Advanced Search (OLGA)

Gene: Otud6b (OTU deubiquitinase 6B) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Otud6b

Name:

OTU deubiquitinase 6B

RGD ID:

1310024

Description:

Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in several processes, including proteasome assembly; protein deubiquitination; and regulation of translation. Predicted to be part of eukaryotic translation initiation factor 4F complex. Orthologous to human OTUD6B (OTU deubiquitinase 6B); INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

deubiquitinase OTUD6B; LOC297911; OTU domain containing 6B; OTU domain-containing protein 6B; RGD1310024; similar to RIKEN cDNA 2600013N14

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OTUD6B (OTU deubiquitinase 6B)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Otud6b (OTU domain containing 6B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Otud6b (OTU deubiquitinase 6B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OTUD6B (OTU deubiquitinase 6B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OTUD6B (OTU deubiquitinase 6B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Otud6b (OTU deubiquitinase 6B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OTUD6B (OTU deubiquitinase 6B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OTUD6B (OTU deubiquitinase 6B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Otud6b (OTU deubiquitinase 6B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Otud6b (OTU domain containing 6B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OTUD6B (OTU deubiquitinase 6B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	otud6b (OTU domain containing 6B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	OTU2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7857	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	otub-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	otud6b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	32,979,190 - 33,011,781 (-)	NCBI		GRCr8
mRatBN7.2	5	28,181,992 - 28,214,486 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	28,023,594 - 28,214,334 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	30,353,872 - 30,369,010 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	31,946,556 - 31,961,694 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	31,906,713 - 31,921,851 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	28,333,019 - 28,350,093 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	28,333,019 - 28,349,927 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	33,017,035 - 33,034,265 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	29,268,066 - 29,283,381 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	29,230,845 - 29,283,260 (-)	NCBI
Celera	5	27,450,913 - 27,466,028 (-)	NCBI		Celera
Cytogenetic Map	5	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud6b	Rat	epilepsy		ISO	OTUD6B (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:25741868 more ...
Otud6b	Rat	genetic disease		ISO	OTUD6B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 more ...
Otud6b	Rat	Intellectual Developmental Disorder with Dysmorphic Facies, Seizures, and Distal Limb Anomalies		ISO	OTUD6B (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:25741868 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud6b	Rat	Intellectual Developmental Disorder with Dysmorphic Facies, Seizures, and Distal Limb Anomalies		ISO	OTUD6B (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud6b	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of OTUD6B mRNA]	CTD	PMID:31150632
Otud6b	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Otud6b (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OTUD6B mRNA	CTD	PMID:22206623
Otud6b	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Otud6b (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of OTUD6B mRNA	CTD	PMID:22206623
Otud6b	Rat	17beta-estradiol	increases expression	ISO	OTUD6B (Homo sapiens)	6480464	Estradiol results in increased expression of OTUD6B mRNA	CTD	PMID:31614463
Otud6b	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Otud6b (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of OTUD6B mRNA	CTD	PMID:21570461
Otud6b	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of OTUD6B mRNA	CTD	PMID:21346803
Otud6b	Rat	2-methylcholine	affects expression	ISO	OTUD6B (Homo sapiens)	6480464	beta-methylcholine affects the expression of OTUD6B mRNA	CTD	PMID:21179406
Otud6b	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of OTUD6B protein	CTD	PMID:34915118
Otud6b	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Otud6b (Mus musculus)	6480464	bisphenol S results in increased expression of OTUD6B mRNA	CTD	PMID:39298647
Otud6b	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of OTUD6B mRNA	CTD	PMID:23630614
Otud6b	Rat	all-trans-retinoic acid	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	Tretinoin results in decreased expression of OTUD6B mRNA	CTD	PMID:33167477
Otud6b	Rat	aristolochic acid A	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of OTUD6B mRNA	CTD	PMID:33212167
Otud6b	Rat	arsane	multiple interactions	ISO	OTUD6B (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of OTUD6B mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of OTUD6B mRNA	CTD	PMID:39836092
Otud6b	Rat	arsenic atom	multiple interactions	ISO	OTUD6B (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of OTUD6B mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of OTUD6B mRNA	CTD	PMID:39836092
Otud6b	Rat	benzo[a]pyrene	increases expression	ISO	Otud6b (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of OTUD6B mRNA	CTD	PMID:22228805
Otud6b	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Otud6b	Rat	beta-lapachone	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	beta-lapachone results in decreased expression of OTUD6B mRNA	CTD	PMID:38218311
