Symbol:
Rras2
Name:
RAS related 2
RGD ID:
1310793
Description:
Predicted to enable GDP binding activity; GTP binding activity; and GTPase activity. Predicted to act upstream of or within Ras protein signal transduction and positive regulation of Schwann cell migration. Predicted to be located in endomembrane system. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in Noonan syndrome 12. Orthologous to human RRAS2 (RAS related 2); PARTICIPATES IN mitogen activated protein kinase signaling pathway; INTERACTS WITH (+)-schisandrin B; 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC365355; MGC109327; ras-related protein R-Ras2; related RAS viral (r-ras) oncogene homolog 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RRAS2 (RAS related 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Rras2 (related RAS viral (r-ras) oncogene 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rras2 (RAS related 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RRAS2 (RAS related 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RRAS2 (RAS related 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rras2 (RAS related 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RRAS2 (RAS related 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RRAS2 (RAS related 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rras2 (RAS related 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
RRAS2 (RAS related 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rras2 (related RAS viral (r-ras) oncogene 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rras2 (RAS related 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RAS1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ras64B
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ras-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RAS2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rras
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 177,668,143 - 177,737,551 (-) NCBI GRCr8 mRatBN7.2 1 168,233,693 - 168,303,111 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 168,233,693 - 168,303,111 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 176,562,741 - 176,632,090 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 183,748,814 - 183,818,172 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 176,462,863 - 176,532,658 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 178,940,515 - 179,010,257 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 178,940,516 - 179,010,257 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 185,908,263 - 185,978,450 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 172,026,262 - 172,097,710 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 172,162,371 - 172,233,819 (-) NCBI Celera 1 166,086,473 - 166,155,650 (-) NCBI Celera Cytogenetic Map 1 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rras2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of RRAS2 mRNA] CTD PMID:31150632 Rras2 Rat 1,1-dichloroethene increases expression ISO Rras2 (Mus musculus) 6480464 vinylidene chloride results in increased expression of RRAS2 mRNA CTD PMID:26682919 Rras2 Rat 1,2-dimethylhydrazine affects expression ISO Rras2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of RRAS2 mRNA CTD PMID:22206623 Rras2 Rat 1,2-dimethylhydrazine multiple interactions ISO Rras2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RRAS2 mRNA CTD PMID:22206623 Rras2 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of RRAS2 mRNA CTD PMID:22841810 Rras2 Rat 1-naphthyl isothiocyanate multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of RRAS2 mRNA CTD PMID:27344345 Rras2 Rat 17alpha-ethynylestradiol multiple interactions ISO Rras2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RRAS2 mRNA CTD PMID:17942748 Rras2 Rat 17alpha-ethynylestradiol increases expression ISO Rras2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of RRAS2 mRNA CTD PMID:17942748 Rras2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Rras2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Rras2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rras2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of RRAS2 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RRAS2 mRNA CTD PMID:16214954 and PMID:17942748 Rras2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RRAS2 mRNA CTD PMID:34747641 Rras2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rras2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RRAS2 mRNA CTD PMID:21570461 Rras2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Rras2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RRAS2 mRNA CTD PMID:19770486 Rras2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rras2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RRAS2 mRNA CTD PMID:15328365 and PMID:18796159 Rras2 Rat 2-(chloromethyl)pyridine increases expression ISO RRAS2 (Homo sapiens) 6480464 2-chloromethylpyridine results in increased expression of RRAS2 mRNA CTD PMID:26198647 Rras2 Rat 2-butoxyethanol decreases expression ISO Rras2 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of RRAS2 mRNA CTD PMID:19812364 Rras2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Rras2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of RRAS2 mRNA CTD PMID:19285098 Rras2 Rat 4,4'-sulfonyldiphenol increases expression ISO Rras2 (Mus musculus) 6480464 bisphenol S results in increased expression of RRAS2 mRNA CTD PMID:39298647 Rras2 Rat 5-aza-2'-deoxycytidine affects expression ISO RRAS2 (Homo sapiens) 6480464 Decitabine affects the expression of RRAS2 mRNA CTD PMID:23300844 Rras2 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RRAS2 mRNA CTD PMID:24780913 and PMID:30047161 Rras2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of RRAS2 mRNA CTD PMID:28959563 Rras2 Rat afimoxifene affects response to substance ISO RRAS2 (Homo sapiens) 6480464 RRAS2 gene affects the susceptibility to afimoxifene CTD PMID:21482774 Rras2 Rat aflatoxin B1 increases methylation ISO RRAS2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of RRAS2 gene CTD PMID:27153756 Rras2 Rat aflatoxin B1 increases expression ISO RRAS2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of RRAS2 mRNA CTD PMID:27153756 Rras2 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of RRAS2 mRNA CTD PMID:30047161 and PMID:38685447 Rras2 Rat antirheumatic drug increases expression ISO RRAS2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of RRAS2 mRNA CTD PMID:24449571 Rras2 Rat aristolochic acid A decreases expression ISO RRAS2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RRAS2 mRNA CTD PMID:33212167 Rras2 Rat arsenite(3-) multiple interactions ISO RRAS2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RRAS2 mRNA] CTD PMID:32406909 Rras2 Rat arsenous acid increases expression ISO RRAS2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of RRAS2 protein CTD PMID:25419056 Rras2 Rat azathioprine increases expression ISO RRAS2 (Homo sapiens) 6480464 Azathioprine results in increased expression of RRAS2 mRNA CTD PMID:26198647 Rras2 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat benzo[a]pyrene increases expression ISO RRAS2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of RRAS2 mRNA CTD PMID:20064835 Rras2 Rat benzo[a]pyrene affects methylation ISO RRAS2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RRAS2 promoter CTD PMID:27901495 Rras2 Rat benzo[a]pyrene increases expression ISO Rras2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RRAS2 mRNA CTD PMID:22228805 Rras2 Rat benzo[a]pyrene decreases expression ISO Rras2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of RRAS2 mRNA CTD PMID:19770486 Rras2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RRAS2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Rras2 Rat beta-lapachone increases expression ISO RRAS2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of RRAS2 mRNA CTD PMID:38218311 Rras2 Rat bis(2-chloroethyl) sulfide increases expression ISO Rras2 (Mus musculus) 6480464 Mustard Gas results in increased expression of RRAS2 mRNA CTD PMID:18955075 Rras2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Rras2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of RRAS2 mRNA CTD PMID:39150890 Rras2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Rras2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of RRAS2 mRNA CTD PMID:33754040 Rras2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rras2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RRAS2 mRNA CTD PMID:34319233 Rras2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RRAS2 mRNA CTD PMID:25181051 Rras2 Rat bisphenol A increases expression ISO RRAS2 (Homo sapiens) 6480464 bisphenol A results in increased expression of RRAS2 protein CTD PMID:34186270 Rras2 Rat bisphenol A multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of RRAS2 gene CTD PMID:31601247 Rras2 Rat bisphenol A decreases expression ISO RRAS2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of RRAS2 protein CTD PMID:33376534 and PMID:37567409 Rras2 Rat bisphenol A affects expression ISO RRAS2 (Homo sapiens) 6480464 bisphenol A affects the expression of RRAS2 mRNA CTD PMID:30903817 Rras2 Rat bisphenol AF increases expression ISO RRAS2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of RRAS2 protein CTD PMID:34186270 Rras2 Rat Bisphenol B increases expression ISO RRAS2 (Homo sapiens) 6480464 bisphenol B results in increased expression of RRAS2 protein CTD PMID:34186270 Rras2 Rat bisphenol F increases expression ISO RRAS2 (Homo sapiens) 6480464 bisphenol F results in increased expression of RRAS2 protein CTD PMID:34186270 Rras2 Rat Butylbenzyl phthalate multiple interactions ISO Rras2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of RRAS2 mRNA CTD PMID:39150890 Rras2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of RRAS2 promoter CTD PMID:22457795 Rras2 Rat capecitabine decreases response to substance ISO RRAS2 (Homo sapiens) 6480464 RRAS2 protein results in decreased susceptibility to Capecitabine CTD PMID:16734730 Rras2 Rat carbamazepine affects expression ISO RRAS2 (Homo sapiens) 6480464 Carbamazepine affects the expression of RRAS2 mRNA CTD PMID:24752500 and PMID:25979313 Rras2 Rat carbon nanotube increases expression ISO Rras2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Rras2 Rat chenodeoxycholic acid multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA CTD PMID:32152650 Rras2 Rat cisplatin affects expression ISO RRAS2 (Homo sapiens) 6480464 Cisplatin affects the expression of RRAS2 mRNA CTD PMID:23300844 Rras2 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat cobalt dichloride increases expression ISO RRAS2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of RRAS2 mRNA CTD PMID:19376846 Rras2 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of RRAS2 mRNA CTD PMID:22465980 Rras2 Rat copper atom multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of RRAS2 mRNA CTD PMID:30911355 Rras2 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of RRAS2 mRNA CTD PMID:22465980 Rras2 Rat copper(0) multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of RRAS2 mRNA CTD PMID:30911355 Rras2 Rat copper(II) sulfate increases expression ISO RRAS2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of RRAS2 mRNA CTD PMID:19549813 Rras2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of RRAS2 mRNA CTD PMID:27523638 Rras2 Rat cyclophosphamide increases expression ISO RRAS2 (Homo sapiens) 6480464 Cyclophosphamide results in increased expression of RRAS2 mRNA CTD PMID:17403535 Rras2 Rat cyclosporin A increases expression ISO RRAS2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of RRAS2 mRNA CTD PMID:25562108 Rras2 Rat cyclosporin A multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA CTD PMID:32152650 Rras2 Rat cyclosporin A decreases expression ISO RRAS2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of RRAS2 mRNA CTD PMID:27989131 Rras2 Rat DDE decreases expression ISO RRAS2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of RRAS2 mRNA CTD PMID:38568856 Rras2 Rat deoxycholic acid multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA CTD PMID:32152650 Rras2 Rat dexamethasone increases expression ISO RRAS2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of RRAS2 mRNA CTD PMID:25047013 Rras2 Rat dextran sulfate decreases expression ISO Rras2 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of RRAS2 protein CTD PMID:32272095 Rras2 Rat dextran sulfate multiple interactions ISO Rras2 (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of RRAS2 protein] CTD PMID:32272095 Rras2 Rat diarsenic trioxide increases expression ISO RRAS2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of RRAS2 protein CTD PMID:25419056 Rras2 Rat diazinon increases expression ISO RRAS2 (Homo sapiens) 6480464 Diazinon results in increased expression of RRAS2 mRNA CTD PMID:26198647 Rras2 Rat Dibutyl phosphate affects expression ISO RRAS2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RRAS2 mRNA CTD PMID:37042841 Rras2 Rat dibutyl phthalate increases expression ISO Rras2 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of RRAS2 mRNA CTD PMID:17361019 and PMID:21266533 Rras2 Rat dibutyl phthalate multiple interactions ISO Rras2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of RRAS2 mRNA CTD PMID:39150890 Rras2 Rat diclofenac affects expression ISO RRAS2 (Homo sapiens) 6480464 Diclofenac affects the expression of RRAS2 mRNA CTD PMID:24752500 Rras2 Rat dicrotophos decreases expression ISO RRAS2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of RRAS2 mRNA CTD PMID:28302478 Rras2 Rat diethyl phthalate multiple interactions ISO Rras2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of RRAS2 mRNA CTD PMID:39150890 Rras2 Rat diisobutyl phthalate multiple interactions ISO Rras2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of RRAS2 mRNA CTD PMID:39150890 Rras2 Rat diisononyl phthalate multiple interactions ISO Rras2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of RRAS2 mRNA CTD PMID:39150890 Rras2 Rat dioxygen multiple interactions ISO Rras2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of RRAS2 mRNA CTD PMID:30529165 Rras2 Rat doxifluridine decreases response to substance ISO RRAS2 (Homo sapiens) 6480464 RRAS2 protein results in decreased susceptibility to doxifluridine CTD PMID:16734730 Rras2 Rat ethanol affects expression ISO Rras2 (Mus musculus) 6480464 Ethanol affects the expression of RRAS2 mRNA CTD PMID:30319688 Rras2 Rat fenthion decreases expression ISO Rras2 (Mus musculus) 6480464 Fenthion results in decreased expression of RRAS2 mRNA CTD PMID:34813904 Rras2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of RRAS2 mRNA CTD PMID:24136188 Rras2 Rat folic acid decreases expression ISO Rras2 (Mus musculus) 6480464 Folic Acid results in decreased expression of RRAS2 mRNA CTD PMID:25629700 Rras2 Rat folic acid multiple interactions ISO Rras2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RRAS2 mRNA CTD PMID:22206623 Rras2 Rat FR900359 decreases phosphorylation ISO RRAS2 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of RRAS2 protein CTD PMID:37730182 Rras2 Rat fulvestrant multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of RRAS2 gene CTD PMID:31601247 Rras2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RRAS2 mRNA CTD PMID:22061828 and PMID:33387578 Rras2 Rat glycochenodeoxycholic acid multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA CTD PMID:32152650 Rras2 Rat glycocholic acid multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA CTD PMID:32152650 Rras2 Rat glycodeoxycholic acid multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA CTD PMID:32152650 Rras2 Rat hydrogen peroxide affects expression ISO RRAS2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of RRAS2 mRNA CTD PMID:23410634 Rras2 Rat ivermectin decreases expression ISO RRAS2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RRAS2 protein CTD PMID:32959892 Rras2 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of RRAS2 mRNA CTD PMID:20080153 Rras2 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat lipopolysaccharide multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of RRAS2 mRNA CTD PMID:35877022 Rras2 Rat menadione increases expression ISO RRAS2 (Homo sapiens) 6480464 Vitamin K 3 results in increased expression of RRAS2 mRNA CTD PMID:23410634 Rras2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of RRAS2 mRNA CTD PMID:30047161 Rras2 Rat monosodium L-glutamate increases expression ISO Rras2 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of RRAS2 mRNA CTD PMID:22078008 Rras2 Rat monosodium L-glutamate multiple interactions ISO Rras2 (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of RRAS2 mRNA CTD PMID:22078008 Rras2 Rat N-methyl-4-phenylpyridinium multiple interactions ISO RRAS2 (Homo sapiens) 6480464 U 0126 affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of RRAS2 mRNA] CTD PMID:12710931 Rras2 Rat naphthalene increases expression ISO Rras2 (Mus musculus) 6480464 naphthalene results in increased expression of RRAS2 mRNA CTD PMID:18978301 Rras2 Rat nefazodone multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of RRAS2 mRNA CTD PMID:32152650 Rras2 Rat obeticholic acid increases expression ISO RRAS2 (Homo sapiens) 6480464 obeticholic acid results in increased expression of RRAS2 mRNA CTD PMID:27939613 Rras2 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of RRAS2 mRNA CTD PMID:25729387 Rras2 Rat paracetamol affects expression ISO Rras2 (Mus musculus) 6480464 Acetaminophen affects the expression of RRAS2 mRNA CTD PMID:17562736 Rras2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RRAS2 mRNA CTD PMID:33387578 Rras2 Rat perfluorooctane-1-sulfonic acid affects expression ISO Rras2 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of RRAS2 mRNA CTD PMID:19429403 Rras2 Rat perfluorooctanoic acid affects expression ISO Rras2 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of RRAS2 mRNA CTD PMID:19429403 Rras2 Rat phenobarbital affects expression ISO RRAS2 (Homo sapiens) 6480464 Phenobarbital affects the expression of RRAS2 mRNA CTD PMID:19159669 Rras2 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat pirinixic acid multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of RRAS2 mRNA CTD PMID:19710929 Rras2 Rat pyrogallol increases expression ISO Rras2 (Mus musculus) 6480464 Pyrogallol results in increased expression of RRAS2 mRNA CTD PMID:20362636 Rras2 Rat rimonabant multiple interactions ISO Rras2 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of RRAS2 mRNA] CTD PMID:19030233 Rras2 Rat SB 431542 multiple interactions ISO RRAS2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of RRAS2 protein CTD PMID:37664457 Rras2 Rat silver atom increases expression ISO RRAS2 (Homo sapiens) 6480464 Silver results in increased expression of RRAS2 mRNA CTD PMID:26551752 Rras2 Rat silver(0) increases expression ISO RRAS2 (Homo sapiens) 6480464 Silver results in increased expression of RRAS2 mRNA CTD PMID:26551752 Rras2 Rat sodium arsenite increases expression ISO RRAS2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of RRAS2 mRNA CTD PMID:17879257 more ... Rras2 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of RRAS2 mRNA CTD PMID:35314868 Rras2 Rat sunitinib decreases expression ISO RRAS2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of RRAS2 mRNA CTD PMID:31533062 Rras2 Rat temozolomide increases expression ISO RRAS2 (Homo sapiens) 6480464 Temozolomide results in increased expression of RRAS2 mRNA CTD PMID:31758290 Rras2 Rat tert-butyl hydroperoxide increases expression ISO RRAS2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of RRAS2 mRNA CTD PMID:23410634 Rras2 Rat tetrachloromethane increases expression ISO Rras2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of RRAS2 mRNA CTD PMID:27339419 and PMID:31919559 Rras2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of RRAS2 mRNA] CTD PMID:31150632 Rras2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of RRAS2 mRNA CTD PMID:31150632 Rras2 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of RRAS2 mRNA CTD PMID:19483382 Rras2 Rat titanium dioxide decreases expression ISO Rras2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of RRAS2 mRNA CTD PMID:23557971 Rras2 Rat titanium dioxide decreases methylation ISO Rras2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RRAS2 gene and titanium dioxide results in decreased methylation of RRAS2 promoter CTD PMID:35295148 Rras2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of RRAS2 mRNA CTD PMID:25729387 Rras2 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of RRAS2 mRNA CTD PMID:25729387 Rras2 Rat trimellitic anhydride increases expression ISO Rras2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of RRAS2 mRNA CTD PMID:19042947 Rras2 Rat trimethyltin increases expression ISO Rras2 (Mus musculus) 6480464 trimethyltin results in increased expression of RRAS2 mRNA CTD PMID:20833246 Rras2 Rat triphenyl phosphate affects expression ISO RRAS2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RRAS2 mRNA CTD PMID:37042841 Rras2 Rat valproic acid affects expression ISO Rras2 (Mus musculus) 6480464 Valproic Acid affects the expression of RRAS2 mRNA CTD PMID:17963808 Rras2 Rat valproic acid affects expression ISO RRAS2 (Homo sapiens) 6480464 Valproic Acid affects the expression of RRAS2 mRNA CTD PMID:25979313 Rras2 Rat valproic acid decreases expression ISO RRAS2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RRAS2 mRNA CTD PMID:29154799 Rras2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of RRAS2 mRNA CTD PMID:23034163 Rras2 Rat zoledronic acid increases expression ISO RRAS2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of RRAS2 protein CTD PMID:28871336
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-(chloromethyl)pyridine (ISO) 2-butoxyethanol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) amiodarone (EXP) amitrole (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) azathioprine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (EXP) capecitabine (ISO) carbamazepine (ISO) carbon nanotube (ISO) chenodeoxycholic acid (ISO) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclophosphamide (ISO) cyclosporin A (ISO) DDE (ISO) deoxycholic acid (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diclofenac (ISO) dicrotophos (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) doxifluridine (ISO) ethanol (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hydrogen peroxide (ISO) ivermectin (ISO) ketamine (EXP) L-ethionine (EXP) lipopolysaccharide (ISO) menadione (ISO) methimazole (EXP) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (ISO) naphthalene (ISO) nefazodone (ISO) obeticholic acid (ISO) omeprazole (EXP) oxaliplatin (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (EXP,ISO) pyrogallol (ISO) rimonabant (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trimellitic anhydride (ISO) trimethyltin (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Rras2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 177,668,143 - 177,737,551 (-) NCBI GRCr8 mRatBN7.2 1 168,233,693 - 168,303,111 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 168,233,693 - 168,303,111 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 176,562,741 - 176,632,090 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 183,748,814 - 183,818,172 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 176,462,863 - 176,532,658 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 178,940,515 - 179,010,257 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 178,940,516 - 179,010,257 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 185,908,263 - 185,978,450 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 172,026,262 - 172,097,710 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 172,162,371 - 172,233,819 (-) NCBI Celera 1 166,086,473 - 166,155,650 (-) NCBI Celera Cytogenetic Map 1 q33 NCBI
RRAS2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 14,277,920 - 14,364,506 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 14,277,922 - 14,364,506 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 14,299,466 - 14,386,052 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 14,256,042 - 14,337,305 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 14,256,871 - 14,337,289 NCBI Celera 11 14,424,875 - 14,511,140 (-) NCBI Celera Cytogenetic Map 11 p15.2 NCBI HuRef 11 13,981,134 - 14,067,065 (-) NCBI HuRef CHM1_1 11 14,298,377 - 14,384,667 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 14,373,520 - 14,459,786 (-) NCBI T2T-CHM13v2.0
Rras2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 113,646,017 - 113,717,016 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 113,646,017 - 113,717,016 (-) Ensembl GRCm39 Ensembl GRCm38 7 114,046,782 - 114,117,781 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 114,046,782 - 114,117,781 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 121,190,296 - 121,261,295 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 113,837,969 - 113,908,962 (-) NCBI MGSCv36 mm8 Celera 7 114,009,446 - 114,081,527 (-) NCBI Celera Cytogenetic Map 7 F1 NCBI cM Map 7 59.29 NCBI
Rras2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 29,481,343 - 29,493,070 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 29,482,502 - 29,546,102 (-) NCBI ChiLan1.0 ChiLan1.0
RRAS2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 16,659,725 - 16,740,763 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 16,622,081 - 16,703,102 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 14,381,173 - 14,462,192 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 14,073,679 - 14,154,027 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 14,073,679 - 14,159,611 (-) Ensembl panpan1.1 panPan2
RRAS2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 37,037,576 - 37,119,733 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 37,038,334 - 37,112,662 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 36,540,855 - 36,621,893 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 37,927,178 - 38,008,648 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 37,928,606 - 38,008,632 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 37,178,474 - 37,259,232 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 37,363,683 - 37,444,503 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 37,644,316 - 37,725,950 (-) NCBI UU_Cfam_GSD_1.0
Rras2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 48,379,460 - 48,395,186 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936528 4,413,436 - 4,427,741 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936528 4,413,436 - 4,429,166 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RRAS2
RRAS2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 50,527,669 - 50,607,208 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 50,527,699 - 50,607,871 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 148,071,811 - 148,151,429 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rras2
.
Predicted Target Of
Count of predictions: 677 Count of miRNA genes: 294 Interacting mature miRNAs: 361 Transcripts: ENSRNOT00000017199 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 737974 Bp161 Blood pressure QTL 161 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 164747558 181133855 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1582204 Livw1 Liver weight QTL 1 3.6 0.0003 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 1 155422851 172949803 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 631548 Bp88 Blood pressure QTL 88 5 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 156677124 176484451 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
D1Rat243
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 177,712,466 - 177,712,705 (+) Marker Load Pipeline mRatBN7.2 1 168,278,025 - 168,278,264 (+) MAPPER mRatBN7.2 Rnor_6.0 1 178,985,175 - 178,985,413 NCBI Rnor6.0 Rnor_5.0 1 185,953,368 - 185,953,606 UniSTS Rnor5.0 RGSC_v3.4 1 172,072,625 - 172,072,864 RGD RGSC3.4 RGSC_v3.4 1 172,072,626 - 172,072,864 UniSTS RGSC3.4 RGSC_v3.1 1 172,208,735 - 172,208,973 RGD Celera 1 166,130,565 - 166,130,803 UniSTS RH 3.4 Map 1 1316.29 RGD RH 3.4 Map 1 1316.29 UniSTS RH 2.0 Map 1 868.3 RGD SHRSP x BN Map 1 84.65 RGD FHH x ACI Map 1 81.06 RGD Cytogenetic Map 1 q34 UniSTS
C86394
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 168,233,945 - 168,234,027 (+) MAPPER mRatBN7.2 Rnor_6.0 1 178,940,768 - 178,940,849 NCBI Rnor6.0 Rnor_5.0 1 185,908,516 - 185,908,597 UniSTS Rnor5.0 RGSC_v3.4 1 172,026,515 - 172,026,596 UniSTS RGSC3.4 Celera 1 166,086,726 - 166,086,807 UniSTS Cytogenetic Map 1 q34 UniSTS
PMC140962P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 45,916,922 - 45,917,137 (+) MAPPER mRatBN7.2 mRatBN7.2 1 168,234,719 - 168,234,933 (+) MAPPER mRatBN7.2 Rnor_6.0 1 178,941,542 - 178,941,755 NCBI Rnor6.0 Rnor_6.0 10 47,514,096 - 47,514,310 NCBI Rnor6.0 Rnor_5.0 10 47,288,934 - 47,289,148 UniSTS Rnor5.0 Rnor_5.0 1 185,909,290 - 185,909,503 UniSTS Rnor5.0 RGSC_v3.4 1 172,027,289 - 172,027,502 UniSTS RGSC3.4 RGSC_v3.4 10 47,389,121 - 47,389,335 UniSTS RGSC3.4 Celera 10 45,170,319 - 45,170,533 UniSTS Celera 1 166,087,500 - 166,087,713 UniSTS Cytogenetic Map 1 q34 UniSTS Cytogenetic Map 10 q22 UniSTS
RH134521
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 168,234,569 - 168,234,749 (+) MAPPER mRatBN7.2 Rnor_6.0 1 178,941,392 - 178,941,571 NCBI Rnor6.0 Rnor_5.0 1 185,909,140 - 185,909,319 UniSTS Rnor5.0 RGSC_v3.4 1 172,027,139 - 172,027,318 UniSTS RGSC3.4 Celera 1 166,087,350 - 166,087,529 UniSTS RH 3.4 Map 1 1317.9 UniSTS Cytogenetic Map 1 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017199 ⟹ ENSRNOP00000017199
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 168,233,694 - 168,303,111 (-) Ensembl Rnor_6.0 Ensembl 1 178,940,516 - 179,010,257 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087771 ⟹ ENSRNOP00000073247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 178,941,894 - 178,955,352 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096467 ⟹ ENSRNOP00000081051
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 168,233,693 - 168,251,234 (-) Ensembl
RefSeq Acc Id:
NM_001013434 ⟹ NP_001013452
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 177,668,143 - 177,737,551 (-) NCBI mRatBN7.2 1 168,233,693 - 168,303,111 (-) NCBI Rnor_6.0 1 178,940,515 - 179,010,257 (-) NCBI Rnor_5.0 1 185,908,263 - 185,978,450 (-) NCBI RGSC_v3.4 1 172,026,262 - 172,097,710 (-) RGD Celera 1 166,086,473 - 166,155,650 (-) RGD
Sequence:
GCGGTGCTAGAGGCTGCGTTCGGCTGCGCTGCAGAGCCGCGAAGAGGATCGCGCTCCCTGGCCGCTGCGTCCTCTGCCCTGGAGCCTTCTCGGCTCTCCTGCGTCTCGGGCAACTCCCAACCAGTCCC
hide sequence
RefSeq Acc Id:
NP_001013452 ⟸ NM_001013434
- UniProtKB:
Q5BJU0 (UniProtKB/TrEMBL), F7ESH4 (UniProtKB/TrEMBL), A0A8I6G5F9 (UniProtKB/TrEMBL)
- Sequence:
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNK
hide sequence
Ensembl Acc Id:
ENSRNOP00000073247 ⟸ ENSRNOT00000087771
Ensembl Acc Id:
ENSRNOP00000017199 ⟸ ENSRNOT00000017199
Ensembl Acc Id:
ENSRNOP00000081051 ⟸ ENSRNOT00000096467
RGD ID: 13690327 Promoter ID: EPDNEW_R852 Type: multiple initiation site Name: Rras2_1 Description: RAS related 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 179,010,272 - 179,010,332 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-08-16
Rras2
RAS related 2
Rras2
related RAS viral (r-ras) oncogene homolog 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Rras2
related RAS viral (r-ras) oncogene homolog 2
Rras2_predicted
related RAS viral (r-ras) oncogene homolog 2 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Rras2_predicted
related RAS viral (r-ras) oncogene homolog 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
