Symbol:
Usp45
Name:
ubiquitin specific peptidase 45
RGD ID:
1310976
Description:
Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in cell migration and photoreceptor cell maintenance. Predicted to act upstream of or within DNA repair and protein deubiquitination. Predicted to be located in cytosol; nucleoplasm; and photoreceptor inner segment. Human ortholog(s) of this gene implicated in Leber congenital amaurosis 19. Orthologous to human USP45 (ubiquitin specific peptidase 45); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC313098; ubiquitin carboxyl-terminal hydrolase 45; ubiquitin specific petidase 45; ubiquitin specific protease 45
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 40,115,394 - 40,188,861 (+) NCBI GRCr8 mRatBN7.2 5 35,318,621 - 35,392,090 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 35,318,635 - 35,389,420 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 37,442,950 - 37,516,428 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 39,035,678 - 39,109,156 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 38,975,187 - 39,048,666 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 35,916,763 - 35,984,525 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 35,916,804 - 35,984,524 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 40,573,111 - 40,639,487 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 36,517,213 - 36,590,986 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 36,502,821 - 36,587,983 (+) NCBI Celera 5 34,335,326 - 34,403,408 (+) NCBI Celera Cytogenetic Map 5 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp45 Rat (1->4)-beta-D-glucan multiple interactions ISO Usp45 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP45 mRNA CTD PMID:36331819 Usp45 Rat 1,2-dimethylhydrazine multiple interactions ISO Usp45 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of USP45 mRNA] CTD PMID:22206623 Usp45 Rat 1,2-dimethylhydrazine decreases expression ISO Usp45 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP45 mRNA CTD PMID:22206623 Usp45 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of USP45 mRNA CTD PMID:29097150 Usp45 Rat 17beta-estradiol increases expression ISO USP45 (Homo sapiens) 6480464 Estradiol results in increased expression of USP45 mRNA CTD PMID:31614463 Usp45 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp45 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP45 mRNA CTD PMID:21570461 Usp45 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP45 mRNA CTD PMID:33387578 Usp45 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP45 mRNA CTD PMID:32109520 Usp45 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of USP45 mRNA CTD PMID:30071829 Usp45 Rat acrolein multiple interactions ISO USP45 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of USP45 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of USP45 mRNA CTD PMID:32699268 Usp45 Rat aflatoxin B1 increases expression ISO Usp45 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of USP45 mRNA CTD PMID:19770486 Usp45 Rat aflatoxin B1 increases methylation ISO USP45 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of USP45 intron CTD PMID:30157460 Usp45 Rat Aflatoxin B2 alpha increases methylation ISO USP45 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of USP45 intron CTD PMID:30157460 Usp45 Rat all-trans-retinoic acid decreases expression ISO USP45 (Homo sapiens) 6480464 Tretinoin results in decreased expression of USP45 mRNA CTD PMID:33167477 Usp45 Rat alpha-pinene multiple interactions ISO USP45 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of USP45 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of USP45 mRNA CTD PMID:32699268 Usp45 Rat arsane affects methylation ISO USP45 (Homo sapiens) 6480464 Arsenic affects the methylation of USP45 gene CTD PMID:25304211 Usp45 Rat arsenic atom affects methylation ISO USP45 (Homo sapiens) 6480464 Arsenic affects the methylation of USP45 gene CTD PMID:25304211 Usp45 Rat benzo[e]pyrene increases methylation ISO USP45 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of USP45 intron CTD PMID:30157460 Usp45 Rat beta-lapachone increases expression ISO USP45 (Homo sapiens) 6480464 beta-lapachone results in increased expression of USP45 mRNA CTD PMID:38218311 Usp45 Rat beta-lapachone decreases expression ISO USP45 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of USP45 mRNA CTD PMID:38218311 Usp45 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP45 mRNA CTD PMID:25181051 Usp45 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP45 mRNA CTD PMID:30816183 and PMID:34947998 Usp45 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of USP45 gene CTD PMID:28505145 Usp45 Rat bortezomib increases expression ISO USP45 (Homo sapiens) 6480464 Bortezomib results in increased expression of USP45 mRNA CTD PMID:20977926 Usp45 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of