Otud6b	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OTUD6B mRNA	CTD	PMID:25181051 more ...
Otud6b	Rat	bisphenol A	decreases expression	ISO	Otud6b (Mus musculus)	6480464	bisphenol A results in decreased expression of OTUD6B mRNA	CTD	PMID:33221593
Otud6b	Rat	bisphenol F	increases expression	ISO	Otud6b (Mus musculus)	6480464	bisphenol F results in increased expression of OTUD6B mRNA	CTD	PMID:38685157
Otud6b	Rat	bromobenzene	increases expression	EXP		6480464	bromobenzene results in increased expression of OTUD6B mRNA	CTD	PMID:32479839
Otud6b	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of OTUD6B promoter	CTD	PMID:22457795
Otud6b	Rat	cadmium dichloride	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of OTUD6B mRNA	CTD	PMID:38568856
Otud6b	Rat	carbon nanotube	increases expression	ISO	Otud6b (Mus musculus)	6480464	Nanotubes and Carbon results in increased expression of OTUD6B mRNA	CTD	PMID:25620056
Otud6b	Rat	chromium(6+)	affects expression	ISO	Otud6b (Mus musculus)	6480464	chromium hexavalent ion affects the expression of OTUD6B mRNA	CTD	PMID:28472532
Otud6b	Rat	clothianidin	increases expression	ISO	OTUD6B (Homo sapiens)	6480464	clothianidin results in increased expression of OTUD6B mRNA	CTD	PMID:29044138
Otud6b	Rat	crocidolite asbestos	decreases expression	ISO	Otud6b (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of OTUD6B mRNA	CTD	PMID:29279043
Otud6b	Rat	cyclosporin A	increases expression	ISO	OTUD6B (Homo sapiens)	6480464	Cyclosporine results in increased expression of OTUD6B mRNA	CTD	PMID:20106945
Otud6b	Rat	dicrotophos	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	dicrotophos results in decreased expression of OTUD6B mRNA	CTD	PMID:28302478
Otud6b	Rat	enzyme inhibitor	multiple interactions	ISO	OTUD6B (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of OTUD6B protein	CTD	PMID:23301498
Otud6b	Rat	ethanol	affects expression	ISO	Otud6b (Mus musculus)	6480464	Ethanol affects the expression of OTUD6B mRNA	CTD	PMID:30319688
Otud6b	Rat	ethanol	multiple interactions	ISO	Otud6b (Mus musculus)	6480464	Ethanol affects the expression of and affects the splicing of OTUD6B mRNA	CTD	PMID:30319688
Otud6b	Rat	folic acid	multiple interactions	ISO	Otud6b (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OTUD6B mRNA	CTD	PMID:22206623
Otud6b	Rat	folic acid	decreases expression	ISO	Otud6b (Mus musculus)	6480464	Folic Acid results in decreased expression of OTUD6B mRNA	CTD	PMID:25629700
Otud6b	Rat	hydrogen peroxide	affects expression	ISO	OTUD6B (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of OTUD6B mRNA	CTD	PMID:21179406
Otud6b	Rat	ivermectin	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	Ivermectin results in decreased expression of OTUD6B protein	CTD	PMID:32959892
Otud6b	Rat	manganese atom	multiple interactions	ISO	OTUD6B (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of OTUD6B mRNA	CTD	PMID:39836092
Otud6b	Rat	manganese(0)	multiple interactions	ISO	OTUD6B (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of OTUD6B mRNA	CTD	PMID:39836092
Otud6b	Rat	manganese(II) chloride	multiple interactions	ISO	OTUD6B (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of OTUD6B mRNA	CTD	PMID:39836092
Otud6b	Rat	mono(2-ethylhexyl) phthalate	increases expression	ISO	OTUD6B (Homo sapiens)	6480464	mono-(2-ethylhexyl)phthalate results in increased expression of OTUD6B mRNA	CTD	PMID:38685446
Otud6b	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of OTUD6B mRNA	CTD	PMID:32479839
Otud6b	Rat	pirinixic acid	increases expression	ISO	Otud6b (Mus musculus)	6480464	pirinixic acid results in increased expression of OTUD6B mRNA	CTD	PMID:23811191
Otud6b	Rat	quercetin	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	Quercetin results in decreased expression of OTUD6B mRNA	CTD	PMID:21632981
Otud6b	Rat	sodium arsenite	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	sodium arsenite results in decreased expression of OTUD6B mRNA	CTD	PMID:38568856
Otud6b	Rat	sodium arsenite	multiple interactions	ISO	OTUD6B (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of OTUD6B mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of OTUD6B mRNA	CTD	PMID:39836092
Otud6b	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of OTUD6B mRNA	CTD	PMID:31150632
Otud6b	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of OTUD6B mRNA]	CTD	PMID:31150632
Otud6b	Rat	thimerosal	increases expression	ISO	OTUD6B (Homo sapiens)	6480464	Thimerosal results in increased expression of OTUD6B mRNA	CTD	PMID:27188386
Otud6b	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of OTUD6B mRNA	CTD	PMID:23411599 and PMID:34492290
Otud6b	Rat	titanium dioxide	decreases expression	ISO	Otud6b (Mus musculus)	6480464	titanium dioxide results in decreased expression of OTUD6B mRNA	CTD	PMID:29264374
Otud6b	Rat	titanium dioxide	decreases methylation	ISO	Otud6b (Mus musculus)	6480464	titanium dioxide results in decreased methylation of OTUD6B gene	CTD	PMID:35295148
Otud6b	Rat	trimellitic anhydride	increases expression	ISO	Otud6b (Mus musculus)	6480464	trimellitic anhydride results in increased expression of OTUD6B mRNA	CTD	PMID:19042947
Otud6b	Rat	triphenyl phosphate	affects expression	ISO	OTUD6B (Homo sapiens)	6480464	triphenyl phosphate affects the expression of OTUD6B mRNA	CTD	PMID:37042841
Otud6b	Rat	urethane	decreases expression	ISO	OTUD6B (Homo sapiens)	6480464	Urethane results in decreased expression of OTUD6B mRNA	CTD	PMID:28818685
Otud6b	Rat	valproic acid	increases expression	ISO	OTUD6B (Homo sapiens)	6480464	Valproic Acid results in increased expression of OTUD6B mRNA	CTD	PMID:23179753 and PMID:29154799
Otud6b	Rat	valproic acid	affects expression	ISO	OTUD6B (Homo sapiens)	6480464	Valproic Acid affects the expression of OTUD6B mRNA	CTD	PMID:25979313

