Symbol:
Pik3c2a
Name:
phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha
RGD ID:
1310389
Description:
Predicted to enable clathrin binding activity and phosphatidylinositol kinase activity. Predicted to be involved in several processes, including intracellular signal transduction; phosphatidylinositol-3-phosphate biosynthetic process; and positive regulation of cell migration involved in sprouting angiogenesis. Predicted to act upstream of or within autophagosome organization; cellular response to starvation; and negative regulation of zinc ion transmembrane transport. Predicted to be located in several cellular components, including clathrin-coated vesicle; nucleoplasm; and trans-Golgi network. Predicted to be active in cytoplasm and plasma membrane. Orthologous to human PIK3C2A (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha); PARTICIPATES IN phosphoinositide metabolic pathway; inositol phosphate metabolic pathway; phosphatidylinositol 3-kinase signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; DDT.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC361632; phosphatidylinositol 3-kinase, C2 domain containing, alpha polypeptide; phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha; phosphoinositide-3-kinase, class 2 alpha polypeptide; phosphoinositide-3-kinase, class 2, alpha polypeptide
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PIK3C2A (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pik3c2a (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pik3c2a (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PIK3C2A (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PIK3C2A (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pik3c2a (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PIK3C2A (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PIK3C2A (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pik3c2a (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GOSR1 (golgi SNAP receptor complex member 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PIK3C2A (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pik3c2a (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pik3c2a (phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
piki-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pi3K68D
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pik3c2a
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 180,012,248 - 180,117,786 (-) NCBI GRCr8 mRatBN7.2 1 170,577,942 - 170,684,353 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 170,577,942 - 170,683,472 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 178,895,808 - 179,001,695 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 186,082,327 - 186,188,218 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 178,795,249 - 178,900,740 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 185,210,922 - 185,326,314 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 185,210,922 - 185,326,314 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 192,182,647 - 192,297,034 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 174,430,831 - 174,537,706 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 174,572,538 - 174,676,951 (-) NCBI Celera 1 168,399,225 - 168,504,593 (-) NCBI Celera Cytogenetic Map 1 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pik3c2a Rat (-)-demecolcine increases expression ISO PIK3C2A (Homo sapiens) 6480464 Demecolcine results in increased expression of PIK3C2A mRNA CTD PMID:23649840 Pik3c2a Rat (1->4)-beta-D-glucan multiple interactions ISO Pik3c2a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PIK3C2A mRNA CTD PMID:36331819 Pik3c2a Rat 1,2-dimethylhydrazine increases expression ISO Pik3c2a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PIK3C2A mRNA CTD PMID:22206623 Pik3c2a Rat 1-nitropyrene increases expression ISO PIK3C2A (Homo sapiens) 6480464 1-nitropyrene results in increased expression of PIK3C2A mRNA CTD PMID:19041380 Pik3c2a Rat 17alpha-ethynylestradiol increases expression ISO Pik3c2a (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PIK3C2A mRNA CTD PMID:17942748 Pik3c2a Rat 17alpha-ethynylestradiol multiple interactions ISO Pik3c2a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PIK3C2A mRNA CTD PMID:17942748 Pik3c2a Rat 17beta-estradiol decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Estradiol results in decreased expression of PIK3C2A mRNA CTD PMID:19167446 Pik3c2a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pik3c2a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PIK3C2A mRNA and AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of PIK3C2A mRNA] CTD PMID:15034205 and PMID:17942748 Pik3c2a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PIK3C2A mRNA CTD PMID:34747641 Pik3c2a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3C2A mRNA CTD PMID:32109520 and PMID:33387578 Pik3c2a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pik3c2a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PIK3C2A mRNA CTD PMID:15034205 Pik3c2a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pik3c2a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PIK3C2A mRNA CTD PMID:21570461 Pik3c2a Rat 2,4-dinitrobenzenesulfonic acid decreases expression ISO Pik3c2a (Mus musculus) 6480464 2 and 4-dinitrobenzenesulfonic acid results in decreased expression of PIK3C2A mRNA CTD PMID:30116771 Pik3c2a Rat 2-hydroxypropanoic acid decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PIK3C2A mRNA CTD PMID:30851411 Pik3c2a Rat 4,4'-sulfonyldiphenol decreases expression ISO Pik3c2a (Mus musculus) 6480464 bisphenol S results in decreased expression of PIK3C2A mRNA CTD PMID:39298647 Pik3c2a Rat 4-hydroxyphenyl retinamide increases expression ISO Pik3c2a (Mus musculus) 6480464 Fenretinide results in increased expression of PIK3C2A mRNA CTD PMID:28973697 Pik3c2a Rat 4-vinylcyclohexene dioxide affects expression ISO Pik3c2a (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of PIK3C2A mRNA CTD PMID:20829426 Pik3c2a Rat 5-aza-2'-deoxycytidine multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of PIK3C2A mRNA] CTD PMID:21095227 Pik3c2a Rat acetylsalicylic acid decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Aspirin results in decreased expression of PIK3C2A mRNA CTD PMID:11906190 Pik3c2a Rat aflatoxin B1 increases expression ISO Pik3c2a (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of PIK3C2A mRNA CTD PMID:19770486 Pik3c2a Rat aflatoxin B1 increases methylation ISO PIK3C2A (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PIK3C2A intron CTD PMID:30157460 Pik3c2a Rat aflatoxin M1 decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of PIK3C2A mRNA CTD PMID:30928695 Pik3c2a Rat aristolochic acid A decreases expression ISO PIK3C2A (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PIK3C2A mRNA CTD PMID:33212167 Pik3c2a Rat arsenite(3-) increases expression ISO Pik3c2a (Mus musculus) 6480464 arsenite results in increased expression of PIK3C2A protein CTD PMID:37955338 Pik3c2a Rat arsenite(3-) multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PIK3C2A mRNA] CTD PMID:32406909 Pik3c2a Rat atrazine increases expression ISO PIK3C2A (Homo sapiens) 6480464 Atrazine results in increased expression of PIK3C2A mRNA CTD PMID:18585445 Pik3c2a Rat avobenzone increases expression ISO PIK3C2A (Homo sapiens) 6480464 avobenzone results in increased expression of PIK3C2A mRNA CTD PMID:31016361 Pik3c2a Rat benzo[a]pyrene multiple interactions ISO Pik3c2a (Mus musculus) 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in decreased expression of PIK3C2A mRNA] CTD PMID:15034205 Pik3c2a Rat benzo[a]pyrene affects methylation ISO PIK3C2A (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PIK3C2A intron CTD PMID:30157460 Pik3c2a Rat benzo[a]pyrene decreases expression ISO Pik3c2a (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PIK3C2A mRNA CTD PMID:15034205 Pik3c2a Rat benzo[a]pyrene diol epoxide I decreases expression ISO PIK3C2A (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Pik3c2a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PIK3C2A