Symbol:
Tfr2
Name:
transferrin receptor 2
RGD ID:
1310152
Description:
Predicted to enable co-receptor binding activity and transferrin receptor activity. Involved in acute-phase response. Predicted to be located in cytoplasmic vesicle and plasma membrane. Predicted to be part of HFE-transferrin receptor complex. Predicted to be active in external side of plasma membrane. Used to study hemochromatosis type 3. Human ortholog(s) of this gene implicated in hemochromatosis and hemochromatosis type 3. Orthologous to human TFR2 (transferrin receptor 2); INTERACTS WITH 17beta-estradiol; 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC288562; transferrin receptor protein 2; Trfr2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TFR2 (transferrin receptor 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tfr2 (transferrin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tfr2 (transferrin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TFR2 (transferrin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TFR2 (transferrin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tfr2 (transferrin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TFR2 (transferrin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TFR2 (transferrin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tfr2 (transferrin receptor 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TFR2 (transferrin receptor 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tfr2 (transferrin receptor 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tfr2 (transferrin receptor 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TRE1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
VPS70
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TRE2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 24,744,450 - 24,761,413 (-) NCBI GRCr8 mRatBN7.2 12 19,107,673 - 19,124,622 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 19,107,673 - 19,124,591 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 20,263,117 - 20,280,127 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 20,875,998 - 20,893,008 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 19,940,332 - 19,957,342 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 22,177,382 - 22,194,330 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 22,177,382 - 22,194,299 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 24,194,288 - 24,211,237 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 19,638,502 - 19,655,420 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 19,628,960 - 19,644,982 (+) NCBI Celera 12 20,912,852 - 20,929,749 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tfr2 Rat (1->4)-beta-D-glucan multiple interactions ISO Tfr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TFR2 mRNA CTD PMID:36331819 Tfr2 Rat 1,1-dichloroethene increases expression ISO Tfr2 (Mus musculus) 6480464 vinylidene chloride results in increased expression of TFR2 mRNA CTD PMID:26682919 Tfr2 Rat 17beta-estradiol decreases expression ISO Tfr2 (Mus musculus) 6480464 Estradiol results in decreased expression of TFR2 mRNA CTD PMID:19484750 Tfr2 Rat 17beta-estradiol increases expression ISO Tfr2 (Mus musculus) 6480464 Estradiol results in increased expression of TFR2 mRNA CTD PMID:39298647 Tfr2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TFR2 protein CTD PMID:32145629 Tfr2 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Tfr2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tfr2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TFR2 mRNA CTD PMID:18163543 and PMID:28213091 Tfr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TFR2 mRNA CTD PMID:32109520 Tfr2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Tfr2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Tfr2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TFR2 mRNA CTD PMID:21346803 Tfr2 Rat 2-butoxyethanol increases expression ISO Tfr2 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of TFR2 mRNA CTD PMID:19812364 Tfr2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Tfr2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of TFR2 mRNA CTD PMID:18648102 Tfr2 Rat 4,4'-sulfonyldiphenol decreases expression ISO TFR2 (Homo sapiens) 6480464 bisphenol S results in decreased expression of TFR2 mRNA CTD PMID:27685785 Tfr2 Rat 4,4'-sulfonyldiphenol affects expression ISO Tfr2 (Mus musculus) 6480464 bisphenol S affects the expression of TFR2 mRNA CTD PMID:39298647 Tfr2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of TFR2 mRNA CTD PMID:31881176 Tfr2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TFR2 mRNA CTD