Symbol:
Gsta4
Name:
glutathione S-transferase alpha 4
RGD ID:
1309970
Description:
Enables toxic substance binding activity. Involved in several processes, including cellular response to lithium ion; response to herbicide; and response to zinc ion. Predicted to be located in cytosol and mitochondrion. Orthologous to human GSTA4 (glutathione S-transferase alpha 4); PARTICIPATES IN glutathione conjugation pathway; glutathione metabolic pathway; phase I biotransformation pathway via cytochrome P450; INTERACTS WITH (+)-schisandrin B; (E)-4-hydroxynon-2-enal; (S)-nicotine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glutathione S-transferase A4; glutathione S-transferase alpha-4; glutathione S-transferase Yk; glutathione S-transferase, alpha 4; glutathione transferase; GST 8-8; GST A4-4; GST K; GST Yk; LOC300850
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Gsta4-ps2
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 87,947,247 - 87,964,490 (+) NCBI GRCr8 mRatBN7.2 8 79,066,967 - 79,084,193 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 79,066,934 - 79,084,182 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 84,554,453 - 84,571,445 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 82,831,109 - 82,848,101 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 80,653,832 - 80,670,824 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 85,497,557 - 85,514,732 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 85,497,557 - 85,518,879 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 85,062,036 - 85,078,502 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 83,165,139 - 83,183,055 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 78,811,797 - 78,829,038 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gsta4 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GSTA4 mRNA] CTD PMID:31150632 Gsta4 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GSTA4 mRNA CTD PMID:22079256 Gsta4 Rat (E)-4-hydroxynon-2-enal affects binding EXP 1641942 (E)-4-hydroxynon-2-enal binds to Gsta4 protein RGD Gsta4 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of GSTA4 mRNA CTD PMID:9774145 Gsta4 Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of GSTA4 mRNA CTD PMID:9774145 Gsta4 Rat (S)-nicotine increases activity EXP 6480464 Nicotine results in increased activity of GSTA4 protein CTD PMID:9774145 Gsta4 Rat 1-chloro-2,4-dinitrobenzene affects binding EXP 1641942 1-chloro-2 4-dinitrobenzene binds to Gsta4 protein RGD Gsta4 Rat 1-chloro-2,4-dinitrobenzene affects metabolic processing EXP 6480464 GSTA4 protein affects the metabolism of Dinitrochlorobenzene CTD PMID:2619714 Gsta4 Rat 1-chloro-2,4-dinitrobenzene multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [GSTA1 protein binds to GSTA4 protein] which affects the metabolism of Dinitrochlorobenzene and [GSTA4 protein binds to GSTA4 protein] which affects the metabolism of Dinitrochlorobenzene CTD PMID:11851347 Gsta4 Rat 13-oxo-9,11-octadecadienoic acid affects metabolic processing ISO GSTA4 (Homo sapiens) 6480464 GSTA4 protein affects the metabolism of 13-oxo-9 and 11-octadecadienoic acid CTD PMID:12031293 Gsta4 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of GSTA4 mRNA CTD PMID:15212814 Gsta4 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of GSTA4 mRNA CTD PMID:17557909 Gsta4 Rat 17beta-estradiol multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of GSTA4 mRNA CTD PMID:30165855 Gsta4 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of GSTA4 mRNA CTD PMID:32145629 Gsta4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSTA4 protein CTD PMID:16548065 Gsta4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GSTA4 mRNA CTD PMID:16054898 more ... Gsta4 Rat 2-hexenal increases expression EXP 6480464 2-hexenal results in increased expression of GSTA4 mRNA and 2-hexenal results in increased expression of GSTA4 protein CTD PMID:9799558 Gsta4 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of GSTA4 mRNA CTD PMID:28522335 Gsta4 Rat 4,4'-sulfonyldiphenol