mRNA CTD PMID:25181051 and PMID:30816183 Pik3c2a Rat bisphenol A increases expression ISO Pik3c2a (Mus musculus) 6480464 bisphenol A results in increased expression of PIK3C2A mRNA CTD PMID:35598803 Pik3c2a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PIK3C2A mRNA CTD PMID:33296240 Pik3c2a Rat bisphenol F increases expression ISO Pik3c2a (Mus musculus) 6480464 bisphenol F results in increased expression of PIK3C2A mRNA CTD PMID:38685157 Pik3c2a Rat butanal increases methylation ISO PIK3C2A (Homo sapiens) 6480464 butyraldehyde results in increased methylation of PIK3C2A gene CTD PMID:30002397 Pik3c2a Rat cadmium dichloride decreases expression ISO Pik3c2a (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of PIK3C2A mRNA CTD PMID:24982889 Pik3c2a Rat cadmium dichloride increases expression ISO PIK3C2A (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PIK3C2A mRNA CTD PMID:26472689 Pik3c2a Rat caffeine decreases phosphorylation ISO PIK3C2A (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PIK3C2A protein CTD PMID:35688186 Pik3c2a Rat carbamazepine affects expression ISO PIK3C2A (Homo sapiens) 6480464 Carbamazepine affects the expression of PIK3C2A mRNA CTD PMID:24752500 Pik3c2a Rat celastrol increases expression ISO PIK3C2A (Homo sapiens) 6480464 celastrol results in increased expression of PIK3C2A mRNA CTD PMID:39181414 Pik3c2a Rat chenodeoxycholic acid multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of PIK3C2A mRNA more ... CTD PMID:33819548 Pik3c2a Rat chlorpyrifos decreases expression ISO Pik3c2a (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PIK3C2A mRNA CTD PMID:37019170 Pik3c2a Rat clorgyline increases expression ISO PIK3C2A (Homo sapiens) 6480464 Clorgyline results in increased expression of PIK3C2A mRNA CTD PMID:19691856 Pik3c2a Rat cobalt dichloride decreases expression ISO PIK3C2A (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PIK3C2A mRNA CTD PMID:19320972 Pik3c2a Rat copper(II) sulfate increases expression ISO PIK3C2A (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PIK3C2A mRNA CTD PMID:19549813 Pik3c2a Rat coumestrol decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Coumestrol results in decreased expression of PIK3C2A mRNA CTD PMID:19167446 Pik3c2a Rat crocidolite asbestos decreases expression ISO Pik3c2a (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of PIK3C2A mRNA CTD PMID:29279043 Pik3c2a Rat curcumin decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Curcumin analog results in decreased expression of PIK3C2A mRNA CTD PMID:26409325 Pik3c2a Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of PIK3C2A mRNA CTD PMID:30207508 Pik3c2a Rat deoxycholic acid multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of PIK3C2A mRNA more ... CTD PMID:33819548 Pik3c2a Rat Dibutyl phosphate affects expression ISO PIK3C2A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PIK3C2A mRNA CTD PMID:37042841 Pik3c2a Rat diclofenac affects expression ISO PIK3C2A (Homo sapiens) 6480464 Diclofenac affects the expression of PIK3C2A mRNA CTD PMID:24752500 Pik3c2a Rat dioxygen multiple interactions ISO Pik3c2a (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of PIK3C2A mRNA CTD PMID:30529165 Pik3c2a Rat dorsomorphin multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PIK3C2A mRNA CTD PMID:27188386 Pik3c2a Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PIK3C2A mRNA CTD PMID:29391264 Pik3c2a Rat ethanol affects expression ISO Pik3c2a (Mus musculus) 6480464 Ethanol affects the expression of PIK3C2A mRNA CTD PMID:30319688 Pik3c2a Rat formaldehyde decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PIK3C2A mRNA CTD PMID:20655997 Pik3c2a Rat FR900359 affects phosphorylation ISO PIK3C2A (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PIK3C2A protein CTD PMID:37730182 Pik3c2a Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PIK3C2A mRNA CTD PMID:33387578 Pik3c2a Rat glycochenodeoxycholic acid multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of PIK3C2A mRNA more ... CTD PMID:33819548 