PMID:28959563 Tfr2 Rat acrylamide decreases expression ISO TFR2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of TFR2 mRNA CTD PMID:32763439 Tfr2 Rat aflatoxin B1 decreases expression ISO TFR2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of TFR2 mRNA CTD PMID:27153756 Tfr2 Rat all-trans-retinoic acid multiple interactions ISO Tfr2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of TFR2 mRNA CTD PMID:36189433 Tfr2 Rat arsane increases methylation ISO TFR2 (Homo sapiens) 6480464 Arsenic results in increased methylation of TFR2 gene CTD PMID:28242323 Tfr2 Rat arsenic atom increases methylation ISO TFR2 (Homo sapiens) 6480464 Arsenic results in increased methylation of TFR2 gene CTD PMID:28242323 Tfr2 Rat benzo[a]pyrene decreases expression ISO Tfr2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TFR2 mRNA CTD PMID:19770486 Tfr2 Rat benzo[a]pyrene decreases expression ISO TFR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TFR2 mRNA CTD PMID:32234424 Tfr2 Rat benzo[a]pyrene affects methylation ISO TFR2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TFR2 promoter CTD PMID:27901495 Tfr2 Rat benzo[a]pyrene increases methylation ISO TFR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TFR2 3' UTR CTD PMID:27901495 Tfr2 Rat benzo[a]pyrene multiple interactions ISO Tfr2 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to TFR2 promoter] CTD PMID:19654925 Tfr2 Rat benzo[e]pyrene increases methylation ISO TFR2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of TFR2 promoter CTD PMID:30157460 Tfr2 Rat bisphenol A increases expression ISO Tfr2 (Mus musculus) 6480464 bisphenol A results in increased expression of TFR2 mRNA CTD PMID:26063408 and PMID:33221593 Tfr2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TFR2 mRNA CTD PMID:34947998 Tfr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TFR2 mRNA CTD PMID:30816183 and PMID:32528016 Tfr2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TFR2 mRNA CTD PMID:25181051 Tfr2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of TFR2 mRNA CTD PMID:25993096 Tfr2 Rat carbon nanotube increases expression ISO Tfr2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of TFR2 mRNA CTD PMID:25620056 Tfr2 Rat CGS 15943 decreases expression ISO TFR2 (Homo sapiens) 6480464 9-chloro-2-(2-furyl)-(1 more ... CTD PMID:25633564 Tfr2 Rat chromium(6+) increases expression ISO TFR2 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of TFR2 mRNA CTD PMID:17382205 Tfr2 Rat clofibrate multiple interactions ISO Tfr2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TFR2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of TFR2 mRNA] CTD PMID:17585979 Tfr2 Rat clofibrate decreases expression ISO Tfr2 (Mus musculus) 6480464 Clofibrate results in decreased expression of TFR2 mRNA CTD PMID:17585979 Tfr2 Rat copper atom decreases expression EXP 6480464 Copper deficiency results in decreased expression of TFR2 protein CTD PMID:20164366 and PMID:22457245 Tfr2 Rat copper(0) decreases expression EXP 6480464 Copper deficiency results in decreased expression of TFR2 protein CTD PMID:20164366 and PMID:22457245 Tfr2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of TFR2 mRNA CTD PMID:27523638 Tfr2 Rat cyclosporin A decreases expression ISO TFR2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TFR2 mRNA CTD PMID:25562108 Tfr2 Rat desferrioxamine B decreases expression ISO TFR2 (Homo sapiens) 6480464 Deferoxamine results in decreased expression of TFR2 protein CTD PMID:25633564 Tfr2 Rat Dibutyl phosphate affects expression ISO TFR2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TFR2 mRNA CTD PMID:37042841 Tfr2 Rat dioxygen increases expression ISO Tfr2 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of TFR2 mRNA CTD PMID:20880076 Tfr2 Rat dorsomorphin decreases expression ISO TFR2 (Homo sapiens) 6480464 dorsomorphin results in decreased expression of TFR2 protein CTD PMID:25633564 Tfr2 Rat dorsomorphin multiple interactions ISO TFR2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFR2 mRNA CTD PMID:27188386 Tfr2 Rat epoxiconazole decreases expression ISO Tfr2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of TFR2 mRNA CTD PMID:35436446 Tfr2 Rat ferric ammonium citrate decreases expression ISO TFR2 (Homo sapiens) 6480464 ferric ammonium citrate results in decreased expression of TFR2 protein CTD PMID:25633564 Tfr2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of TFR2 mRNA CTD PMID:24136188 Tfr2 Rat fumonisin B1 decreases expression ISO Tfr2 (Mus musculus) 6480464 fumonisin B1 results in decreased expression of TFR2 mRNA CTD PMID:16221962 Tfr2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of TFR2 mRNA CTD PMID:25539665 Tfr2 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of TFR2 mRNA CTD PMID:24136188 Tfr2 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of TFR2 mRNA CTD PMID:24915197 Tfr2 Rat GSK-J4 decreases expression ISO TFR2 (Homo sapiens) 6480464 GSK-J4 results in decreased expression of TFR2 mRNA CTD PMID:29301935 Tfr2 Rat iron atom multiple interactions ISO Tfr2 (Mus musculus) 6480464 [HBB-B1 gene mutant form results in increased abundance of Iron] which results in decreased expression of TFR2 mRNA more ... CTD PMID:17018382 more ... Tfr2 Rat iron atom decreases expression EXP 6480464 Iron deficiency results in decreased expression of TFR2 protein CTD PMID:20164366 and PMID:22457245 Tfr2 Rat iron atom affects metabolic processing ISO Tfr2 (Mus musculus) 6480464 TFR2 protein affects the metabolism of Iron CTD PMID:17194590 and PMID:17241880 Tfr2 Rat iron atom increases uptake ISO Tfr2 (Mus musculus) 6480464 TFR2 protein mutant form results in increased uptake of Iron CTD PMID:16935854 Tfr2 Rat iron atom affects response to substance ISO TFR2 (Homo sapiens) 6480464 TFR2 protein affects the susceptibility to Iron CTD PMID:16893896 Tfr2 Rat iron atom multiple interactions ISO TFR2 (Homo sapiens) 6480464 [HFE protein binds to TFR2 protein] which affects the susceptibility to Iron CTD PMID:16893896 Tfr2 Rat iron dextran increases expression ISO Tfr2 (Mus musculus) 6480464 Iron-Dextran Complex results in increased expression of TFR2 protein CTD PMID:27095094 Tfr2 Rat iron(0) increases uptake ISO Tfr2 (Mus musculus) 6480464 TFR2 protein mutant form results in increased uptake of Iron CTD PMID:16935854 Tfr2 Rat iron(0) affects metabolic processing ISO Tfr2 (Mus musculus) 6480464 TFR2 protein affects the metabolism of Iron CTD PMID:17194590 and PMID:17241880 Tfr2 Rat iron(0) affects response to substance ISO TFR2 (Homo sapiens) 6480464 TFR2 protein affects the susceptibility to Iron CTD PMID:16893896 Tfr2 Rat iron(0) multiple interactions ISO TFR2 (Homo sapiens) 6480464 [HFE protein binds to TFR2 protein] which affects the susceptibility to Iron CTD PMID:16893896 Tfr2 Rat iron(0) multiple interactions ISO Tfr2 (Mus musculus) 6480464 [HBB-B1 gene mutant form results in increased abundance of Iron] which results in decreased expression of TFR2 mRNA more ... CTD PMID:17018382 more ... Tfr2 Rat iron(0) decreases expression EXP 6480464 Iron deficiency results in decreased expression of TFR2 protein CTD PMID:20164366 and PMID:22457245 Tfr2 Rat kenpaullone decreases expression ISO TFR2 (Homo sapiens) 6480464 kenpaullone results in decreased expression of TFR2 mRNA CTD PMID:25633564 Tfr2 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of TFR2 mRNA CTD PMID:24136188 Tfr2 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of TFR2 mRNA CTD PMID:28935588 Tfr2 Rat methapyrilene increases methylation ISO TFR2 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of TFR2 promoter CTD PMID:30157460 Tfr2 Rat methapyrilene decreases expression ISO TFR2 (Homo sapiens) 6480464 Methapyrilene results in decreased expression of TFR2 mRNA CTD PMID:28935588 Tfr2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Tfr2 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of TFR2 mRNA CTD PMID:36189433 Tfr2 Rat monosodium L-glutamate multiple interactions ISO Tfr2 (Mus musculus) 6480464 [Sodium Glutamate co-treated with Trans Fatty Acids] results in increased expression of TFR2 mRNA CTD PMID:19001666 Tfr2 Rat N-methyl-4-phenylpyridinium increases expression ISO Tfr2 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of TFR2 mRNA CTD PMID:22776087 Tfr2 Rat N-nitrosodiethylamine decreases expression ISO Tfr2 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of TFR2 mRNA and Diethylnitrosamine results in decreased expression of TFR2 protein CTD PMID:19061943 Tfr2 Rat N-nitrosodiethylamine multiple interactions ISO Tfr2 (Mus musculus) 6480464 Iron inhibits the reaction [Diethylnitrosamine results in decreased expression of TFR2 protein] CTD PMID:19061943 Tfr2 Rat N-Nitrosopyrrolidine decreases expression ISO TFR2 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of TFR2 mRNA CTD PMID:32234424 Tfr2 Rat nickel dichloride increases expression ISO Tfr2 (Mus musculus) 6480464 nickel chloride results in increased expression of TFR2 mRNA CTD PMID:24577088 Tfr2 Rat nickel sulfate increases expression ISO TFR2 (Homo sapiens) 6480464 nickel sulfate results in increased expression of TFR2 mRNA CTD PMID:17382205 Tfr2 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of TFR2 mRNA CTD PMID:33484710 Tfr2 Rat okadaic acid decreases expression ISO TFR2 (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of TFR2 mRNA CTD PMID:38832940 Tfr2 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of TFR2 mRNA CTD PMID:25729387 Tfr2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TFR2 mRNA CTD PMID:25729387 Tfr2 Rat paracetamol multiple interactions ISO Tfr2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TFR2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of TFR2 mRNA] CTD PMID:17585979 Tfr2 Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Tfr2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tfr2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TFR2 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of TFR2 mRNA CTD PMID:36331819 Tfr2 Rat phenethyl isothiocyanate decreases expression ISO TFR2 (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of TFR2 mRNA CTD PMID:26678675 Tfr2 Rat pirinixic acid decreases expression ISO Tfr2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of TFR2 mRNA CTD PMID:16221962 Tfr2 Rat potassium chromate increases expression ISO TFR2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of TFR2 mRNA CTD PMID:17382205 Tfr2 Rat potassium dichromate increases expression ISO Tfr2 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of TFR2 mRNA CTD PMID:23608068 Tfr2 Rat quercetin affects expression ISO TFR2 (Homo sapiens) 6480464 Quercetin affects the expression of TFR2 mRNA CTD PMID:21632981 Tfr2 Rat resveratrol multiple interactions ISO TFR2 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of TFR2 mRNA CTD PMID:23557933 Tfr2 Rat SB 431542 multiple interactions ISO TFR2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFR2 mRNA CTD PMID:27188386 Tfr2 Rat sotorasib multiple interactions ISO TFR2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of TFR2 mRNA CTD PMID:36139627 Tfr2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TFR2 mRNA CTD PMID:31150632 Tfr2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TFR2 mRNA CTD PMID:23411599 and PMID:34492290 Tfr2 Rat tolcapone increases expression EXP 6480464 tolcapone results in increased expression of TFR2 mRNA CTD PMID:24136188 Tfr2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TFR2 mRNA CTD PMID:25729387 Tfr2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of TFR2 mRNA CTD PMID:25729387 Tfr2 Rat trametinib multiple interactions ISO TFR2 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of TFR2 mRNA CTD PMID:36139627 Tfr2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TFR2 mRNA CTD PMID:33387578 Tfr2 Rat triptonide increases expression ISO Tfr2 (Mus musculus) 6480464 triptonide results in increased expression of TFR2 mRNA CTD PMID:33045310 Tfr2 Rat valproic acid decreases expression ISO TFR2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TFR2 mRNA CTD PMID:29154799 Tfr2 Rat valproic acid increases expression ISO Tfr2 (Mus musculus) 6480464 Valproic Acid results in increased expression of TFR2 mRNA CTD PMID:20546886 Tfr2 Rat valproic acid increases expression ISO TFR2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TFR2 mRNA CTD PMID:23179753 and PMID:26272509 Tfr2 Rat valproic acid multiple interactions ISO TFR2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TFR2 mRNA CTD PMID:27188386 Tfr2 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of TFR2 gene CTD PMID:31682807
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 17beta-estradiol (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP) carbon nanotube (ISO) CGS 15943 (ISO) chromium(6+) (ISO) clofibrate (ISO) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) cyclosporin A (ISO) desferrioxamine B (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) dorsomorphin (ISO) epoxiconazole (ISO) ferric ammonium citrate (ISO) flutamide (EXP) fumonisin B1 (ISO) furan (EXP) glafenine (EXP) glycidol (EXP) GSK-J4 (ISO) iron atom (EXP,ISO) iron dextran (ISO) iron(0) (EXP,ISO) kenpaullone (ISO) leflunomide (EXP) methapyrilene (EXP,ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (ISO) nickel dichloride (ISO) nickel sulfate (ISO) nitrofen (EXP) okadaic acid (ISO) oxaliplatin (EXP) paracetamol (ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) phenethyl isothiocyanate (ISO) pirinixic acid (ISO) potassium chromate (ISO) potassium dichromate (ISO) quercetin (ISO) resveratrol (ISO) SB 431542 (ISO) sotorasib (ISO) tetrachloromethane (EXP) thioacetamide (EXP) tolcapone (EXP) topotecan (EXP) trametinib (ISO) trichloroethene (EXP) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
A novel rat model of hereditary hemochromatosis due to a mutation in transferrin receptor 2.
Bartnikas TB, etal., Comp Med. 2013 Apr;63(2):143-55.
2.
The gene TFR2 is mutated in a new type of haemochromatosis mapping to 7q22.
Camaschella C, etal., Nat Genet. 2000 May;25(1):14-5.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Comparison of changes in gene expression of transferrin receptor-1 and other iron-regulatory proteins in rat liver and brain during acute-phase response.
Malik IA, etal., Cell Tissue Res. 2011 May;344(2):299-312. doi: 10.1007/s00441-011-1152-3. Epub 2011 Mar 26.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Elevated levels of transferrin receptor 2 mRNA, not transferrin receptor 1 mRNA, are associated with increased survival in acute myeloid leukaemia.
Nakamaki T, etal., Br J Haematol. 2004 Apr;125(1):42-9.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
mRNA expression of iron regulatory genes in beta-thalassemia intermedia and beta-thalassemia major mouse models.
Weizer-Stern O, etal., Am J Hematol. 2006 Jul;81(7):479-83.
Tfr2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 24,744,450 - 24,761,413 (-) NCBI GRCr8 mRatBN7.2 12 19,107,673 - 19,124,622 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 19,107,673 - 19,124,591 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 20,263,117 - 20,280,127 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 20,875,998 - 20,893,008 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 19,940,332 - 19,957,342 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 22,177,382 - 22,194,330 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 22,177,382 - 22,194,299 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 24,194,288 - 24,211,237 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 19,638,502 - 19,655,420 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 19,628,960 - 19,644,982 (+) NCBI Celera 12 20,912,852 - 20,929,749 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
TFR2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 100,620,420 - 100,641,552 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 100,620,416 - 100,642,779 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 100,218,043 - 100,239,175 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 100,055,975 - 100,077,109 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 99,862,690 - 99,883,810 NCBI Celera 7 94,947,821 - 94,968,950 (-) NCBI Celera Cytogenetic Map 7 q22.1 NCBI HuRef 7 94,849,520 - 94,870,648 (-) NCBI HuRef CHM1_1 7 100,148,586 - 100,169,685 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 101,860,501 - 101,881,634 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 99,577,671 - 99,598,799 (-) NCBI
Tfr2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 137,568,127 - 137,586,344 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 137,568,102 - 137,585,743 (+) Ensembl GRCm39 Ensembl GRCm38 5 137,569,822 - 137,588,081 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 137,569,840 - 137,587,481 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 138,011,079 - 138,028,709 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 137,800,593 - 137,817,260 (+) NCBI MGSCv36 mm8 Celera 5 134,553,519 - 134,571,033 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 76.57 NCBI
Tfr2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955573 272,289 - 291,668 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955573 272,315 - 289,227 (+) NCBI ChiLan1.0 ChiLan1.0
TFR2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 118,531,714 - 118,554,217 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 166,796,330 - 166,818,842 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 92,647,431 - 92,669,889 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 106,048,497 - 106,060,481 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 106,048,935 - 106,069,238 (-) Ensembl panpan1.1 panPan2
TFR2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 9,059,501 - 9,076,646 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 9,060,629 - 9,076,158 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 10,763,917 - 10,781,061 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 8,993,681 - 9,010,842 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 8,993,652 - 9,010,354 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 8,846,198 - 8,863,361 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 8,823,694 - 8,841,037 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 9,006,114 - 9,023,274 (+) NCBI UU_Cfam_GSD_1.0
Tfr2
TFR2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 8,539,320 - 8,578,763 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 8,539,316 - 8,553,993 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 7,934,261 - 7,948,960 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TFR2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 12,570,604 - 12,592,269 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 12,571,841 - 12,592,266 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 3,712,690 - 3,733,677 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tfr2
.
Predicted Target Of
Count of predictions: 62 Count of miRNA genes: 55 Interacting mature miRNAs: 62 Transcripts: ENSRNOT00000001905 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 61443 Btemp2 Thermal response to stress QTL 2 3.3 0.000094 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 12 15025183 20794014 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 13008296 19212979 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
45
113
91
90
59
25
59
6
214
93
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001905 ⟹ ENSRNOP00000001905
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 19,107,673 - 19,124,591 (-) Ensembl Rnor_6.0 Ensembl 12 22,177,382 - 22,194,299 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082895 ⟹ ENSRNOP00000072585
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 19,107,673 - 19,124,591 (-) Ensembl Rnor_6.0 Ensembl 12 22,177,402 - 22,194,287 (-) Ensembl
RefSeq Acc Id:
NM_001105916 ⟹ NP_001099386
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 24,744,450 - 24,761,368 (-) NCBI mRatBN7.2 12 19,107,673 - 19,124,591 (-) NCBI Rnor_6.0 12 22,177,382 - 22,194,299 (-) NCBI Rnor_5.0 12 24,194,288 - 24,211,237 (-) NCBI RGSC_v3.4 12 19,638,502 - 19,655,420 (+) RGD Celera 12 20,912,852 - 20,929,749 (-) RGD
Sequence:
AAATCCAGAGACCTGTTGCTGAGTTGAACTTGGCTGCTGTGTCTTCCCACTCAGGACTCGGCTTTGACAGGCACGAGGCAGGGACTGGGGTGAGCCCCTACCTCTCAGATCTTTCTGGACCTGGCTGC
hide sequence
RefSeq Acc Id:
XM_006249116 ⟹ XP_006249178
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 24,744,468 - 24,761,413 (-) NCBI mRatBN7.2 12 19,107,691 - 19,124,622 (-) NCBI Rnor_6.0 12 22,177,400 - 22,194,330 (-) NCBI Rnor_5.0 12 24,194,288 - 24,211,237 (-) NCBI
Sequence:
GGCTTTGAGTCTTCTGGGAGCATGGTCCAAGAAATCCAGAGACCTGTTGCTGAGTTGAACTTGG
hide sequence
RefSeq Acc Id:
XM_006249117 ⟹ XP_006249179
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 24,744,468 - 24,761,375 (-) NCBI mRatBN7.2 12 19,107,691 - 19,124,589 (-) NCBI Rnor_6.0 12 22,177,400 - 22,194,300 (-) NCBI Rnor_5.0 12 24,194,288 - 24,211,237 (-) NCBI
Sequence:
GAAATCCAGAGACCTGTTGCTGAGTTGAACTTGGCTGCTGTGTCTTCCCACTCAGGACTCGGCT
hide sequence
RefSeq Acc Id:
XM_006249118 ⟹ XP_006249180
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 24,744,468 - 24,761,359 (-) NCBI mRatBN7.2 12 19,107,691 - 19,124,616 (-) NCBI Rnor_6.0 12 22,177,400 - 22,194,324 (-) NCBI Rnor_5.0 12 24,194,288 - 24,211,237 (-) NCBI
Sequence:
GAGTCTTCTGGGAGCATGGTCCAAGAAATCCAGAGACCTGTTGCTGAGTTGAACTTGGCTGCTG
hide sequence
RefSeq Acc Id:
XM_008769125 ⟹ XP_008767347
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 24,744,468 - 24,761,379 (-) NCBI mRatBN7.2 12 19,107,691 - 19,124,605 (-) NCBI Rnor_6.0 12 22,177,400 - 22,194,298 (-) NCBI