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud6b	Rat	cell population proliferation	involved_in	IEA	UniProtKB:Q8N6M0 and ensembl:ENSP00000384190	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Otud6b	Rat	cell population proliferation	involved_in	ISO	OTUD6B (Homo sapiens)	1624291	PMID:27864334	RGD	PMID:27864334
Otud6b	Rat	negative regulation of translation	involved_in	ISO	OTUD6B (Homo sapiens) and UniProtKB:Q8N6M0-1	1624291	PMID:27864334	RGD	PMID:27864334
Otud6b	Rat	positive regulation of translation	involved_in	ISO	OTUD6B (Homo sapiens) and UniProtKB:Q8N6M0-2	1624291	PMID:27864334	RGD	PMID:27864334
Otud6b	Rat	proteasome assembly	involved_in	ISO	OTUD6B (Homo sapiens)	1624291	PMID:28343629	RGD	PMID:28343629
Otud6b	Rat	proteasome assembly	involved_in	IEA	UniProtKB:Q8N6M0 and ensembl:ENSP00000384190	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Otud6b	Rat	protein deubiquitination	involved_in	ISO	OTUD6B (Homo sapiens)	1624291	PMID:21267069 and PMID:27864334	RGD	PMID:21267069 and PMID:27864334
Otud6b	Rat	protein deubiquitination	involved_in	IEA	UniProtKB:Q8N6M0 and ensembl:ENSP00000384190	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud6b	Rat	eukaryotic translation initiation factor 4F complex	located_in	ISO	OTUD6B (Homo sapiens)	1624291	PMID:27864334	RGD	PMID:27864334
Otud6b	Rat	eukaryotic translation initiation factor 4F complex	located_in	IEA	UniProtKB:Q8N6M0 and ensembl:ENSP00000384190	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Otud6b	Rat	cysteine-type deubiquitinase activity	enables	ISO	OTUD6B (Homo sapiens)	1624291	PMID:21267069	RGD	PMID:21267069
Otud6b	Rat	cysteine-type deubiquitinase activity	enables	IBA	FB:FBgn0026738 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Otud6b	Rat	cysteine-type deubiquitinase activity	enables	IEA	UniProtKB:Q8N6M0 and ensembl:ENSP00000384190	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Otud6b	Rat	cysteine-type deubiquitinase activity	enables	IEA	EC:3.4.19.12	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Otud6b	Rat	cysteine-type peptidase activity	enables	IEA	UniProtKB-KW:KW-0788	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Otud6b	Rat	protein binding	enables	ISO	OTUD6B (Homo sapiens)	1624291	UniProtKB:Q96FW1 more ...	RGD	PMID:28514442 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:21267069	PMID:27864334	PMID:28343629