Pik3c2a Rat glycocholic acid multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of PIK3C2A mRNA more ... CTD PMID:33819548 Pik3c2a Rat glycodeoxycholic acid multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of PIK3C2A mRNA more ... CTD PMID:33819548 Pik3c2a Rat heptanal increases methylation ISO PIK3C2A (Homo sapiens) 6480464 heptanal results in increased methylation of PIK3C2A gene CTD PMID:30002397 Pik3c2a Rat hexadecanoic acid multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid] affects the expression of PIK3C2A mRNA CTD PMID:30547786 Pik3c2a Rat hexanal increases methylation ISO PIK3C2A (Homo sapiens) 6480464 n-hexanal results in increased methylation of PIK3C2A gene CTD PMID:30002397 Pik3c2a Rat hypochlorous acid increases expression ISO Pik3c2a (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of PIK3C2A mRNA CTD PMID:19376150 Pik3c2a Rat inulin multiple interactions ISO Pik3c2a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PIK3C2A mRNA CTD PMID:36331819 Pik3c2a Rat isoflavones increases expression ISO PIK3C2A (Homo sapiens) 6480464 Isoflavones results in increased expression of PIK3C2A mRNA CTD PMID:17374662 Pik3c2a Rat methidathion decreases expression ISO Pik3c2a (Mus musculus) 6480464 methidathion results in decreased expression of PIK3C2A mRNA CTD PMID:34813904 Pik3c2a Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PIK3C2A gene CTD PMID:35440735 Pik3c2a Rat nonanal increases methylation ISO PIK3C2A (Homo sapiens) 6480464 nonanal results in increased methylation of PIK3C2A gene CTD PMID:30002397 Pik3c2a Rat octanal increases methylation ISO PIK3C2A (Homo sapiens) 6480464 caprylic aldehyde results in increased methylation of PIK3C2A gene CTD PMID:30002397 Pik3c2a Rat oleic acid multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Palmitic Acid co-treated with Oleic Acid] affects the expression of PIK3C2A mRNA CTD PMID:30547786 Pik3c2a Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PIK3C2A mRNA CTD PMID:25729387 Pik3c2a Rat p-chloromercuribenzoic acid increases expression ISO PIK3C2A (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of PIK3C2A mRNA CTD PMID:26272509 Pik3c2a Rat paclitaxel affects response to substance ISO PIK3C2A (Homo sapiens) 6480464 PIK3C2A protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Pik3c2a Rat paracetamol affects expression ISO Pik3c2a (Mus musculus) 6480464 Acetaminophen affects the expression of PIK3C2A mRNA CTD PMID:17562736 Pik3c2a Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PIK3C2A mRNA CTD PMID:33387578 Pik3c2a Rat paracetamol multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PIK3C2A mRNA CTD PMID:33819548 Pik3c2a Rat paracetamol increases expression ISO PIK3C2A (Homo sapiens) 6480464 Acetaminophen results in increased expression of PIK3C2A mRNA CTD PMID:21420995 Pik3c2a Rat pentanal increases methylation ISO PIK3C2A (Homo sapiens) 6480464 pentanal results in increased methylation of PIK3C2A gene CTD PMID:30002397 Pik3c2a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pik3c2a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of PIK3C2A mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PIK3C2A mRNA CTD PMID:36331819 Pik3c2a Rat perfluorooctanoic acid increases expression ISO PIK3C2A (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of PIK3C2A mRNA CTD PMID:23978341 Pik3c2a Rat phenylmercury acetate multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PIK3C2A mRNA CTD PMID:27188386 Pik3c2a Rat phlorizin decreases expression ISO Pik3c2a (Mus musculus) 6480464 Phlorhizin results in decreased expression of PIK3C2A mRNA CTD PMID:22538082 Pik3c2a Rat propanal increases methylation ISO PIK3C2A (Homo sapiens) 6480464 propionaldehyde results in increased methylation of PIK3C2A gene CTD PMID:30002397 Pik3c2a Rat quercitrin affects expression ISO PIK3C2A (Homo sapiens) 6480464 quercitrin affects the expression of PIK3C2A mRNA CTD PMID:25193878 Pik3c2a Rat rac-lactic acid decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PIK3C2A mRNA CTD PMID:30851411 