Sequence:
AATCCAGAGACCTGTTGCTGAGTTGAACTTGGCTGCTGTGTCTTCCCACTCAGGACTCGGCTTT
hide sequence
RefSeq Acc Id:
XM_008769127 ⟹ XP_008767349
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 24,744,468 - 24,761,413 (-) NCBI mRatBN7.2 12 19,107,691 - 19,124,622 (-) NCBI Rnor_6.0 12 22,177,400 - 22,194,330 (-) NCBI
Sequence:
GGCTTTGAGTCTTCTGGGAGCATGGTCCAAGAAATCCAGAGACCTGTTGCTGAGTTGAACTTGG
hide sequence
RefSeq Acc Id:
NP_001099386 ⟸ NM_001105916
- UniProtKB:
B2GUY2 (UniProtKB/Swiss-Prot), A0A8L2UQK5 (UniProtKB/TrEMBL)
- Sequence:
MEQRWGLLRKVQQWSPRPSQTIYRRVEGPQLENLEEEDREEGEELPAQFCPMELKGPERLGSCPGRSIPIPWAAAGRKAAPYLVLTTLLIFTGAFLLGYVAFRGSCQACGDSVLVVGEDVNSEDSSRG
hide sequence
RefSeq Acc Id:
XP_006249178 ⟸ XM_006249116
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2UQK5 (UniProtKB/TrEMBL)
- Sequence:
MVQEIQRPVAELNLAAVSSHSGLGFDRHEAGTGGSGGGTSMEQRWGLLRKVQQWSPRPSQTIYR
hide sequence
RefSeq Acc Id:
XP_006249180 ⟸ XM_006249118
- Peptide Label:
isoform X2
- UniProtKB:
B2GUY2 (UniProtKB/Swiss-Prot), A0A8L2UQK5 (UniProtKB/TrEMBL)
- Sequence:
MEQRWGLLRKVQQWSPRPSQTIYRRVEGPQLENLEEEDREEGEELPAQFCPMELKGPERLGSCP
hide sequence
RefSeq Acc Id:
XP_006249179 ⟸ XM_006249117
- Peptide Label:
isoform X2
- UniProtKB:
B2GUY2 (UniProtKB/Swiss-Prot), A0A8L2UQK5 (UniProtKB/TrEMBL)
- Sequence:
MEQRWGLLRKVQQWSPRPSQTIYRRVEGPQLENLEEEDREEGEELPAQFCPMELKGPERLGSCPGRSIPIPWAAAGRKAAPYLVLTTLLIFTGAFLLGYVAFRGSCQACGDSVLVVGEDVNSEDSSRG
hide sequence
RefSeq Acc Id:
XP_008767349 ⟸ XM_008769127
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2UQK5 (UniProtKB/TrEMBL)
- Sequence:
MVQEIQRPVAELNLAAVSSHSGLGFDRHEAGTGGSGGGTSMEQRWGLLRKVQQWSPRPSQTIYR
hide sequence
RefSeq Acc Id:
XP_008767347 ⟸ XM_008769125
- Peptide Label:
isoform X2
- UniProtKB:
B2GUY2 (UniProtKB/Swiss-Prot), A0A8L2UQK5 (UniProtKB/TrEMBL)
- Sequence:
MEQRWGLLRKVQQWSPRPSQTIYRRVEGPQLENLEEEDREEGEELPAQFCPMELKGPERLGSCP
hide sequence
Ensembl Acc Id:
ENSRNOP00000072585 ⟸ ENSRNOT00000082895
Ensembl Acc Id:
ENSRNOP00000001905 ⟸ ENSRNOT00000001905
RGD ID: 13698522 Promoter ID: EPDNEW_R9041 Type: multiple initiation site Name: Tfr2_1 Description: transferrin receptor 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 22,194,293 - 22,194,353 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Tfr2
transferrin receptor 2
Trfr2
transferrin receptor 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Trfr2
transferrin receptor 2
Trfr2_predicted
transferrin receptor 2 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Trfr2_predicted
transferrin receptor 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