Otud6b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	32,979,190 - 33,011,781 (-)	NCBI		GRCr8
mRatBN7.2	5	28,181,992 - 28,214,486 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	28,023,594 - 28,214,334 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	30,353,872 - 30,369,010 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	31,946,556 - 31,961,694 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	31,906,713 - 31,921,851 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	28,333,019 - 28,350,093 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	28,333,019 - 28,349,927 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	33,017,035 - 33,034,265 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	29,268,066 - 29,283,381 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	29,230,845 - 29,283,260 (-)	NCBI
Celera	5	27,450,913 - 27,466,028 (-)	NCBI		Celera
Cytogenetic Map	5	q13	NCBI

OTUD6B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	91,070,344 - 91,087,093 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	91,070,196 - 91,087,095 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	92,082,572 - 92,099,321 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	92,151,600 - 92,168,499 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	8	88,277,450 - 88,294,349 (+)	NCBI		Celera
Cytogenetic Map	8	q21.3	NCBI
HuRef	8	87,293,694 - 87,310,590 (+)	NCBI		HuRef
CHM1_1	8	92,123,085 - 92,139,970 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	92,195,269 - 92,212,018 (+)	NCBI		T2T-CHM13v2.0

Otud6b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	14,809,503 - 14,826,413 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	14,809,498 - 14,826,587 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	14,809,505 - 14,826,413 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	14,809,498 - 14,826,587 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	14,736,652 - 14,753,734 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	14,736,652 - 14,753,531 (-)	NCBI		MGSCv36	mm8
Celera	4	14,601,182 - 14,626,052 (-)	NCBI		Celera
Cytogenetic Map	4	A1	NCBI
cM Map	4	6.38	NCBI

Otud6b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	7,844,292 - 7,858,658 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955417	7,844,311 - 7,859,032 (+)	NCBI	ChiLan1.0	ChiLan1.0

OTUD6B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	108,440,903 - 108,457,789 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	83,979,464 - 83,996,406 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	87,733,597 - 87,750,481 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	89,685,766 - 89,702,661 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	89,685,766 - 89,702,659 (+)	Ensembl	panpan1.1		panPan2

OTUD6B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	36,466,596 - 36,485,509 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	36,433,450 - 36,483,222 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	36,618,817 - 36,638,435 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	36,667,557 - 36,687,411 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	36,667,366 - 36,713,018 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	36,687,777 - 36,707,389 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	36,669,466 - 36,689,095 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	37,108,146 - 37,127,799 (+)	NCBI		UU_Cfam_GSD_1.0

Otud6b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	43,087,401 - 43,104,325 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936544	4,688,347 - 4,702,591 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936544	4,688,332 - 4,705,304 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OTUD6B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	45,772,333 - 45,793,338 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	45,776,776 - 45,793,270 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	49,397,943 - 49,414,516 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OTUD6B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	86,140,202 - 86,156,906 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	86,140,327 - 86,154,676 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	54,706,534 - 54,723,240 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Otud6b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	885,821 - 901,677 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624744	875,658 - 901,540 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Otud6b
200 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	123
Count of miRNA genes:	100
Interacting mature miRNAs:	108
Transcripts:	ENSRNOT00000008725
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	8948228	53948228	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	3844018	47869213	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	2138965	32656739	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
61462	Niddm10	Non-insulin dependent diabetes mellitus QTL 10	3.9	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	5	5112159	47171491	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	12689285	57689285	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1549901	Neudeg2	Neurodegradation QTL 2	4	0	nervous system integrity trait (VT:0010566)	mononuclear cell count (CMO:0002119)	5	24838710	44045280	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006237914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008725 ⟹ ENSRNOP00000008726