increases expression ISO GSTA4 (Homo sapiens) 6480464 bisphenol S results in increased expression of GSTA4 protein CTD PMID:24793377 Gsta4 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of GSTA4 mRNA CTD PMID:9774145 Gsta4 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one decreases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in decreased expression of GSTA4 mRNA CTD PMID:9774145 Gsta4 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases activity EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased activity of GSTA4 protein CTD PMID:9774145 Gsta4 Rat 4-hydroxynon-2-enal multiple interactions ISO GSTA4 (Homo sapiens) 6480464 GSTA4 protein binds to and affects the metabolism of 4-hydroxy-2-nonenal CTD PMID:15829614 Gsta4 Rat 4-hydroxynon-2-enal increases expression EXP 6480464 4-hydroxy-2-nonenal results in increased expression of GSTA4 mRNA and 4-hydroxy-2-nonenal results in increased expression of GSTA4 protein CTD PMID:9799558 Gsta4 Rat 4-hydroxynon-2-enal affects metabolic processing EXP 6480464 GSTA4 protein affects the metabolism of 4-hydroxy-2-nonenal and GSTA4 protein affects the metabolism of 4-hydroxy-2-nonenal analog CTD PMID:11256969 more ... Gsta4 Rat 4-hydroxynon-2-enal affects metabolic processing ISO GSTA4 (Homo sapiens) 6480464 GSTA4 protein affects the metabolism of 4-hydroxy-2-nonenal CTD PMID:10514034 more ... Gsta4 Rat 4-phenylbutyric acid increases expression ISO GSTA4 (Homo sapiens) 6480464 4-phenylbutyric acid results in increased expression of GSTA4 mRNA CTD PMID:14583596 Gsta4 Rat 5-aza-2'-deoxycytidine affects expression ISO GSTA4 (Homo sapiens) 6480464 Decitabine affects the expression of GSTA4 mRNA CTD PMID:23300844 Gsta4 Rat 5-fluorouracil affects response to substance ISO GSTA4 (Homo sapiens) 6480464 GSTA4 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Gsta4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GSTA4 mRNA CTD PMID:24780913 Gsta4 Rat acrolein increases expression EXP 6480464 Acrolein results in increased expression of GSTA4 mRNA and Acrolein results in increased expression of GSTA4 protein CTD PMID:9799558 Gsta4 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of GSTA4 mRNA CTD PMID:28959563 Gsta4 Rat aflatoxin B1 affects response to substance ISO GSTA4 (Homo sapiens) 6480464 GSTA4 gene SNP affects the susceptibility to Aflatoxin B1 CTD PMID:12907637 Gsta4 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of GSTA4 mRNA CTD PMID:33354967 Gsta4 Rat Allylamine decreases response to substance EXP 6480464 GSTA4 protein results in decreased susceptibility to Allylamine CTD PMID:10406932 Gsta4 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of GSTA4 mRNA CTD PMID:38685447 Gsta4 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of GSTA4 mRNA CTD PMID:18178546 Gsta4 Rat arsane multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSTA4 mRNA and [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of GSTA4 mRNA CTD PMID:32525701 and PMID:39836092 Gsta4 Rat arsenic atom multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSTA4 mRNA and [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of GSTA4 mRNA CTD PMID:32525701 and PMID:39836092 Gsta4 Rat arsenite(3-) affects expression ISO GSTA4 (Homo sapiens) 6480464 arsenite affects the expression of GSTA4 mRNA CTD PMID:22959463 Gsta4 Rat arsenite(3-) increases methylation ISO GSTA4 (Homo sapiens) 6480464 arsenite results in increased methylation of GSTA4 promoter CTD PMID:23974009 Gsta4 Rat benzo[a]pyrene increases expression ISO GSTA4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of GSTA4 mRNA CTD PMID:32890658 Gsta4 Rat benzo[a]pyrene increases methylation ISO GSTA4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GSTA4 5' UTR CTD PMID:27901495 Gsta4 Rat beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of GSTA4 protein CTD PMID:9794803 Gsta4 Rat bilirubin IXalpha decreases expression ISO GSTA4 (Homo sapiens) 6480464 Bilirubin results in decreased expression of GSTA4 mRNA CTD PMID:20196124 