USP45 promoter CTD PMID:22457795 Usp45 Rat CGP 52608 multiple interactions ISO USP45 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP45 gene] CTD PMID:28238834 Usp45 Rat chlorpyrifos decreases expression ISO Usp45 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of USP45 mRNA CTD PMID:37019170 Usp45 Rat choline multiple interactions ISO Usp45 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of USP45 mRNA CTD PMID:20938992 Usp45 Rat crocidolite asbestos decreases expression ISO Usp45 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of USP45 mRNA CTD PMID:29279043 Usp45 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of USP45 mRNA CTD PMID:26577399 Usp45 Rat Dibutyl phosphate affects expression ISO USP45 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP45 mRNA CTD PMID:37042841 Usp45 Rat dioxygen increases expression ISO Usp45 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of USP45 mRNA CTD PMID:22629407 Usp45 Rat dioxygen multiple interactions ISO Usp45 (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of USP45 mRNA] CTD PMID:22629407 Usp45 Rat doxorubicin decreases expression ISO USP45 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of USP45 mRNA CTD PMID:29803840 Usp45 Rat folic acid multiple interactions ISO Usp45 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of USP45 mRNA more ... CTD PMID:20938992 and PMID:22206623 Usp45 Rat folic acid decreases expression ISO Usp45 (Mus musculus) 6480464 Folic Acid results in decreased expression of USP45 mRNA CTD PMID:25629700 Usp45 Rat formaldehyde decreases expression ISO USP45 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of USP45 mRNA CTD PMID:23649840 Usp45 Rat FR900359 decreases phosphorylation ISO USP45 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of USP45 protein CTD PMID:37730182 Usp45 Rat gallic acid decreases expression ISO USP45 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of USP45 mRNA CTD PMID:34408198 Usp45 Rat L-methionine multiple interactions ISO Usp45 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of USP45 mRNA CTD PMID:20938992 Usp45 Rat manganese atom decreases expression ISO USP45 (Homo sapiens) 6480464 Manganese results in decreased expression of USP45 mRNA CTD PMID:17175027 Usp45 Rat manganese(0) decreases expression ISO USP45 (Homo sapiens) 6480464 Manganese results in decreased expression of USP45 mRNA CTD PMID:17175027 Usp45 Rat manganese(II) chloride decreases expression ISO USP45 (Homo sapiens) 6480464 manganese chloride results in decreased expression of USP45 mRNA CTD PMID:17175027 Usp45 Rat methapyrilene increases methylation ISO USP45 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of USP45 intron CTD PMID:30157460 Usp45 Rat methyl methanesulfonate increases expression ISO USP45 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of USP45 mRNA CTD PMID:23649840 Usp45 Rat methylmercury chloride decreases expression ISO USP45 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of USP45 mRNA CTD PMID:28001369 Usp45 Rat ozone multiple interactions ISO USP45 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of USP45 mRNA more ... CTD PMID:32699268 Usp45 Rat paracetamol increases expression ISO USP45 (Homo sapiens) 6480464 Acetaminophen results in increased expression of USP45 mRNA CTD PMID:26690555 Usp45 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of USP45 mRNA CTD PMID:33387578 Usp45 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp45 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP45 mRNA CTD PMID:36331819 Usp45 Rat phenobarbital affects expression ISO Usp45 (Mus musculus) 6480464 Phenobarbital affects the expression of USP45 mRNA CTD PMID:23091169 Usp45 Rat phlorizin decreases expression ISO Usp45 (Mus musculus) 6480464 Phlorhizin results in decreased expression of USP45 mRNA CTD PMID:22538082 Usp45 Rat pirinixic acid decreases expression ISO Usp45 (Mus musculus) 6480464 pirinixic acid results in decreased expression of USP45 mRNA CTD PMID:18445702 Usp45 Rat sunitinib increases expression ISO USP45 (Homo sapiens) 6480464 Sunitinib results in increased expression of USP45 mRNA CTD PMID:31533062 Usp45 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of USP45 mRNA CTD PMID:34492290 Usp45 Rat titanium dioxide decreases methylation ISO Usp45 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP45 gene CTD PMID:35295148 Usp45 Rat trichostatin A increases expression ISO USP45 (Homo sapiens) 6480464 trichostatin A results in increased expression of USP45 mRNA CTD PMID:24935251 Usp45 Rat triphenyl phosphate affects expression ISO USP45 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP45 mRNA CTD PMID:37042841 Usp45 Rat valproic acid affects expression ISO Usp45 (Mus musculus) 6480464 Valproic Acid affects the expression of USP45 mRNA CTD PMID:17292431 Usp45 Rat valproic acid increases expression ISO USP45 (Homo sapiens) 6480464 Valproic Acid results in increased expression of USP45 mRNA CTD PMID:24935251 and PMID:29154799 Usp45 Rat valproic acid decreases methylation ISO USP45 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of USP45 gene CTD PMID:29154799 Usp45 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of USP45 mRNA CTD PMID:23034163 Usp45 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of USP45 gene CTD PMID:31682807 Usp45 Rat vorinostat increases expression ISO USP45 (Homo sapiens) 6480464 vorinostat results in increased expression of USP45 mRNA CTD PMID:27188386
Usp45 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 40,115,394 - 40,188,861 (+) NCBI GRCr8 mRatBN7.2 5 35,318,621 - 35,392,090 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 35,318,635 - 35,389,420 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 37,442,950 - 37,516,428 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 39,035,678 - 39,109,156 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 38,975,187 - 39,048,666 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 35,916,763 - 35,984,525 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 35,916,804 - 35,984,524 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 40,573,111 - 40,639,487 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 36,517,213 - 36,590,986 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 36,502,821 - 36,587,983 (+) NCBI Celera 5 34,335,326 - 34,403,408 (+) NCBI Celera Cytogenetic Map 5 q21 NCBI
USP45 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 99,432,325 - 99,517,846 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 99,432,325 - 99,521,728 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 99,880,201 - 99,963,299 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 99,986,903 - 100,069,973 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 100,524,338 - 100,607,389 (-) NCBI Celera Cytogenetic Map 6 q16.2 NCBI HuRef 6 97,320,605 - 97,403,620 (-) NCBI HuRef CHM1_1 6 100,143,216 - 100,226,233 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 100,606,672 - 100,692,182 (-) NCBI T2T-CHM13v2.0
Usp45 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 21,767,161 - 21,837,872 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 21,767,156 - 21,837,872 (+) Ensembl GRCm39 Ensembl GRCm38 4 21,767,161 - 21,837,872 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 21,767,156 - 21,837,872 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 21,703,417 - 21,765,019 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 21,867,134 - 21,928,707 (+) NCBI MGSCv36 mm8 Celera 4 21,521,282 - 21,582,575 (+) NCBI Celera Cytogenetic Map 4 A3 NCBI cM Map 4 8.93 NCBI
Usp45 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 25,316,535 - 25,378,573 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 25,315,536 - 25,375,283 (-) NCBI ChiLan1.0 ChiLan1.0
USP45 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 119,479,099 - 119,562,643 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 117,357,233 - 117,443,835 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 97,273,498 - 97,356,749 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 101,155,903 - 101,239,145 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 101,155,903 - 101,238,682 (-) Ensembl panpan1.1 panPan2
USP45 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 57,637,890 - 57,706,562 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 57,642,515 - 57,706,511 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 57,396,662 - 57,468,813 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 58,460,557 - 58,533,263 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 58,500,488 - 58,533,253 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 57,817,618 - 57,889,705 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 57,662,704 - 57,736,494 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 57,907,902 - 57,981,807 (-) NCBI UU_Cfam_GSD_1.0
Usp45 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 92,576,117 - 92,663,981 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936651 1,037,804 - 1,119,399 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936651 1,031,328 - 1,119,344 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP45 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 66,387,608 - 66,454,737 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 66,387,616 - 66,454,806 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 75,067,349 - 75,131,522 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP45 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 74,368,043 - 74,434,884 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 74,362,564 - 74,438,133 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 46,695,092 - 46,768,332 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp45
.
Predicted Target Of
Count of predictions: 398 Count of miRNA genes: 228 Interacting mature miRNAs: 273 Transcripts: ENSRNOT00000066043 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2293666 Bmd38 Bone mineral density QTL 38 4.4 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 5 8948228 53948228 Rat 1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 1300117 Hrtrt8 Heart rate QTL 8 3.49 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 3844018 47869213 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 61462 Niddm10 Non-insulin dependent diabetes mellitus QTL 10 3.9 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 5 5112159 47171491 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 1549901 Neudeg2 Neurodegradation QTL 2 4 0 nervous system integrity trait (VT:0010566) mononuclear cell count (CMO:0002119) 5 24838710 44045280 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 1641903 Alcrsp3 Alcohol response QTL 3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 12689285 57689285 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat
AU015084
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 35,320,665 - 35,320,777 (+) MAPPER mRatBN7.2 Rnor_6.0 5 35,918,816 - 35,918,927 NCBI Rnor6.0 Rnor_5.0 5 40,575,342 - 40,575,453 UniSTS Rnor5.0 RGSC_v3.4 5 36,519,201 - 36,519,312 UniSTS RGSC3.4 Celera 5 34,337,357 - 34,337,468 UniSTS Cytogenetic Map 5 q21 UniSTS
BF399437
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 35,371,967 - 35,372,128 (+) MAPPER mRatBN7.2 Rnor_6.0 5 35,967,091 - 35,967,251 NCBI Rnor6.0 Rnor_5.0 5 40,622,096 - 40,622,256 UniSTS Rnor5.0 RGSC_v3.4 5 36,573,544 - 36,573,704 UniSTS RGSC3.4 Celera 5 34,386,072 - 34,386,232 UniSTS RH 3.4 Map 5 166.0 UniSTS Cytogenetic Map 5 q21 UniSTS
AI843191
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 35,388,965 - 35,389,062 (+) MAPPER mRatBN7.2 mRatBN7.2 7 53,916,905 - 53,917,002 (-) MAPPER mRatBN7.2 mRatBN7.2 5 35,388,965 - 35,389,062 (-) MAPPER mRatBN7.2 mRatBN7.2 7 53,916,905 - 53,917,002 (+) MAPPER mRatBN7.2 Rnor_6.0 7 61,350,948 - 61,351,044 NCBI Rnor6.0 Rnor_6.0 5 35,984,070 - 35,984,166 NCBI Rnor6.0 Rnor_5.0 7 61,347,169 - 61,347,265 UniSTS Rnor5.0 Rnor_5.0 5 40,639,032 - 40,639,128 UniSTS Rnor5.0 RGSC_v3.4 5 36,590,532 - 36,590,628 UniSTS RGSC3.4 RGSC_v3.4 7 57,635,321 - 57,635,417 UniSTS RGSC3.4 Celera 5 34,402,954 - 34,403,050 UniSTS Cytogenetic Map 5 q21 UniSTS
RH137368
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 53,916,654 - 53,916,873 (+) MAPPER mRatBN7.2 mRatBN7.2 5 35,389,094 - 35,389,313 (-) MAPPER mRatBN7.2 mRatBN7.2 7 53,916,654 - 53,916,873 (-) MAPPER mRatBN7.2 mRatBN7.2 5 35,389,094 - 35,389,313 (+) MAPPER mRatBN7.2 Rnor_6.0 7 61,350,697 - 61,350,915 NCBI Rnor6.0 Rnor_6.0 5 35,984,199 - 35,984,417 NCBI Rnor6.0 Rnor_5.0 7 61,346,918 - 61,347,136 UniSTS Rnor5.0 Rnor_5.0 5 40,639,161 - 40,639,379 UniSTS Rnor5.0 RGSC_v3.4 5 36,590,661 - 36,590,879 UniSTS RGSC3.4 RGSC_v3.4 7 57,635,070 - 57,635,288 UniSTS RGSC3.4 Celera 5 34,403,083 - 34,403,301 UniSTS RH 3.4 Map 5 165.5 UniSTS Cytogenetic Map 5 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066043 ⟹ ENSRNOP00000060364
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 35,318,635 - 35,389,420 (+) Ensembl Rnor_6.0 Ensembl 5 35,916,804 - 35,984,524 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083132 ⟹ ENSRNOP00000073155
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 35,318,635 - 35,389,420 (+) Ensembl Rnor_6.0 Ensembl 5 35,916,819 - 35,981,378 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108204 ⟹ ENSRNOP00000092813
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 35,318,635 - 35,389,420 (+) Ensembl
RefSeq Acc Id:
NM_001395561 ⟹ NP_001382490
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 40,115,409 - 40,188,861 (+) NCBI mRatBN7.2 5 35,318,635 - 35,392,090 (+) NCBI
RefSeq Acc Id:
XM_006237939 ⟹ XP_006238001
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 40,115,426 - 40,186,192 (+) NCBI mRatBN7.2 5 35,318,640 - 35,392,090 (+) NCBI Rnor_6.0 5 35,916,777 - 35,984,525 (+) NCBI Rnor_5.0 5 40,573,111 - 40,639,487 (+) NCBI
Sequence:
GGACGCCAGGCCCCGCCTTCTCCGGTTCCCCTCTGCACAGGCGCAGAAGCTCCTGCGTGTGGAAGCTGCGGCCCGGCGGGCGGGGTGAGTTGGGGCCCAGGCTTTGGGGTCACTGCAACCCCTGTGTC
hide sequence
RefSeq Acc Id:
XM_006237940 ⟹ XP_006238002
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 40,115,394 - 40,186,192 (+) NCBI mRatBN7.2 5 35,318,621 - 35,392,090 (+) NCBI Rnor_6.0 5 35,916,764 - 35,984,525 (+) NCBI Rnor_5.0 5 40,573,111 - 40,639,487 (+) NCBI
Sequence:
CTCGCCCCGCCCAGGACGCCAGGCCCCGCCTTCTCCGGTTCCCCTCTGCACAGGCGCAGAAGCT
hide sequence
RefSeq Acc Id:
XM_006237941 ⟹ XP_006238003
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 40,115,394 - 40,186,192 (+) NCBI mRatBN7.2 5 35,318,621 - 35,392,090 (+) NCBI Rnor_6.0 5 35,916,763 - 35,984,525 (+) NCBI Rnor_5.0 5 40,573,111 - 40,639,487 (+) NCBI
Sequence:
CCTCGCCCCGCCCAGGACGCCAGGCCCCGCCTTCTCCGGTTCCCCTCTGCACAGGCGCAGAAGCTCCTGCGTGTGGAAGCTGCGGCCCGGCGGGCGGGGAAATAACAGATGCGGGTAAAAGATCCATC
hide sequence
RefSeq Acc Id:
XM_039109812 ⟹ XP_038965740
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 40,115,426 - 40,186,192 (+) NCBI mRatBN7.2 5 35,318,640 - 35,392,090 (+) NCBI
RefSeq Acc Id:
XM_039109813 ⟹ XP_038965741
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 40,137,292 - 40,186,192 (+) NCBI mRatBN7.2 5 35,340,516 - 35,392,090 (+) NCBI
RefSeq Acc Id:
XP_006238003 ⟸ XM_006237941
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AG99 (UniProtKB/TrEMBL)
- Sequence:
MRVKDPSKDLPEKGKRSKRPLLPHDEDSSDDIAVGLTCQHISYAVSVNHVKKAVAETLWSVCSECLKERRLCDGQPVLPSDVWLCLKCGFQGCGKNSESQHSLRHFKSSGAESHCVVISLSTWVIWCY
hide sequence
RefSeq Acc Id:
XP_006238002 ⟸ XM_006237940
- Peptide Label:
isoform X2
- Sequence:
MRVKDPSKDLPEKGKRSKRPLLPHDEDSSDDIAGLTCQHISYAVSVNHVKKAVAETLWSVCSECLKERRLCDGQPVLPSDVWLCLKCGFQGCGKNSESQHSLRHFKSSGAESHCVVISLSTWVIWCYE
hide sequence
RefSeq Acc Id:
XP_006238001 ⟸ XM_006237939
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K4S7 (UniProtKB/TrEMBL)
- Sequence:
MRVKDPSKDLPEKGKRSKRPLLPHDEDSSDDIAVGLTCQHISYAVSVNHVKKAVAETLWSVCSE
hide sequence
Ensembl Acc Id:
ENSRNOP00000060364 ⟸ ENSRNOT00000066043
Ensembl Acc Id:
ENSRNOP00000073155 ⟸ ENSRNOT00000083132
RefSeq Acc Id:
XP_038965740 ⟸ XM_039109812
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038965741 ⟸ XM_039109813
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000092813 ⟸ ENSRNOT00000108204
RefSeq Acc Id:
NP_001382490 ⟸ NM_001395561
- UniProtKB:
A0A0G2K4S7 (UniProtKB/TrEMBL)
RGD ID: 13693596 Promoter ID: EPDNEW_R4121 Type: multiple initiation site Name: Usp45_1 Description: ubiquitin specific peptidase 45 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 35,916,813 - 35,916,873 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Usp45
ubiquitin specific peptidase 45
Usp45
ubiquitin specific petidase 45
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Usp45
ubiquitin specific petidase 45
Usp45_predicted
ubiquitin specific petidase 45 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Usp45_predicted
ubiquitin specific petidase 45 (predicted)
ubiquitin specific protease 45 (predicted)
Name updated
1299863 APPROVED
2005-01-12
Usp45_predicted
ubiquitin specific protease 45 (predicted)
Symbol and Name status set to approved
70820 APPROVED