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	28,197,325 - 28,214,334 (-)	Ensembl
Rnor_6.0 Ensembl	5	28,333,019 - 28,349,927 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093302 ⟹ ENSRNOP00000076285

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	28,023,594 - 28,214,334 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093477

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	28,334,912 - 28,336,024 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093698 ⟹ ENSRNOP00000076236

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	28,181,889 - 28,214,175 (-)	Ensembl
Rnor_6.0 Ensembl	5	28,338,920 - 28,349,854 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111015 ⟹ ENSRNOP00000086210

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	28,207,610 - 28,214,175 (-)	Ensembl

RefSeq Acc Id:

NM_001106639 ⟹ NP_001100109

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	32,996,453 - 33,011,568 (-)	NCBI
mRatBN7.2	5	28,199,217 - 28,214,334 (-)	NCBI
Rnor_6.0	5	28,334,912 - 28,350,074 (-)	NCBI
Rnor_5.0	5	33,017,035 - 33,034,265 (-)	NCBI
RGSC_v3.4	5	29,268,066 - 29,283,381 (-)	RGD
Celera	5	27,450,913 - 27,466,028 (-)	RGD

Sequence:

show sequence

GCGCCGCCCAGAGCGGTCCGAGCACGCAGGCGCCCTAGCCCATGTCGGCTTCTCCGGGTTTCAGTGGTTAGACCTGGATCCGGAGCCGCCTTGAGGCGGGGCTGGGCCTTCCCGGCGGCCAATGGCGC
CCCGGGTGAGGGTTGAGGGGTGGGAGGCGCTGGCCTGCCTGAGGTGCCGAACTCCTCCAGCGCGTGTTCCCGGCCACTTGGTCGTCATGGAGGAGATCTTGGCTGAAGAGCTTGATGATGAGGAGCAG
CTGATGAGAAGGCATCGGAAGGAGAAGAAGGAGCTGCAAGCTAAAATTCAGGGAATGAAGAACGCCGTTCCCAAAAACGACAAAAAGAGGAGGAAGCAACTCACGGAAGATGTTGCTAAATTGGAGAG
GGAAATGGAGCAAAAACACAGGGAAGAACTGGAGCAATTGAAACTGACTTTCAAGGACAGTAAGATAGATTCTGTTGCTGTTAACGTTTCAAACTTGGTACTTGACAGTCAGCCACCTCGGATTTCAA
AAGCACAAAAGAGACGGGAGAAGAAGGCTGCATTGGAAAAGGAGCGGGAAGAAAGGATAGCTGAGGCAGAGATTGAGAACTTATCTGGAGCCAGACATCTAGAGAGTGAAAAACTTGCTCAGATATTG
GCAGCCAGAGAACTGGAAATTAAACATATTCCATCTGACGGTCATTGTATGTATGGGGCACTTGAGGATCAGCTAAGAGAACAAGACTCTGCTCTGACTGTGGCTACCCTAAGGAGGCAGACTGCTGA
GTACATGCAGAGCCATTCAGACGACTTCCTGCCATTCCTAACCAACCCCAACACAGGAGACATGTACACTCCAGAAGAGTTTGGAAAGTACTGTGACGATATTGTAAACACGGCCGCGTGGGGTGGTC
AGCTTGAGCTAAGAGCTCTGTCTCACATCTTAAAGACACCGATCGAGATACTACAGGCAGATGCTCCTCCTATTATAGTTGGTGAAGAGTATCCAAGGAATCCATTAGTACTAGTATACATGAGGCAT
GCGTATGGCTTAGGAGAACATTATAATTCTGTTACACGGTTGGTGAACTCAACTACTGAAAATTGCAGCTAGTTTACAAAATGTTACACTGTTTATAGAGTGTGCCCATCTACCAAGTGCTAGATTGT
TGTAAATGCTACTGAAAAACACAGCTACCTTAAATGAGTTTTATGAATAAGCTTACTAACGGGCTTTTTACAAATACATTGGAGTGACTTTAATCAGTGCTCTCTTAGTGGCATTTTTACAACTTAGT
CTATTGTGGAGAAGAATATCATTCACAGGCCAAGGCGTTACTC

hide sequence

RefSeq Acc Id:

XM_006237914 ⟹ XP_006237976

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	32,994,562 - 33,011,781 (-)	NCBI
mRatBN7.2	5	28,197,613 - 28,214,474 (-)	NCBI
Rnor_6.0	5	28,334,031 - 28,350,093 (-)	NCBI
Rnor_5.0	5	33,017,035 - 33,034,265 (-)	NCBI

Sequence:

show sequence

CAGAGTCCCAGCTTCCGGCGCGCCGCCCAGAGCGGTCCGAGCACGCAGGCGCCCTAGCCCATGT
CGGCTTCTCCGGGTTTCAGTGGTTAGACCTGGATCCGGAGCCGCCTTGAGGCGGGGCTGGGCCTTCCCGGCGGCCAATGGCGCCCCGGGTGAGGGTTGAGGGGTGGGAGGCGCTGGCCTGCCTGAGGT
GCCGAACTCCTCCAGCGCGTGTTCCCGGCCACTTGGTCGTCATGGAGGAGATCTTGGCTGAAGAGCTTGATGATGAGGAGCAGCTGATGAGAAGGCATCGGAAGGAGAAGAAGGAGCTGCAAGCTAAA
ATTCAGGGAATGAAGAACGCCGTTCCCAAAAACGACAAAAAGAGGAGGAAGCAACTCACGGAAGATGTTGCTAAATTGGAGAGGGAAATGGAGCAAAAACACAGGGAAGAACTGGAGCAATTGAAACT
GACTTTCAAGGACAGTAAGATAGATTCTGTTGCTGTTAACGTTTCAAACTTGGTACTTGACAGTCAGCCACCTCGGATTTCAAAAGCACAAAAGAGACGGGAGAAGAAGGCTGCATTGGAAAAGGAGC
GGGAAGAAAGGATAGCTGAGGCAGAGATTGAGAACTTATCTGGAGCCAGACATCTAGAGAGTGAAAAACTTGCTCAGATATTGGCAGCCAGAGAACTGGAAATTAAACATATTCCATCTGACGGTCAT
TGTATGTATGGGGCACTTGAGGATCAGCTAAGAGAACAAGACTCTGCTCTGACTGTGGCTACCCTAAGGAGGCAGACTGCTGAGTACATGCAGAGCCATTCAGACGACTTCCTGCCATTCCTAACCAA
CCCCAACACAGGAGACATGTACACTCCAGAAGAGTTTGGAAAGTACTGTGACGATATTGTAAACACGGCCGCGTGGGGTGGTCAGCTTGAGCTAAGAGCTCTGTCTCACATCTTAAAGACACCGATCG
AGATACTACAGGCAGATGCTCCTCCTATTATAGTTGGTGAAGAGTATCCAAGGAATCCATTAGTACTAGTATACATGAGGCATGCGTATGGCTTAGGAGAACATTATAATTCTGTTACACGGAAGAGT
TGAAAGCCGCTGTTCAGAAGCACAGAGCTGTGTGGTAAAATCAGCACAGAAGACTTGTATGTGGAACGACTCATGTTAAATCACTT

hide sequence

RefSeq Acc Id:

XM_039109423 ⟹ XP_038965351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	32,979,190 - 33,011,781 (-)	NCBI
mRatBN7.2	5	28,181,992 - 28,214,486 (-)	NCBI

RefSeq Acc Id:

XM_063287293 ⟹ XP_063143363

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	32,979,190 - 33,007,857 (-)	NCBI

RefSeq Acc Id:

XM_063287294 ⟹ XP_063143364

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	32,994,562 - 33,004,946 (-)	NCBI


Protein RefSeqs	NP_001100109	(Get FASTA)	NCBI Sequence Viewer
	XP_006237976	(Get FASTA)	NCBI Sequence Viewer
	XP_038965351	(Get FASTA)	NCBI Sequence Viewer
	XP_063143363	(Get FASTA)	NCBI Sequence Viewer
	XP_063143364	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL98465	(Get FASTA)	NCBI Sequence Viewer
	EDL98466	(Get FASTA)	NCBI Sequence Viewer
	EDL98467	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008726
	ENSRNOP00000008726.7
	ENSRNOP00000076236
	ENSRNOP00000076236.2
	ENSRNOP00000076285.2
	ENSRNOP00000086210.1

RefSeq Acc Id:

NP_001100109 ⟸ NM_001106639

- UniProtKB:

A6II95 (UniProtKB/TrEMBL), A0A1W2Q6D9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAPRVRVEGWEALACLRCRTPPARVPGHLVVMEEILAEELDDEEQLMRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQKHREELEQLKLTFKDSKIDSVAVNVSNLVLDSQPPR
ISKAQKRREKKAALEKEREERIAEAEIENLSGARHLESEKLAQILAARELEIKHIPSDGHCMYGALEDQLREQDSALTVATLRRQTAEYMQSHSDDFLPFLTNPNTGDMYTPEEFGKYCDDIVNTAAW
GGQLELRALSHILKTPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYNSVTRLVNSTTENCS

hide sequence

RefSeq Acc Id:	XP_006237976 ⟸ XM_006237914
- Peptide Label:	isoform X2
- UniProtKB:	D3ZGY2 (UniProtKB/TrEMBL), A0A1W2Q6D9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPRVRVEGWEALACLRCRTPPARVPGHLVVMEEILAEELDDEEQLMRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEREMEQKHREELEQLKLTFKDSKIDSVAVNVSNLVLDSQPPR ISKAQKRREKKAALEKEREERIAEAEIENLSGARHLESEKLAQILAARELEIKHIPSDGHCMYGALEDQLREQDSALTVATLRRQTAEYMQSHSDDFLPFLTNPNTGDMYTPEEFGKYCDDIVNTAAW GGQLELRALSHILKTPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYNSVTRKS hide sequence

Ensembl Acc Id:

ENSRNOP00000008726 ⟸ ENSRNOT00000008725

Ensembl Acc Id:

ENSRNOP00000076236 ⟸ ENSRNOT00000093698

RefSeq Acc Id:	XP_038965351 ⟸ XM_039109423
- Peptide Label:	isoform X1
- UniProtKB:	A0A1W2Q6I2 (UniProtKB/TrEMBL), A0A1W2Q6D9 (UniProtKB/TrEMBL)

Protein Domains

OTU

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZGY2-F1-model_v2	AlphaFold	D3ZGY2	1-285	view protein structure
AF-A0A1W2Q640-F1-model_v2	AlphaFold	A0A1W2Q640	1-347	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693581

Promoter ID:

EPDNEW_R4100

Type:

initiation region

Name:

Otud6b_1

Description:

OTU domain containing 6B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	28,349,906 - 28,349,966	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-41885	BioCyc
Ensembl Genes	ENSRNOG00000006636	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008725	ENTREZGENE
	ENSRNOT00000008725.8	UniProtKB/TrEMBL
	ENSRNOT00000093302.2	UniProtKB/TrEMBL
	ENSRNOT00000093698	ENTREZGENE
	ENSRNOT00000093698.2	UniProtKB/TrEMBL
	ENSRNOT00000111015.1	UniProtKB/TrEMBL
Gene3D-CATH	3.90.70.80	UniProtKB/TrEMBL
InterPro	OTU	UniProtKB/TrEMBL
	OTU_OTUD6	UniProtKB/TrEMBL
	OTU_ubiquitin_thioesterase	UniProtKB/TrEMBL
	Papain_like_cys_pep_sf	UniProtKB/TrEMBL
KEGG Report	rno:297911	UniProtKB/TrEMBL
NCBI Gene	297911	ENTREZGENE
PANTHER	DEUBIQUITINASE OTUD6B	UniProtKB/TrEMBL
	OTU DOMAIN CONTAINING PROTEIN	UniProtKB/TrEMBL
Pfam	OTU	UniProtKB/TrEMBL
PhenoGen	Otud6b	PhenoGen
PROSITE	OTU	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006636	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/TrEMBL
UniProt	A0A1W2Q6D9	ENTREZGENE, UniProtKB/TrEMBL
	A0A1W2Q6I2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A6P1_RAT	UniProtKB/TrEMBL
	A6II95	ENTREZGENE, UniProtKB/TrEMBL
	D3ZGY2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-09	Otud6b	OTU deubiquitinase 6B	Otud6b	OTU domain containing 6B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Otud6b	OTU domain containing 6B	Otud6b_predicted	OTU domain containing 6B (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Otud6b_predicted	OTU domain containing 6B (predicted)	RGD1310024_predicted	similar to RIKEN cDNA 2600013N14 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1310024_predicted	similar to RIKEN cDNA 2600013N14 (predicted)	LOC297911_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC297911_predicted	similar to RIKEN cDNA 2600013N14 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM