO PIK3CD (Homo sapiens) 6480464 Selenium results in increased expression of PIK3CD mRNA CTD PMID:19244175 Pik3cd Rat selenium atom multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PIK3CD mRNA CTD PMID:19244175 Pik3cd Rat silicon dioxide increases expression ISO Pik3cd (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PIK3CD mRNA CTD PMID:29341224 Pik3cd Rat sirolimus increases expression ISO Pik3cd (Mus musculus) 6480464 Sirolimus results in increased expression of PIK3CD mRNA CTD PMID:31522336 Pik3cd Rat sirolimus multiple interactions ISO Pik3cd (Mus musculus) 6480464 Sirolimus inhibits the reaction [TGFB1 protein results in decreased expression of PIK3CD mRNA] CTD PMID:31522336 Pik3cd Rat sodium arsenite affects methylation ISO PIK3CD (Homo sapiens) 6480464 sodium arsenite affects the methylation of PIK3CD gene CTD PMID:28589171 Pik3cd Rat sodium arsenite decreases expression ISO Pik3cd (Mus musculus) 6480464 sodium arsenite results in decreased expression of PIK3CD mRNA CTD PMID:37682722 Pik3cd Rat sodium arsenite multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PIK3CD mRNA CTD PMID:39836092 Pik3cd Rat sodium arsenite increases expression ISO PIK3CD (Homo sapiens) 6480464 sodium arsenite results in increased expression of PIK3CD mRNA CTD PMID:29301061 Pik3cd Rat sulforaphane decreases expression ISO PIK3CD (Homo sapiens) 6480464 sulforaphane results in decreased expression of PIK3CD mRNA CTD PMID:31838189 Pik3cd Rat sunitinib increases expression ISO PIK3CD (Homo sapiens) 6480464 Sunitinib results in increased expression of PIK3CD mRNA CTD PMID:31533062 Pik3cd Rat tamibarotene increases expression ISO PIK3CD (Homo sapiens) 6480464 tamibarotene results in increased expression of PIK3CD mRNA CTD PMID:15498508 Pik3cd Rat temozolomide affects response to substance ISO PIK3CD (Homo sapiens) 6480464 PIK3CD mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Pik3cd Rat terbufos increases methylation ISO PIK3CD (Homo sapiens) 6480464 terbufos results in increased methylation of PIK3CD promoter CTD PMID:22847954 Pik3cd Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PIK3CD mRNA CTD PMID:32741896 Pik3cd Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PIK3CD mRNA CTD PMID:31150632 Pik3cd Rat tetracycline decreases expression ISO Pik3cd (Mus musculus) 6480464 Tetracycline results in decreased expression of PIK3CD mRNA CTD PMID:16917069 Pik3cd Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PIK3CD mRNA CTD PMID:34492290 Pik3cd Rat titanium dioxide decreases methylation ISO Pik3cd (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PIK3CD gene CTD PMID:35295148 Pik3cd Rat toluene 2,4-diisocyanate increases expression ISO Pik3cd (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of PIK3CD protein CTD PMID:33711354 Pik3cd Rat toluene 2,4-diisocyanate multiple interactions ISO Pik3cd (Mus musculus) 6480464 IC 87114 inhibits the reaction [Toluene 2 more ... CTD PMID:33711354 Pik3cd Rat Tributyltin oxide decreases expression ISO PIK3CD (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of PIK3CD mRNA CTD PMID:26314263 Pik3cd Rat trichostatin A increases expression ISO PIK3CD (Homo sapiens) 6480464 trichostatin A results in increased expression of PIK3CD mRNA CTD PMID:17940511 Pik3cd Rat trichostatin A affects expression ISO PIK3CD (Homo sapiens) 6480464 trichostatin A affects the expression of PIK3CD mRNA CTD PMID:28542535 Pik3cd Rat triphenyl phosphate affects expression ISO PIK3CD (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PIK3CD mRNA CTD PMID:37042841 Pik3cd Rat triptonide decreases expression ISO Pik3cd (Mus musculus) 6480464 triptonide results in decreased expression of PIK3CD mRNA CTD PMID:33045310 Pik3cd Rat tungsten decreases expression ISO Pik3cd (Mus musculus) 6480464 Tungsten results in decreased expression of PIK3CD mRNA CTD PMID:30912803 Pik3cd Rat Tylophorine increases expression ISO PIK3CD (Homo sapiens) 6480464 tylophorine analog results in increased expression of PIK3CD mRNA CTD PMID:19284764 Pik3cd Rat valproic acid increases expression ISO PIK3CD (Homo sapiens) 6480464 Valproic Acid results in increased expression of PIK3CD mRNA CTD PMID:19101580 Pik3cd Rat valproic acid increases methylation ISO PIK3CD (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PIK3CD gene CTD PMID:29154799 Pik3cd Rat valproic acid affects expression ISO PIK3CD (Homo sapiens) 6480464 Valproic Acid affects the expression of PIK3CD mRNA CTD PMID:25979313 Pik3cd Rat vitamin E multiple interactions ISO PIK3CD (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PIK3CD mRNA CTD PMID:19244175 Pik3cd Rat vitamin E increases expression ISO PIK3CD (Homo sapiens) 6480464 Vitamin E results in increased expression of PIK3CD mRNA CTD PMID:19244175 Pik3cd Rat wortmannin decreases activity ISO Pik3cd (Mus musculus) 6480464 wortmannin results in decreased activity of PIK3CD protein CTD PMID:21644799 Pik3cd Rat Yessotoxin increases expression ISO PIK3CD (Homo sapiens) 6480464 yessotoxin analog results in increased expression of PIK3CD mRNA CTD PMID:30679557 Pik3cd Rat zearalenone increases expression ISO Pik3cd (Mus musculus) 6480464 Zearalenone results in increased expression of PIK3CD mRNA CTD PMID:30138655
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-butoxyethanol (ISO) 3,3',5-triiodo-L-thyronine (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-nitrophenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) calcium atom (ISO) calcium(0) (ISO) cannabidiol (ISO) carbamazepine (ISO) carmustine (ISO) celastrol (ISO) chlormequat chloride (EXP) chloroprene (ISO) chlorpyrifos (EXP,ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) diclofenac (ISO) dicrotophos (ISO) dioxygen (ISO) diquat (ISO) Doramectin (EXP) elemental selenium (ISO) entinostat (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fonofos (ISO) gedunin (ISO) genistein (EXP) gentamycin (EXP) glycyrrhetinate (ISO) glycyrrhetinic acid (ISO) glycyrrhizinic acid (ISO) IC-87114 (ISO) idelalisib (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) LY294002 (ISO) methapyrilene (ISO) methyl methanesulfonate (ISO) N-nitrosodimethylamine (ISO) nickel atom (ISO) obeticholic acid (ISO) ochratoxin A (ISO) ozone (ISO) parathion (ISO) pentachlorophenol (ISO) phenol (ISO) phorbol 13-acetate 12-myristate (ISO) potassium chromate (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) selenium atom (ISO) silicon dioxide (ISO) sirolimus (ISO) sodium arsenite (ISO) sulforaphane (ISO) sunitinib (ISO) tamibarotene (ISO) temozolomide (ISO) terbufos (ISO) testosterone (EXP) tetrachloromethane (EXP) tetracycline (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) Tributyltin oxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) Tylophorine (ISO) valproic acid (ISO) vitamin E (ISO) wortmannin (ISO) Yessotoxin (ISO) zearalenone (ISO)
1.
MiR-339 inhibits proliferation of pulmonary artery smooth muscle cell by targeting FGF signaling.
Chen J, etal., Physiol Rep. 2017 Sep;5(18). pii: 5/18/e13441. doi: 10.14814/phy2.13441.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Phosphoinositide 3-kinases as a common platform for multi-hormone signaling.
Hirsch E, etal., J Endocrinol. 2007 Aug;194(2):243-56.
5.
Pharmacological inhibition of p110δ subunit of PI3K confers protection against experimental leishmaniasis.
Khadem F, etal., J Antimicrob Chemother. 2017 Feb;72(2):467-477. doi: 10.1093/jac/dkw448. Epub 2016 Dec 20.
6.
Neuregulin 1-ErbB4-PI3K signaling in schizophrenia and phosphoinositide 3-kinase-p110δ inhibition as a potential therapeutic strategy.
Law AJ, etal., Proc Natl Acad Sci U S A. 2012 Jul 24;109(30):12165-70. doi: 10.1073/pnas.1206118109. Epub 2012 Jun 11.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Deficiency of Phosphatidylinositol 3-Kinase δ Signaling Leads to Diminished Numbers of Regulatory T Cells and Increased Neutrophil Activity Resulting in Mortality Due to Endotoxic Shock.
Okeke EB, etal., J Immunol. 2017 Aug 1;199(3):1086-1095. doi: 10.4049/jimmunol.1600954. Epub 2017 Jun 28.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
PI3Kδ Regulates the Magnitude of CD8+ T Cell Responses after Challenge with Listeria monocytogenes.
Pearce VQ, etal., J Immunol. 2015 Oct 1;195(7):3206-17. doi: 10.4049/jimmunol.1501227. Epub 2015 Aug 26.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
14.
The p110δ isoforme of phosphatidylinositol 3-kinase plays an important role in host defense against chlamydial lung infection through influencing CD4+ T-cell function.
Qiao S, etal., Pathog Dis. 2018 Aug 1;76(6). pii: 5035814. doi: 10.1093/femspd/fty053.
15.
Role of PI3Kdelta and PI3Kgamma in inflammatory arthritis and tissue localization of neutrophils.
Randis TM, etal., Eur J Immunol. 2008 May;38(5):1215-24.
16.
GOA pipeline
RGD automated data pipeline
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
Primate-specific miR-663 functions as a tumor suppressor by targeting PIK3CD and predicts the prognosis of human glioblastoma.
Shi Y, etal., Clin Cancer Res. 2014 Apr 1;20(7):1803-13. doi: 10.1158/1078-0432.CCR-13-2284. Epub 2014 Feb 12.
20.
PI3Kδ hyper-activation promotes development of B cells that exacerbate Streptococcus pneumoniae infection in an antibody-independent manner.
Stark AK, etal., Nat Commun. 2018 Aug 9;9(1):3174. doi: 10.1038/s41467-018-05674-8.
21.
Aberrant methylation of ERBB pathway genes in sporadic colorectal cancer.
Szmida E, etal., J Appl Genet. 2015 May;56(2):185-92. doi: 10.1007/s13353-014-0253-6. Epub 2014 Nov 1.
22.
PIK3R1 (p85a) is somatically mutated at high frequency in primary endometrial cancer.
Urick ME, etal., Cancer Res. 2011 Jun 15;71(12):4061-7. doi: 10.1158/0008-5472.CAN-11-0549. Epub 2011 Apr 8.
Pik3cd Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 165,377,994 - 165,426,620 (-) NCBI GRCr8 mRatBN7.2 5 160,094,952 - 160,142,962 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 160,094,952 - 160,120,930 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 162,811,574 - 162,837,548 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 164,630,975 - 164,656,844 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 164,587,341 - 164,613,203 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 166,602,053 - 166,628,028 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 166,602,053 - 166,628,028 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 170,248,202 - 170,274,177 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 166,735,274 - 166,761,189 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 166,747,134 - 166,774,251 (-) NCBI Celera 5 158,364,393 - 158,390,431 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
PIK3CD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 9,627,258 - 9,729,114 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 9,629,889 - 9,729,114 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 9,711,789 - 9,789,172 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 9,634,377 - 9,711,759 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 9,646,068 - 9,723,240 NCBI Celera 1 8,862,699 - 8,900,443 (+) NCBI Celera Cytogenetic Map 1 p36.22 NCBI HuRef 1 8,867,937 - 8,945,277 (+) NCBI HuRef CHM1_1 1 9,700,330 - 9,777,708 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 9,170,040 - 9,271,897 (+) NCBI T2T-CHM13v2.0
Pik3cd Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 149,733,625 - 149,787,023 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 149,733,625 - 149,787,028 (-) Ensembl GRCm39 Ensembl GRCm38 4 149,649,168 - 149,702,566 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 149,649,168 - 149,702,571 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 149,023,277 - 149,075,738 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 148,492,968 - 148,542,489 (-) NCBI MGSCv36 mm8 Celera 4 151,915,787 - 151,968,568 (-) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 80.15 NCBI
Pik3cd Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 3,813,923 - 3,838,119 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 3,813,923 - 3,837,563 (-) NCBI ChiLan1.0 ChiLan1.0
PIK3CD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 218,491,653 - 218,569,742 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 217,137,299 - 217,214,394 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 8,418,570 - 8,495,435 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 9,683,626 - 9,724,641 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 9,686,208 - 9,724,633 (+) Ensembl panpan1.1 panPan2
PIK3CD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 62,884,596 - 62,936,882 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 62,909,009 - 62,935,971 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 62,900,181 - 62,953,014 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 63,111,143 - 63,163,978 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 63,093,394 - 63,164,766 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 63,132,926 - 63,185,725 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 62,972,335 - 63,025,149 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 63,376,064 - 63,428,899 (+) NCBI UU_Cfam_GSD_1.0
Pik3cd
PIK3CD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 70,026,373 - 70,084,742 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 70,026,254 - 70,086,950 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 64,031,598 - 64,091,037 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PIK3CD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 122,040,131 - 122,111,397 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 122,041,963 - 122,078,504 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 26,005,112 - 26,077,450 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pik3cd
.
Confirmed Target Of
Mir384 rno-miR-384-5p Mirtarbase external_info Luciferase reporter assay//qRT-PCR//Western blot Functional MTI 23315007
Predicted Target Of
Count of predictions: 387 Count of miRNA genes: 230 Interacting mature miRNAs: 270 Transcripts: ENSRNOT00000066179 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
RH133425
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 160,095,082 - 160,095,287 (+) MAPPER mRatBN7.2 Rnor_6.0 5 166,602,184 - 166,602,388 NCBI Rnor6.0 Rnor_5.0 5 170,248,333 - 170,248,537 UniSTS Rnor5.0 RGSC_v3.4 5 166,735,405 - 166,735,609 UniSTS RGSC3.4 Celera 5 158,364,524 - 158,364,728 UniSTS RH 3.4 Map 5 1115.8 UniSTS Cytogenetic Map 5 q36 UniSTS
RH142729
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 160,112,028 - 160,112,136 (+) MAPPER mRatBN7.2 Rnor_6.0 5 166,619,130 - 166,619,237 NCBI Rnor6.0 Rnor_5.0 5 170,265,279 - 170,265,386 UniSTS Rnor5.0 RGSC_v3.4 5 166,752,291 - 166,752,398 UniSTS RGSC3.4 Celera 5 158,381,533 - 158,381,640 UniSTS RH 3.4 Map 5 1115.5 UniSTS Cytogenetic Map 5 q36 UniSTS
BE109926
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 160,097,539 - 160,097,715 (+) MAPPER mRatBN7.2 Rnor_6.0 5 166,604,641 - 166,604,816 NCBI Rnor6.0 Rnor_5.0 5 170,250,790 - 170,250,965 UniSTS Rnor5.0 RGSC_v3.4 5 166,737,862 - 166,738,037 UniSTS RGSC3.4 Celera 5 158,366,981 - 158,367,156 UniSTS RH 3.4 Map 5 1114.6 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066179 ⟹ ENSRNOP00000061674
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 160,094,952 - 160,120,930 (-) Ensembl Rnor_6.0 Ensembl 5 166,602,053 - 166,628,028 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095643 ⟹ ENSRNOP00000076811
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 160,095,016 - 160,120,930 (-) Ensembl
RefSeq Acc Id:
NM_001108978 ⟹ NP_001102448
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,377,994 - 165,403,968 (-) NCBI mRatBN7.2 5 160,094,952 - 160,120,930 (-) NCBI Rnor_6.0 5 166,602,053 - 166,628,028 (-) NCBI Rnor_5.0 5 170,248,202 - 170,274,177 (-) NCBI RGSC_v3.4 5 166,735,274 - 166,761,189 (-) RGD Celera 5 158,364,393 - 158,390,431 (-) RGD
Sequence:
CTTTCAGACACATAAGGAGCTGAGAGCCAGGCAGAAGTGGGATGAAGCTCCCTGATGGCAAAGCACCTGTAATCTCCCAGGCACAGGGGCCTTGGCTGGTGGTCCTTCTCGGCCCATCCCAAACAGGA
hide sequence
RefSeq Acc Id:
XM_039110494 ⟹ XP_038966422
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,961 (-) NCBI
RefSeq Acc Id:
XM_039110495 ⟹ XP_038966423
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,962 (-) NCBI
RefSeq Acc Id:
XM_039110496 ⟹ XP_038966424
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,425,942 (-) NCBI mRatBN7.2 5 160,095,015 - 160,126,805 (-) NCBI
RefSeq Acc Id:
XM_039110497 ⟹ XP_038966425
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,406,179 (-) NCBI mRatBN7.2 5 160,095,015 - 160,123,156 (-) NCBI
RefSeq Acc Id:
XM_039110498 ⟹ XP_038966426
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,425,870 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,835 (-) NCBI
RefSeq Acc Id:
XM_039110499 ⟹ XP_038966427
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,961 (-) NCBI
RefSeq Acc Id:
XM_039110500 ⟹ XP_038966428
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,961 (-) NCBI
RefSeq Acc Id:
XM_039110501 ⟹ XP_038966429
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,961 (-) NCBI
RefSeq Acc Id:
XM_039110502 ⟹ XP_038966430
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,961 (-) NCBI
RefSeq Acc Id:
XM_039110503 ⟹ XP_038966431
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,961 (-) NCBI
RefSeq Acc Id:
XM_039110504 ⟹ XP_038966432
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,961 (-) NCBI
RefSeq Acc Id:
XM_039110505 ⟹ XP_038966433
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI mRatBN7.2 5 160,095,015 - 160,142,961 (-) NCBI
RefSeq Acc Id:
XM_063288133 ⟹ XP_063144203
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI
RefSeq Acc Id:
XM_063288134 ⟹ XP_063144204
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,406,174 (-) NCBI
RefSeq Acc Id:
XM_063288135 ⟹ XP_063144205
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,405,561 (-) NCBI
RefSeq Acc Id:
XM_063288136 ⟹ XP_063144206
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,425,933 (-) NCBI
RefSeq Acc Id:
XM_063288137 ⟹ XP_063144207
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI
RefSeq Acc Id:
XM_063288138 ⟹ XP_063144208
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,425,990 (-) NCBI
RefSeq Acc Id:
XM_063288139 ⟹ XP_063144209
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,406,167 (-) NCBI
RefSeq Acc Id:
XM_063288140 ⟹ XP_063144210
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,425,917 (-) NCBI
RefSeq Acc Id:
XM_063288141 ⟹ XP_063144211
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,426,620 (-) NCBI
RefSeq Acc Id:
XM_063288142 ⟹ XP_063144212
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 165,378,057 - 165,406,177 (-) NCBI
RefSeq Acc Id:
NP_001102448 ⟸ NM_001108978
- UniProtKB:
D4A5Q1 (UniProtKB/TrEMBL), A6IUB9 (UniProtKB/TrEMBL)
- Sequence:
MPPGVDCPMEFWTKEESQSVAVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPFFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEF
hide sequence
Ensembl Acc Id:
ENSRNOP00000061674 ⟸ ENSRNOT00000066179
RefSeq Acc Id:
XP_038966423 ⟸ XM_039110495
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038966433 ⟸ XM_039110505
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_038966432 ⟸ XM_039110504
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038966429 ⟸ XM_039110501
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038966428 ⟸ XM_039110500
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038966431 ⟸ XM_039110503
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_038966430 ⟸ XM_039110502
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038966427 ⟸ XM_039110499
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5Y949 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966422 ⟸ XM_039110494
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038966426 ⟸ XM_039110498
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038966424 ⟸ XM_039110496
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038966425 ⟸ XM_039110497
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000076811 ⟸ ENSRNOT00000095643
RefSeq Acc Id:
XP_063144211 ⟸ XM_063288141
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063144203 ⟸ XM_063288133
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063144207 ⟸ XM_063288137
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063144208 ⟸ XM_063288138
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063144206 ⟸ XM_063288136
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5Y949 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144210 ⟸ XM_063288140
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063144212 ⟸ XM_063288142
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063144204 ⟸ XM_063288134
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5Y949 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144209 ⟸ XM_063288139
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063144205 ⟸ XM_063288135
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5Y949 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-10
Pik3cd
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta
Pik3cd
phosphoinositide-3-kinase, catalytic, delta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-04-23
Pik3cd
phosphoinositide-3-kinase, catalytic, delta polypeptide
Pik3cd
phosphatidylinositol 3-kinase catalytic delta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Pik3cd
phosphatidylinositol 3-kinase catalytic delta polypeptide
Pik3cd_predicted
phosphatidylinositol 3-kinase catalytic delta polypeptide (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Pik3cd_predicted
phosphatidylinositol 3-kinase catalytic delta polypeptide (predicted)
Symbol and Name status set to approved
70820 APPROVED
