Symbol:
Usp49
Name:
ubiquitin specific peptidase 49
RGD ID:
1310513
Description:
Predicted to enable histone binding activity and peptidase activity. Predicted to be involved in mRNA splicing, via spliceosome; negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; and protein deubiquitination. Predicted to be active in cytoplasm. Orthologous to human USP49 (ubiquitin specific peptidase 49); INTERACTS WITH (+)-schisandrin B; 6-propyl-2-thiouracil; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC316211; RGD1310513; similar to hypothetical protein MGC20741; ubiquitin carboxyl-terminal hydrolase 49; ubiquitin thioesterase 49
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 20,803,177 - 20,867,681 (-) NCBI GRCr8 mRatBN7.2 9 13,305,640 - 13,366,132 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 13,308,178 - 13,366,132 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 21,888,201 - 21,945,900 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 26,952,281 - 27,010,031 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 25,251,607 - 25,309,304 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 15,314,875 - 15,375,365 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 15,317,413 - 15,375,365 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 14,239,085 - 14,299,667 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 8,774,333 - 8,832,285 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 8,778,351 - 8,786,793 (-) NCBI Celera 9 11,060,638 - 11,117,551 (-) NCBI Celera Cytogenetic Map 9 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp49 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of USP49 mRNA] CTD PMID:31150632 Usp49 Rat 1,2-dimethylhydrazine decreases expression ISO Usp49 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP49 mRNA CTD PMID:22206623 Usp49 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Usp49 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Usp49 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Usp49 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Usp49 Rat 2-hydroxypropanoic acid increases expression ISO USP49 (Homo sapiens) 6480464 Lactic Acid results in increased expression of USP49 mRNA CTD PMID:30851411 Usp49 Rat 4,4'-sulfonyldiphenol decreases expression ISO Usp49 (Mus musculus) 6480464 bisphenol S results in decreased expression of USP49 mRNA CTD PMID:39298647 Usp49 Rat 4,4'-sulfonyldiphenol affects methylation ISO Usp49 (Mus musculus) 6480464 bisphenol S affects the methylation of USP49 gene CTD PMID:31683443 Usp49 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Usp49 (Mus musculus) 6480464 bisphenol S results in decreased methylation of USP49 exon CTD PMID:33297965 Usp49 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of USP49 mRNA CTD PMID:24780913 and PMID:25825206 Usp49 Rat all-trans-retinoic acid decreases expression ISO USP49 (Homo sapiens) 6480464 Tretinoin results in decreased expression of USP49 mRNA CTD PMID:21934132 Usp49 Rat aristolochic acid A increases expression ISO USP49 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of USP49 mRNA CTD PMID:33212167 Usp49 Rat beta-lapachone decreases expression ISO USP49 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of USP49 mRNA CTD PMID:38218311 Usp49 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP49 mRNA CTD PMID:25181051 Usp49 Rat bisphenol A decreases expression ISO Usp49 (Mus musculus) 6480464 bisphenol A results in decreased expression of USP49 mRNA CTD PMID:33221593 Usp49 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of USP49 mRNA CTD PMID:32479839 Usp49 Rat cadmium atom multiple interactions ISO USP49 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP49 mRNA CTD PMID:35301059 Usp49 Rat cadmium dichloride increases expression ISO USP49 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of USP49 mRNA CTD PMID:38568856 Usp49 Rat cadmium dichloride multiple interactions ISO USP49 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP49 mRNA CTD PMID:35301059 Usp49 Rat chlorpyrifos decreases expression ISO Usp49 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of USP49 mRNA CTD PMID:37019170 Usp49 Rat copper atom multiple interactions ISO USP49 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of USP49 mRNA CTD PMID:20971185 Usp49 Rat copper(0) multiple interactions ISO USP49 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of USP49 mRNA CTD PMID:20971185 Usp49 Rat Dibutyl phosphate affects expression ISO USP49 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP49 mRNA CTD PMID:37042841 Usp49 Rat dorsomorphin multiple interactions ISO USP49 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Usp49 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of USP49 mRNA CTD PMID:29391264 Usp49 Rat entinostat decreases expression ISO USP49 (Homo sapiens) 6480464 entinostat results in decreased expression of USP49 mRNA CTD PMID:26272509 Usp49 Rat ethyl methanesulfonate increases expression ISO USP49 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of USP49 mRNA CTD PMID:23649840 Usp49 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of USP49 mRNA CTD PMID:30307764 Usp49 Rat formaldehyde increases expression ISO USP49 (Homo sapiens) 6480464 Formaldehyde results in increased expression of USP49 mRNA CTD PMID:23649840 Usp49 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP49 mRNA CTD PMID:33387578 Usp49 Rat hydralazine multiple interactions ISO USP49 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of USP49 mRNA CTD PMID:17183730 Usp49 Rat hydrogen peroxide affects expression ISO USP49 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of USP49 mRNA CTD PMID:21179406 Usp49 Rat methyl methanesulfonate increases expression ISO USP49 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of USP49 mRNA CTD PMID:23649840 Usp49 Rat methylmercury chloride decreases expression ISO USP49 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of USP49 mRNA CTD PMID:28001369 Usp49 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of USP49 mRNA CTD PMID:28801915 Usp49 Rat ozone multiple interactions ISO Usp49 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of USP49 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of USP49 mRNA CTD PMID:34911549 Usp49 Rat panobinostat multiple interactions ISO USP49 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of USP49 mRNA CTD PMID:27188386 Usp49 Rat panobinostat decreases expression ISO USP49 (Homo sapiens) 6480464 panobinostat results in decreased expression of USP49 mRNA CTD PMID:26272509 Usp49 Rat paracetamol affects expression ISO Usp49 (Mus musculus) 6480464 Acetaminophen affects the expression of USP49 mRNA CTD PMID:17562736 Usp49 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of USP49 mRNA CTD PMID:33387578 Usp49 Rat PCB138 multiple interactions ISO Usp49 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Usp49 Rat pentanal decreases expression ISO USP49 (Homo sapiens) 6480464 pentanal results in decreased expression of USP49 mRNA CTD PMID:26079696 Usp49 Rat phenylmercury acetate decreases expression ISO USP49 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of USP49 mRNA CTD PMID:26272509 Usp49 Rat phenylmercury acetate multiple interactions ISO USP49 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of USP49 mRNA CTD PMID:27188386 Usp49 Rat pirinixic acid multiple interactions ISO USP49 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of USP49 mRNA CTD PMID:19710929 Usp49 Rat rac-lactic acid increases expression ISO USP49 (Homo sapiens) 6480464 Lactic Acid results in increased expression of USP49 mRNA CTD PMID:30851411 Usp49 Rat SB 431542 multiple interactions ISO USP49 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Usp49 Rat silicon dioxide increases expression ISO USP49 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of USP49 mRNA CTD PMID:23806026 Usp49 Rat Soman increases expression EXP 6480464 Soman results in increased expression of USP49 mRNA CTD PMID:19281266 Usp49 Rat sunitinib decreases expression ISO USP49 (Homo sapiens) 6480464 Sunitinib results in decreased expression of USP49 mRNA CTD PMID:31533062 Usp49 Rat temozolomide decreases expression ISO USP49 (Homo sapiens) 6480464 Temozolomide results in decreased expression of USP49 mRNA CTD PMID:31758290 Usp49 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of USP49 mRNA CTD PMID:31150632 Usp49 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of USP49 mRNA] CTD PMID:31150632 Usp49 Rat thimerosal decreases expression ISO USP49 (Homo sapiens) 6480464 Thimerosal results in decreased expression of USP49 mRNA CTD PMID:27188386 Usp49 Rat thiram increases expression ISO USP49 (Homo sapiens) 6480464 Thiram results in increased expression of USP49 mRNA CTD PMID:38568856 Usp49 Rat titanium dioxide increases methylation ISO Usp49 (Mus musculus) 6480464 titanium dioxide results in increased methylation of USP49 gene CTD PMID:35295148 Usp49 Rat titanium dioxide decreases methylation ISO Usp49 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP49 promoter CTD PMID:35295148 Usp49 Rat torcetrapib increases expression ISO USP49 (Homo sapiens) 6480464 torcetrapib results in increased expression of USP49 mRNA CTD PMID:23228038 Usp49 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of USP49 mRNA CTD PMID:33387578 Usp49 Rat trichostatin A decreases expression ISO USP49 (Homo sapiens) 6480464 trichostatin A results in decreased expression of USP49 mRNA CTD PMID:24935251 and PMID:26272509 Usp49 Rat trichostatin A affects expression ISO USP49 (Homo sapiens) 6480464 trichostatin A affects the expression of USP49 mRNA CTD PMID:28542535 Usp49 Rat trichostatin A multiple interactions ISO USP49 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of USP49 mRNA CTD PMID:27188386 Usp49 Rat triptonide increases expression ISO Usp49 (Mus musculus) 6480464 triptonide results in increased expression of USP49 mRNA CTD PMID:33045310 Usp49 Rat valproic acid multiple interactions ISO USP49 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of USP49 mRNA more ... CTD PMID:17183730 and PMID:27188386 Usp49 Rat valproic acid affects expression ISO Usp49 (Mus musculus) 6480464 Valproic Acid affects the expression of USP49 mRNA CTD PMID:17292431 Usp49 Rat valproic acid decreases expression ISO USP49 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of USP49 mRNA CTD PMID:23179753 more ... Usp49 Rat vorinostat decreases expression ISO USP49 (Homo sapiens) 6480464 vorinostat results in decreased expression of USP49 mRNA CTD PMID:26272509 and PMID:27188386
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) copper atom (ISO) copper(0) (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) endosulfan (EXP) entinostat (ISO) ethyl methanesulfonate (ISO) fenvalerate (EXP) formaldehyde (ISO) gentamycin (EXP) hydralazine (ISO) hydrogen peroxide (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (EXP) ozone (ISO) panobinostat (ISO) paracetamol (EXP,ISO) PCB138 (ISO) pentanal (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) rac-lactic acid (ISO) SB 431542 (ISO) silicon dioxide (ISO) Soman (EXP) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (EXP) thimerosal (ISO) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) trichloroethene (EXP) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO) vorinostat (ISO)
Usp49 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 20,803,177 - 20,867,681 (-) NCBI GRCr8 mRatBN7.2 9 13,305,640 - 13,366,132 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 13,308,178 - 13,366,132 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 21,888,201 - 21,945,900 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 26,952,281 - 27,010,031 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 25,251,607 - 25,309,304 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 15,314,875 - 15,375,365 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 15,317,413 - 15,375,365 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 14,239,085 - 14,299,667 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 8,774,333 - 8,832,285 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 8,778,351 - 8,786,793 (-) NCBI Celera 9 11,060,638 - 11,117,551 (-) NCBI Celera Cytogenetic Map 9 q12 NCBI
USP49 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 41,789,896 - 41,895,375 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 41,789,896 - 41,895,375 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 41,757,634 - 41,863,113 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 41,873,361 - 41,971,077 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 43,318,714 - 43,416,439 (-) NCBI Celera Cytogenetic Map 6 p21.1 NCBI HuRef 6 41,484,106 - 41,581,878 (-) NCBI HuRef CHM1_1 6 41,768,743 - 41,866,405 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 41,618,461 - 41,723,935 (-) NCBI T2T-CHM13v2.0
Usp49 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 47,941,615 - 47,997,664 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 47,941,615 - 47,997,663 (+) Ensembl GRCm39 Ensembl GRCm38 17 47,630,690 - 47,686,739 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 47,630,690 - 47,686,738 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 47,767,639 - 47,821,016 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 47,093,881 - 47,147,258 (+) NCBI MGSCv36 mm8 Celera 17 51,067,647 - 51,120,972 (+) NCBI Celera Cytogenetic Map 17 C NCBI cM Map 17 23.72 NCBI
Usp49 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 8,191,236 - 8,198,809 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 8,187,118 - 8,237,910 (-) NCBI ChiLan1.0 ChiLan1.0
USP49 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 56,282,907 - 56,389,693 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 52,152,885 - 52,256,921 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 41,375,083 - 41,479,143 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 42,678,680 - 42,781,748 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 42,683,149 - 42,695,707 (-) Ensembl panpan1.1 panPan2
USP49 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 10,474,873 - 10,556,900 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 10,479,733 - 10,577,918 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 10,504,358 - 10,589,769 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 10,955,129 - 11,041,174 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 10,955,164 - 11,051,627 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 10,485,701 - 10,567,699 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 10,569,381 - 10,654,952 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 10,663,097 - 10,748,867 (-) NCBI UU_Cfam_GSD_1.0
Usp49 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 45,957,669 - 46,049,495 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 17,991,688 - 18,000,794 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 17,946,875 - 18,002,081 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP49 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 36,981,383 - 37,052,568 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 36,978,291 - 37,054,027 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 42,393,547 - 42,458,617 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP49 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 30,265,322 - 30,373,547 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 30,356,698 - 30,366,940 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 41,783,918 - 41,895,090 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp49
.
Predicted Target Of
Count of predictions: 656 Count of miRNA genes: 293 Interacting mature miRNAs: 357 Transcripts: ENSRNOT00000018550 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 10054141 Gmadr4 Adrenal mass QTL 4 2.45 0.0074 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 9 1 14209783 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 61450 Ciaa3 CIA Autoantibody QTL 3 6.5 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 9 7954720 22071169 Rat 1578675 Bss17 Bone structure and strength QTL 17 3.8 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 9 3368652 13533896 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat 61425 Cia15 Collagen induced arthritis QTL 15 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 9 5109826 42921101 Rat 70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018550 ⟹ ENSRNOP00000018550
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 13,308,178 - 13,366,132 (-) Ensembl Rnor_6.0 Ensembl 9 15,317,413 - 15,375,365 (-) Ensembl
RefSeq Acc Id:
NM_001136470 ⟹ NP_001129942
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 20,805,715 - 20,863,667 (-) NCBI mRatBN7.2 9 13,308,178 - 13,366,132 (-) NCBI Rnor_6.0 9 15,317,413 - 15,375,365 (-) NCBI Rnor_5.0 9 14,239,085 - 14,299,667 (-) NCBI RGSC_v3.4 9 8,774,333 - 8,832,285 (-) RGD Celera 9 11,060,638 - 11,117,551 (-) RGD
Sequence:
CTTGCAAGGGAGCCTTTCTGTTTCAGAATGGACTTTATCCCTCTCGGAAGTCCTTGAGGCCACTGCCACCTAGGTCTGATTTATTTCCCAGTCCCTATTTGGGGAGCGATGAACCTTTTCTAGTCCCG
hide sequence
RefSeq Acc Id:
XM_006244435 ⟹ XP_006244497
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 20,803,177 - 20,826,448 (-) NCBI mRatBN7.2 9 13,305,640 - 13,323,918 (-) NCBI Rnor_6.0 9 15,314,875 - 15,333,131 (-) NCBI Rnor_5.0 9 14,239,085 - 14,299,667 (-) NCBI
Sequence:
CCTTGGTGCTGGGGTTAGAGGTGTGAGCTACCATGTCCAGATTAAGAAAGTGGCGACTGCGCTAAAACATGGATAGATGCAAACATGTAGGGCGGTTACGGCTCGCCCAGGATCACTCCATCCTGAAC
hide sequence
RefSeq Acc Id:
XM_017596410 ⟹ XP_017451899
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 20,803,177 - 20,863,303 (-) NCBI mRatBN7.2 9 13,305,640 - 13,365,484 (-) NCBI Rnor_6.0 9 15,314,875 - 15,374,664 (-) NCBI
Sequence:
GACGATAAGAGGCGTGGTCCGCCCGCTCGTCTCGCGCCCCGGTGACAGCTCGCGCGTGCTGATGATGGCGGTAACAGAGAAGAGGCAAACCAGCCAGTGATTATGTGAGAATATGGAAGACGATGGGA
hide sequence
RefSeq Acc Id:
XM_017596411 ⟹ XP_017451900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 20,803,177 - 20,862,630 (-) NCBI mRatBN7.2 9 13,305,640 - 13,365,041 (-) NCBI Rnor_6.0 9 15,314,875 - 15,374,185 (-) NCBI
Sequence:
AAGGCAGGCTGGGGCGGGGGTTTGCTATGAGATGAGGAGGATTAGGAGAGAAAGGGTTAGAAGCCGGAGAGAGGAGTGAGGAAGAAACCCAGGCTGGCCCGGGGATGAGGTTAGGAAGCCCGGGGCTA
hide sequence
RefSeq Acc Id:
XM_039083485 ⟹ XP_038939413
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 20,803,177 - 20,862,751 (-) NCBI mRatBN7.2 9 13,305,640 - 13,365,194 (-) NCBI
RefSeq Acc Id:
XM_063267083 ⟹ XP_063123153
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 20,803,177 - 20,867,681 (-) NCBI
RefSeq Acc Id:
NP_001129942 ⟸ NM_001136470
- UniProtKB:
D3ZJ49 (UniProtKB/TrEMBL)
- Sequence:
MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESAWACLKCSHVACGRYIEDHALKHFEETGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDLPARRGRTLRSTAAGEDVVP
hide sequence
RefSeq Acc Id:
XP_006244497 ⟸ XM_006244435
- Peptide Label:
isoform X1
- UniProtKB:
D3ZJ49 (UniProtKB/TrEMBL)
- Sequence:
MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESAWACLKCSHVACGRYIEDHALKHFEETGHP
hide sequence
RefSeq Acc Id:
XP_017451899 ⟸ XM_017596410
- Peptide Label:
isoform X1
- UniProtKB:
D3ZJ49 (UniProtKB/TrEMBL)
- Sequence:
MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESAWACLKCSHVACGRYIEDHALKHFEETGHPLAMEVRDLYVFCYLCKDYVLNDNPEGDLKLLRSSLLAVRGQKQDLPARRGRTLRSTAAGEDVVP
hide sequence
RefSeq Acc Id:
XP_017451900 ⟸ XM_017596411
- Peptide Label:
isoform X1
- UniProtKB:
D3ZJ49 (UniProtKB/TrEMBL)
- Sequence:
MDRCKHVGRLRLAQDHSILNPQKWCCLECATTESAWACLKCSHVACGRYIEDHALKHFEETGHP
hide sequence
Ensembl Acc Id:
ENSRNOP00000018550 ⟸ ENSRNOT00000018550
RefSeq Acc Id:
XP_038939413 ⟸ XM_039083485
- Peptide Label:
isoform X1
- UniProtKB:
D3ZJ49 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123153 ⟸ XM_063267083
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Usp49
ubiquitin specific peptidase 49
Usp49_predicted
ubiquitin specific peptidase 49 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Usp49_predicted
ubiquitin specific peptidase 49 (predicted)
RGD1310513_predicted
similar to hypothetical protein MGC20741 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1310513_predicted
similar to hypothetical protein MGC20741 (predicted)
LOC316211_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC316211_predicted
similar to hypothetical protein MGC20741 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