Pik3c2a Rat SB 431542 multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PIK3C2A mRNA CTD PMID:27188386 Pik3c2a Rat silver atom decreases expression ISO Pik3c2a (Mus musculus) 6480464 Silver results in decreased expression of PIK3C2A mRNA CTD PMID:27131904 Pik3c2a Rat silver(0) decreases expression ISO Pik3c2a (Mus musculus) 6480464 Silver results in decreased expression of PIK3C2A mRNA CTD PMID:27131904 Pik3c2a Rat sodium arsenate increases expression ISO Pik3c2a (Mus musculus) 6480464 sodium arsenate results in increased expression of PIK3C2A mRNA CTD PMID:21795629 Pik3c2a Rat sodium arsenite increases expression ISO PIK3C2A (Homo sapiens) 6480464 sodium arsenite results in increased expression of PIK3C2A mRNA CTD PMID:38568856 Pik3c2a Rat sorafenib decreases expression ISO PIK3C2A (Homo sapiens) 6480464 sorafenib results in decreased expression of PIK3C2A mRNA CTD PMID:26409325 Pik3c2a Rat sulforaphane multiple interactions ISO Pik3c2a (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of PIK3C2A mRNA CTD PMID:30529165 Pik3c2a Rat sunitinib increases expression ISO PIK3C2A (Homo sapiens) 6480464 Sunitinib results in increased expression of PIK3C2A mRNA CTD PMID:31533062 Pik3c2a Rat Sunset Yellow FCF multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of PIK3C2A mRNA CTD PMID:33819548 Pik3c2a Rat tamoxifen affects expression ISO Pik3c2a (Mus musculus) 6480464 Tamoxifen affects the expression of PIK3C2A mRNA CTD PMID:20937368 Pik3c2a Rat tartrazine multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of PIK3C2A mRNA CTD PMID:33819548 Pik3c2a Rat tetracycline increases expression ISO Pik3c2a (Mus musculus) 6480464 Tetracycline results in increased expression of PIK3C2A mRNA CTD PMID:16917069 Pik3c2a Rat thimerosal increases expression ISO PIK3C2A (Homo sapiens) 6480464 Thimerosal results in increased expression of PIK3C2A mRNA CTD PMID:27188386 Pik3c2a Rat titanium dioxide decreases methylation ISO Pik3c2a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PIK3C2A promoter CTD PMID:35295148 Pik3c2a Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PIK3C2A mRNA CTD PMID:25729387 Pik3c2a Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PIK3C2A mRNA CTD PMID:33387578 Pik3c2a Rat trichostatin A increases expression ISO PIK3C2A (Homo sapiens) 6480464 trichostatin A results in increased expression of PIK3C2A mRNA CTD PMID:24935251 more ... Pik3c2a Rat triclosan multiple interactions ISO PIK3C2A (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Triclosan] results in decreased expression of PIK3C2A mRNA CTD PMID:33819548 Pik3c2a Rat triphenyl phosphate affects expression ISO PIK3C2A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PIK3C2A mRNA CTD PMID:37042841 Pik3c2a Rat triptonide increases expression ISO Pik3c2a (Mus musculus) 6480464 triptonide results in increased expression of PIK3C2A mRNA CTD PMID:33045310 Pik3c2a Rat valproic acid decreases expression ISO PIK3C2A (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PIK3C2A mRNA CTD PMID:23179753 Pik3c2a Rat valproic acid increases expression ISO PIK3C2A (Homo sapiens) 6480464 Valproic Acid results in increased expression of PIK3C2A mRNA CTD PMID:26705709 and PMID:29154799 Pik3c2a Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of PIK3C2A mRNA CTD PMID:19015723 Pik3c2a Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PIK3C2A gene CTD PMID:31682807 Pik3c2a Rat vincristine increases expression ISO PIK3C2A (Homo sapiens) 6480464 Vincristine results in increased expression of PIK3C2A mRNA CTD PMID:23649840 Pik3c2a Rat zinc atom increases expression ISO PIK3C2A (Homo sapiens) 6480464 Zinc results in increased expression of PIK3C2A mRNA CTD PMID:19071009 Pik3c2a Rat zinc(0) increases expression ISO PIK3C2A (Homo sapiens) 6480464 Zinc results in increased expression of PIK3C2A mRNA CTD PMID:19071009 Pik3c2a Rat zoledronic acid increases expression ISO PIK3C2A (Homo sapiens) 6480464 zoledronic acid results in increased expression of PIK3C2A mRNA CTD PMID:20977926
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Pik3c2a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 180,012,248 - 180,117,786 (-) NCBI GRCr8 mRatBN7.2 1 170,577,942 - 170,684,353 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 170,577,942 - 170,683,472 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 178,895,808 - 179,001,695 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 186,082,327 - 186,188,218 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 178,795,249 - 178,900,740 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 185,210,922 - 185,326,314 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 185,210,922 - 185,326,314 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 192,182,647 - 192,297,034 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 174,430,831 - 174,537,706 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 174,572,538 - 174,676,951 (-) NCBI Celera 1 168,399,225 - 168,504,593 (-) NCBI Celera Cytogenetic Map 1 q35 NCBI
PIK3C2A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 17,086,575 - 17,207,986 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 17,077,730 - 17,207,986 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 17,108,122 - 17,229,533 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 17,064,698 - 17,147,930 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 17,067,860 - 17,147,864 NCBI Celera 11 17,236,314 - 17,320,701 (-) NCBI Celera Cytogenetic Map 11 p15.1 NCBI HuRef 11 16,791,536 - 16,875,065 (-) NCBI HuRef CHM1_1 11 17,107,728 - 17,190,971 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 17,184,463 - 17,305,651 (-) NCBI T2T-CHM13v2.0
Pik3c2a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 115,936,500 - 116,042,693 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 115,936,500 - 116,042,684 (-) Ensembl GRCm39 Ensembl GRCm38 7 116,337,265 - 116,443,465 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 116,337,265 - 116,443,449 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 123,480,790 - 123,586,972 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 116,130,710 - 116,209,201 (-) NCBI MGSCv36 mm8 Celera 7 116,275,791 - 116,376,830 (-) NCBI Celera Cytogenetic Map 7 F1 NCBI cM Map 7 61.62 NCBI
Pik3c2a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 31,896,161 - 31,999,730 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 31,896,161 - 31,999,730 (-) NCBI ChiLan1.0 ChiLan1.0
PIK3C2A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 19,421,635 - 19,542,611 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 19,382,544 - 19,503,423 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 17,143,024 - 17,263,920 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 16,828,959 - 16,949,891 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 16,828,966 - 16,949,856 (-) Ensembl panpan1.1 panPan2
PIK3C2A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 39,693,211 - 39,868,603 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 39,695,520 - 39,784,639 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 39,193,753 - 39,309,848 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 40,798,394 - 40,914,802 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 40,799,161 - 40,914,780 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 39,813,119 - 39,927,798 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 40,018,167 - 40,133,971 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 40,357,482 - 40,473,688 (-) NCBI UU_Cfam_GSD_1.0
Pik3c2a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 45,811,389 - 45,932,425 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936528 1,869,527 - 1,964,183 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936528 1,845,372 - 1,964,908 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PIK3C2A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 41,829,916 - 42,024,362 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 41,829,969 - 42,024,062 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 44,958,962 - 45,079,401 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PIK3C2A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 47,759,850 - 47,874,458 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 47,795,954 - 47,877,028 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 145,200,659 - 145,318,077 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pik3c2a
.
Predicted Target Of
Count of predictions: 548 Count of miRNA genes: 272 Interacting mature miRNAs: 346 Transcripts: ENSRNOT00000055120 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 737974 Bp161 Blood pressure QTL 161 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 164747558 181133855 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 619614 Bp78 Blood pressure QTL 78 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 169112897 197261052 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1582204 Livw1 Liver weight QTL 1 3.6 0.0003 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 1 155422851 172949803 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 631548 Bp88 Blood pressure QTL 88 5 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 156677124 176484451 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
RH136965
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 170,578,275 - 170,578,459 (-) MAPPER mRatBN7.2 Rnor_6.0 1 185,325,797 - 185,325,980 NCBI Rnor6.0 Rnor_5.0 1 192,296,517 - 192,296,700 UniSTS Rnor5.0 RGSC_v3.4 1 174,431,165 - 174,431,348 UniSTS RGSC3.4 Celera 1 168,399,559 - 168,399,742 UniSTS RH 3.4 Map 1 1562.2 UniSTS Cytogenetic Map 1 q34-q35 UniSTS
RH140296
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 170,611,306 - 170,611,490 (-) MAPPER mRatBN7.2 Rnor_6.0 1 185,292,766 - 185,292,949 NCBI Rnor6.0 Rnor_5.0 1 192,263,486 - 192,263,669 UniSTS Rnor5.0 RGSC_v3.4 1 174,464,196 - 174,464,379 UniSTS RGSC3.4 Celera 1 168,432,590 - 168,432,773 UniSTS Cytogenetic Map 1 q34-q35 UniSTS
AI236381
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 170,598,205 - 170,598,421 (-) MAPPER mRatBN7.2 Rnor_6.0 1 185,305,835 - 185,306,050 NCBI Rnor6.0 Rnor_5.0 1 192,276,555 - 192,276,770 UniSTS Rnor5.0 RGSC_v3.4 1 174,451,095 - 174,451,310 UniSTS RGSC3.4 Celera 1 168,419,489 - 168,419,704 UniSTS Cytogenetic Map 1 q34-q35 UniSTS
BM387076
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 170,580,147 - 170,580,355 (-) MAPPER mRatBN7.2 Rnor_6.0 1 185,323,901 - 185,324,108 NCBI Rnor6.0 Rnor_5.0 1 192,294,621 - 192,294,828 UniSTS Rnor5.0 RGSC_v3.4 1 174,433,037 - 174,433,244 UniSTS RGSC3.4 Celera 1 168,401,431 - 168,401,638 UniSTS RH 3.4 Map 1 1562.91 UniSTS Cytogenetic Map 1 q34-q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000055120 ⟹ ENSRNOP00000051993
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 170,577,942 - 170,683,472 (-) Ensembl Rnor_6.0 Ensembl 1 185,210,922 - 185,326,314 (+) Ensembl
RefSeq Acc Id:
NM_001108500 ⟹ NP_001101970
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 180,012,248 - 180,117,773 (-) NCBI mRatBN7.2 1 170,577,942 - 170,683,472 (-) NCBI Rnor_6.0 1 185,210,922 - 185,326,314 (+) NCBI Rnor_5.0 1 192,182,647 - 192,297,034 (+) NCBI RGSC_v3.4 1 174,430,831 - 174,537,706 (-) RGD Celera 1 168,399,225 - 168,504,593 (-) RGD
Sequence:
GTACAGTGCTCGGCTGGCCGCGGAGTCAGTCGAAGCTCTCCTCAGCGGCCGGCTGAGCCAGCTGAGGCGGGAGAAAAACATGGCTCGGACCTTTGAGGGCGCGAAGGCTTGGGTTGCGGTGGAGACTG
hide sequence
RefSeq Acc Id:
XM_039082801 ⟹ XP_038938729
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 180,028,140 - 180,117,786 (-) NCBI mRatBN7.2 1 170,594,837 - 170,684,353 (-) NCBI
RefSeq Acc Id:
XM_063267503 ⟹ XP_063123573
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 180,012,428 - 180,117,786 (-) NCBI
RefSeq Acc Id:
XM_063267507 ⟹ XP_063123577
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 180,012,428 - 180,117,786 (-) NCBI
RefSeq Acc Id:
XM_063267510 ⟹ XP_063123580
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 180,012,428 - 180,094,274 (-) NCBI
RefSeq Acc Id:
XM_063267512 ⟹ XP_063123582
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 180,012,428 - 180,066,552 (-) NCBI
RefSeq Acc Id:
NP_001101970 ⟸ NM_001108500
- UniProtKB:
D3ZTF6 (UniProtKB/TrEMBL), A6I8E5 (UniProtKB/TrEMBL)
- Sequence:
MAQISNNSEFKQCSSSHPEPIRTKDVDKAEALQMEAEALAKLQKDRHMTDSPRGFELSNSTRQRTQGFNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKILLDDNFETRKTPASPVTPVLSPSFS
hide sequence
Ensembl Acc Id:
ENSRNOP00000051993 ⟸ ENSRNOT00000055120
RefSeq Acc Id:
XP_038938729 ⟸ XM_039082801
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063123577 ⟸ XM_063267507
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063123573 ⟸ XM_063267503
- Peptide Label:
isoform X1
- UniProtKB:
A6I8E5 (UniProtKB/TrEMBL), D3ZTF6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123580 ⟸ XM_063267510
- Peptide Label:
isoform X3
- UniProtKB:
A6I8E7 (UniProtKB/TrEMBL), A6I8E6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063123582 ⟸ XM_063267512
- Peptide Label:
isoform X4
- UniProtKB:
A6I8E6 (UniProtKB/TrEMBL)
RGD ID: 13690335 Promoter ID: EPDNEW_R860 Type: initiation region Name: Pik3c2a_1 Description: phosphatidylinositol-4-phosphate 3-kinase, catalytic subunittype 2 alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 185,210,949 - 185,211,009 EPDNEW
BioCyc Gene G2FUF-57715 BioCyc
Ensembl Genes ENSRNOG00000020479 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000055120 ENTREZGENE
ENSRNOT00000055120.3 UniProtKB/TrEMBL
Gene3D-CATH 1.10.1070.11 UniProtKB/TrEMBL
1.25.40.70 UniProtKB/TrEMBL
2.60.40.150 UniProtKB/TrEMBL
3.30.1520.10 UniProtKB/TrEMBL
Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1 UniProtKB/TrEMBL
Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 4 UniProtKB/TrEMBL
InterPro ARM-type_fold UniProtKB/TrEMBL
C2_Ca-dep UniProtKB/TrEMBL
C2_domain_sf UniProtKB/TrEMBL
IPR001683 UniProtKB/TrEMBL
Kinase-like_dom UniProtKB/TrEMBL
PI3/4_kinase_cat UniProtKB/TrEMBL
PI3/4_kinase_cat_sf UniProtKB/TrEMBL
PI3/4_kinase_CS UniProtKB/TrEMBL
PI3K-C2-alpha_dom UniProtKB/TrEMBL
PI3K_accessory_sf UniProtKB/TrEMBL
PI3K_C2 UniProtKB/TrEMBL
PI3K_ras-bd UniProtKB/TrEMBL
PI_Kinase UniProtKB/TrEMBL
PInositide-3_kin_accessory_dom UniProtKB/TrEMBL
PX_dom_sf UniProtKB/TrEMBL
PX_PI3K_C2_alpha UniProtKB/TrEMBL
Ubiquitin-rel_dom UniProtKB/TrEMBL
KEGG Report rno:361632 UniProtKB/TrEMBL
NCBI Gene 361632 ENTREZGENE
PANTHER PHOSPHATIDYLINOSITOL 4-PHOSPHATE 3-KINASE C2 DOMAIN-CONTAINING SUBUNIT ALPHA UniProtKB/TrEMBL
PI_Kinase UniProtKB/TrEMBL
Pfam PF00168 UniProtKB/TrEMBL
PF00787 UniProtKB/TrEMBL
PI3_PI4_kinase UniProtKB/TrEMBL
PI3K_C2 UniProtKB/TrEMBL
PI3K_rbd UniProtKB/TrEMBL
PI3Ka UniProtKB/TrEMBL
PhenoGen Pik3c2a PhenoGen
PROSITE PI3_4_KINASE_1 UniProtKB/TrEMBL
PI3_4_KINASE_2 UniProtKB/TrEMBL
PI3_4_KINASE_3 UniProtKB/TrEMBL
PI3K_C2 UniProtKB/TrEMBL
PI3K_RBD UniProtKB/TrEMBL
PIK_HELICAL UniProtKB/TrEMBL
PS50004 UniProtKB/TrEMBL
PS50195 UniProtKB/TrEMBL
RatGTEx ENSRNOG00000020479 RatGTEx
SMART PI3K_C2 UniProtKB/TrEMBL
PI3K_rbd UniProtKB/TrEMBL
PI3Ka UniProtKB/TrEMBL
PI3Kc UniProtKB/TrEMBL
SM00239 UniProtKB/TrEMBL
SM00312 UniProtKB/TrEMBL
Superfamily-SCOP 64268 UniProtKB/TrEMBL
ARM-type_fold UniProtKB/TrEMBL
Kinase_like UniProtKB/TrEMBL
SSF49562 UniProtKB/TrEMBL
SSF54236 UniProtKB/TrEMBL
UniProt A6I8E5 ENTREZGENE, UniProtKB/TrEMBL
A6I8E6 ENTREZGENE, UniProtKB/TrEMBL
A6I8E7 ENTREZGENE, UniProtKB/TrEMBL
D3ZTF6 ENTREZGENE, UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-10
Pik3c2a
phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha
Pik3c2a
phosphoinositide-3-kinase, class 2, alpha polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-09
Pik3c2a
phosphoinositide-3-kinase, class 2, alpha polypeptide
Pik3c2a
phosphatidylinositol 3-kinase, C2 domain containing, alpha polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Pik3c2a
phosphatidylinositol 3-kinase, C2 domain containing, alpha polypeptide
Pik3c2a_predicted
phosphatidylinositol 3-kinase, C2 domain containing, alpha polypeptide (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Pik3c2a_predicted
phosphatidylinositol 3-kinase, C2 domain containing, alpha polypeptide (predicted)
Symbol and Name status set to approved
70820 APPROVED