Gsta4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GSTA4 mRNA CTD PMID:25181051 more ... Gsta4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GSTA4 mRNA CTD PMID:32145629 Gsta4 Rat bisphenol A affects expression ISO GSTA4 (Homo sapiens) 6480464 bisphenol A affects the expression of GSTA4 mRNA CTD PMID:30903817 Gsta4 Rat bucladesine increases expression ISO GSTA4 (Homo sapiens) 6480464 Bucladesine results in increased expression of GSTA4 mRNA CTD PMID:26049102 Gsta4 Rat bucladesine multiple interactions ISO GSTA4 (Homo sapiens) 6480464 KT 5720 inhibits the reaction [Bucladesine results in increased expression of GSTA4 mRNA] CTD PMID:26049102 Gsta4 Rat butyric acid increases expression ISO GSTA4 (Homo sapiens) 6480464 Butyric Acid results in increased expression of GSTA4 mRNA CTD PMID:30439556 Gsta4 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of GSTA4 protein CTD PMID:21699967 Gsta4 Rat cadmium dichloride decreases expression ISO GSTA4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of GSTA4 protein CTD PMID:26220685 Gsta4 Rat CGP 52608 multiple interactions ISO GSTA4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GSTA4 gene] CTD PMID:28238834 Gsta4 Rat chenodeoxycholic acid multiple interactions EXP 6480464 Chenodeoxycholic Acid binds to and results in decreased activity of GSTA4 protein CTD PMID:3954743 Gsta4 Rat chenodeoxycholic acid multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of GSTA4 mRNA more ... CTD PMID:33819548 Gsta4 Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of GSTA4 mRNA CTD PMID:30744511 Gsta4 Rat chlorpyrifos affects expression EXP 6480464 Chlorpyrifos affects the expression of GSTA4 mRNA CTD PMID:19440498 Gsta4 Rat chlorpyrifos decreases expression ISO GSTA4 (Homo sapiens) 6480464 Chlorpyrifos results in decreased expression of GSTA4 mRNA CTD PMID:33011216 Gsta4 Rat cholic acid multiple interactions EXP 6480464 Cholic Acid binds to and results in decreased activity of GSTA4 protein CTD PMID:3954743 Gsta4 Rat chromium(6+) decreases expression ISO GSTA4 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of GSTA4 mRNA CTD PMID:30690063 Gsta4 Rat cisplatin affects expression ISO GSTA4 (Homo sapiens) 6480464 Cisplatin affects the expression of GSTA4 mRNA CTD PMID:23300844 Gsta4 Rat cisplatin multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of GSTA4 mRNA CTD PMID:27392435 Gsta4 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of GSTA4 protein CTD PMID:20180811 Gsta4 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of GSTA4 protein CTD PMID:16470657 Gsta4 Rat cobalt dichloride decreases expression ISO GSTA4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of GSTA4 mRNA CTD PMID:19376846 Gsta4 Rat copper atom multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of GSTA4 mRNA CTD PMID:20971185 Gsta4 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of GSTA4 mRNA CTD PMID:30556269 Gsta4 Rat copper(0) multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of GSTA4 mRNA CTD PMID:20971185 Gsta4 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of GSTA4 mRNA CTD PMID:30556269 Gsta4 Rat copper(II) sulfate decreases expression ISO GSTA4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GSTA4 mRNA CTD PMID:19549813 Gsta4 Rat curcumin increases activity ISO GSTA4 (Homo sapiens) 6480464 Curcumin results in increased activity of GSTA4 protein CTD PMID:10514034 Gsta4 Rat Cyanoginosin increases expression EXP 6480464 microcystin results in increased expression of GSTA4 mRNA CTD PMID:19135122 Gsta4 Rat cyclosporin A decreases expression ISO GSTA4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GSTA4 mRNA CTD PMID:20106945 more ... Gsta4 Rat cypermethrin increases expression EXP 6480464 cypermethrin results in increased expression of GSTA4 mRNA CTD PMID:20815782 Gsta4 Rat deoxycholic acid multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of GSTA4 mRNA more ... CTD PMID:33819548 Gsta4 Rat Diallyl sulfide increases expression EXP 6480464 allyl sulfide results in increased expression of GSTA4 mRNA CTD PMID:19695238 Gsta4 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of GSTA4 mRNA CTD PMID:17452286 Gsta4 Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of GSTA4 mRNA CTD PMID:19440498 Gsta4 Rat dichlorine decreases expression EXP 6480464 Chlorine results in decreased expression of GSTA4 mRNA CTD PMID:18636392 Gsta4 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of GSTA4 mRNA CTD PMID:18636392 Gsta4 Rat diclofenac decreases activity ISO GSTA4 (Homo sapiens) 6480464 Diclofenac results in decreased activity of GSTA4 protein CTD PMID:27183920 Gsta4 Rat dicrotophos decreases expression ISO GSTA4 (Homo sapiens) 6480464 dicrotophos results in decreased expression of GSTA4 mRNA CTD PMID:28302478 Gsta4 Rat dimethylarsinic acid increases expression ISO GSTA4 (Homo sapiens) 6480464 Cacodylic Acid results in increased expression of GSTA4 mRNA CTD PMID:17720352 Gsta4 Rat dinophysistoxin 1 decreases expression ISO GSTA4 (Homo sapiens) 6480464 dinophysistoxin 1 results in decreased expression of GSTA4 mRNA CTD PMID:28939011 Gsta4 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of GSTA4 mRNA CTD PMID:21551480 Gsta4 Rat doxorubicin affects response to substance ISO GSTA4 (Homo sapiens) 6480464 GSTA4 protein affects the susceptibility to Doxorubicin CTD PMID:18225754 Gsta4 Rat doxorubicin decreases expression ISO GSTA4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GSTA4 mRNA CTD PMID:29803840 Gsta4 Rat ellagic acid increases expression ISO GSTA4 (Homo sapiens) 6480464 Ellagic Acid results in increased expression of GSTA4 mRNA CTD PMID:12002526 Gsta4 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of GSTA4 mRNA CTD PMID:29391264 Gsta4 Rat etacrynic acid affects metabolic processing EXP 6480464 GSTA4 protein affects the metabolism of Ethacrynic Acid CTD PMID:2619714 Gsta4 Rat etacrynic acid increases expression EXP 6480464 Ethacrynic Acid results in increased expression of GSTA4 mRNA and Ethacrynic Acid results in increased expression of GSTA4 protein CTD PMID:9799558 Gsta4 Rat ethanol decreases expression ISO GSTA4 (Homo sapiens) 6480464 Ethanol results in decreased expression of GSTA4 mRNA CTD PMID:28986285 Gsta4 Rat ethoxyquin increases expression EXP 6480464 Ethoxyquin results in increased expression of GSTA4 mRNA and Ethoxyquin results in increased expression of GSTA4 protein CTD PMID:19695238 and PMID:9794803 Gsta4 Rat EUK-134 multiple interactions EXP 6480464 [Acetylcysteine co-treated with EUK-134] promotes the reaction [[Zinc Sulfate co-treated with Paraquat] results in increased activity of GSTA4 protein] more ... CTD PMID:25724285 Gsta4 Rat fenitrothion multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Fenitrothion results in decreased expression of GSTA4 mRNA] CTD PMID:30639957 Gsta4 Rat fenitrothion decreases expression EXP 6480464 Fenitrothion results in decreased expression of GSTA4 mRNA CTD PMID:30639957 Gsta4 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of GSTA4 mRNA CTD PMID:23962444 Gsta4 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of GSTA4 mRNA CTD PMID:24136188 Gsta4 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of GSTA4 mRNA CTD PMID:24793618 Gsta4 Rat gamma-glutamyl-glutathione multiple interactions EXP 6480464 GSTA4 protein binds to and affects the metabolism of gamma-glutamyl-glutathione CTD PMID:2619714 Gsta4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of GSTA4 protein CTD PMID:22061828 Gsta4 Rat glutathione affects metabolic processing ISO GSTA4 (Homo sapiens) 6480464 GSTA4 protein affects the metabolism of Glutathione CTD PMID:14727915 Gsta4 Rat glutathione multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [GSTA4 protein co-treated with Glutathione] results in increased metabolism of amodiaquine quinoneimine and [GSTA4 protein co-treated with Glutathione] results in increased metabolism of desethylamodiaquine CTD PMID:28478157 Gsta4 Rat glutathione affects metabolic processing EXP 6480464 GSTA4 protein affects the metabolism of Glutathione CTD PMID:14727915 Gsta4 Rat glycochenodeoxycholic acid multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of GSTA4 mRNA more ... CTD PMID:33819548 Gsta4 Rat glycocholic acid multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of GSTA4 mRNA more ... CTD PMID:33819548 Gsta4 Rat glycodeoxycholic acid multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of GSTA4 mRNA more ... CTD PMID:33819548 Gsta4 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of GSTA4 mRNA CTD PMID:21396975 Gsta4 Rat indole-3-methanol increases expression EXP 6480464 indole-3-carbinol results in increased expression of GSTA4 protein CTD PMID:9794803 Gsta4 Rat inulin multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Inulin metabolite co-treated with oligofructose metabolite] results in increased expression of GSTA4 mRNA CTD PMID:23225440 Gsta4 Rat iodide salt decreases expression EXP 6480464 Iodides deficiency results in decreased expression of GSTA4 protein CTD PMID:26795019 Gsta4 Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of GSTA4 mRNA CTD PMID:20097248 Gsta4 Rat iron atom multiple interactions EXP 6480464 Iron results in increased expression of and results in increased activity of GSTA4 protein CTD PMID:7878679 Gsta4 Rat iron(0) multiple interactions EXP 6480464 Iron results in increased expression of and results in increased activity of GSTA4 protein CTD PMID:7878679 Gsta4 Rat kojic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid] results in increased expression of GSTA4 mRNA CTD PMID:18544905 Gsta4 Rat KT 5720 multiple interactions ISO GSTA4 (Homo sapiens) 6480464 KT 5720 inhibits the reaction [Bucladesine results in increased expression of GSTA4 mRNA] CTD PMID:26049102 Gsta4 Rat L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Potassium Dichromate results in decreased expression of GSTA4 mRNA] CTD PMID:23470461 Gsta4 Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of GSTA4 mRNA CTD PMID:21864555 Gsta4 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of GSTA4 protein CTD PMID:7878682 and PMID:9750042 Gsta4 Rat lead(0) decreases expression EXP 6480464 Lead results in decreased expression of GSTA4 protein CTD PMID:22129743 Gsta4 Rat lead(0) affects splicing ISO GSTA4 (Homo sapiens) 6480464 Lead affects the splicing of GSTA4 mRNA CTD PMID:28903495 Gsta4 Rat lead(0) multiple interactions EXP 6480464 Plant Extracts inhibits the reaction [Lead results in decreased expression of GSTA4 protein] CTD PMID:22129743 Gsta4 Rat leflunomide decreases expression ISO GSTA4 (Homo sapiens) 6480464 leflunomide results in decreased expression of GSTA4 mRNA CTD PMID:28988120 Gsta4 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of GSTA4 mRNA CTD PMID:24136188 Gsta4 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of GSTA4 mRNA CTD PMID:18082333 Gsta4 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of GSTA4 mRNA CTD PMID:18082333 Gsta4 Rat lithocholic acid multiple interactions EXP 6480464 Lithocholic Acid binds to and results in decreased activity of GSTA4 protein CTD PMID:3954743 Gsta4 Rat lithocholic acid increases expression EXP 6480464 Lithocholic Acid results in increased expression of GSTA4 mRNA CTD PMID:21311750 Gsta4 Rat lithocholic acid sulfate multiple interactions EXP 6480464 sulfolithocholic acid binds to and results in decreased activity of GSTA4 protein CTD PMID:3954743 Gsta4 Rat maneb increases activity EXP 6480464 Maneb results in increased activity of GSTA4 protein CTD PMID:20888808 Gsta4 Rat maneb multiple interactions EXP 6480464 [Paraquat co-treated with Maneb] results in increased expression of and results in increased activity of GSTA4 protein more ... CTD PMID:23159886 Gsta4 Rat maneb increases expression EXP 6480464 Maneb results in increased expression of GSTA4 mRNA and Maneb results in increased expression of GSTA4 protein CTD PMID:20888808 and PMID:23159886 Gsta4 Rat manganese atom multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSTA4 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of GSTA4 mRNA CTD PMID:39836092 Gsta4 Rat manganese(0) multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSTA4 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of GSTA4 mRNA CTD PMID:39836092 Gsta4 Rat manganese(II) chloride multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSTA4 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of GSTA4 mRNA CTD PMID:39836092 Gsta4 Rat menadione affects expression ISO GSTA4 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of GSTA4 mRNA CTD PMID:20044591 Gsta4 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of GSTA4 mRNA CTD PMID:30467583 Gsta4 Rat methylmercury chloride decreases expression ISO GSTA4 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of GSTA4 mRNA CTD PMID:28001369 Gsta4 Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of GSTA4 mRNA CTD PMID:30744511 Gsta4 Rat microcystin decreases expression EXP 6480464 Microcystins results in decreased expression of GSTA4 mRNA CTD PMID:19790251 Gsta4 Rat microcystin increases expression EXP 6480464 Microcystins results in increased expression of GSTA4 mRNA CTD PMID:19790251 Gsta4 Rat mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of GSTA4 mRNA CTD PMID:22087261 Gsta4 Rat N-acetyl-beta-D-glucosamine increases expression ISO GSTA4 (Homo sapiens) 6480464 Acetylglucosamine results in increased expression of GSTA4 mRNA CTD PMID:18047607 Gsta4 Rat N-acetyl-D-glucosamine increases expression ISO GSTA4 (Homo sapiens) 6480464 Acetylglucosamine results in increased expression of GSTA4 mRNA CTD PMID:18047607 Gsta4 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [Acetylcysteine co-treated with EUK-134] promotes the reaction [[Zinc Sulfate co-treated with Paraquat] results in increased activity of GSTA4 protein] more ... CTD PMID:23159886 more ... Gsta4 Rat N-hydroxy-PhIP increases expression EXP 6480464 2-hydroxyamino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of GSTA4 protein CTD PMID:17122891 Gsta4 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid] results in increased expression of GSTA4 mRNA and [Phenobarbital co-treated with Diethylnitrosamine] results in increased expression of GSTA4 protein CTD PMID:18544905 and PMID:20935162 Gsta4 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of GSTA4 protein CTD PMID:19716841 Gsta4 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of GSTA4 mRNA CTD PMID:24136188 Gsta4 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of GSTA4 mRNA CTD PMID:9774145 Gsta4 Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of GSTA4 mRNA CTD PMID:9774145 Gsta4 Rat nicotine increases activity EXP 6480464 Nicotine results in increased activity of GSTA4 protein CTD PMID:9774145 Gsta4 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of GSTA4 mRNA CTD PMID:24136188 Gsta4 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of GSTA4 mRNA CTD PMID:33484710 Gsta4 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of GSTA4 mRNA CTD PMID:23358140 Gsta4 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of GSTA4 mRNA CTD PMID:25729387 Gsta4 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of GSTA4 mRNA CTD PMID:25729387 Gsta4 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of GSTA4 mRNA CTD PMID:18636392 Gsta4 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of GSTA4 mRNA CTD PMID:27638505 Gsta4 Rat paracetamol decreases expression ISO GSTA4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GSTA4 mRNA CTD PMID:29067470 Gsta4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of GSTA4 mRNA CTD PMID:33387578 Gsta4 Rat paracetamol multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of GSTA4 mRNA CTD PMID:33819548 Gsta4 Rat paraquat multiple interactions EXP 6480464 [Acetylcysteine co-treated with EUK-134] promotes the reaction [[Zinc Sulfate co-treated with Paraquat] results in increased activity of GSTA4 protein] more ... CTD PMID:20553223 more ... Gsta4 Rat paraquat increases activity EXP 6480464 Paraquat results in increased activity of GSTA4 protein CTD PMID:20888808 and PMID:25724285 Gsta4 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of GSTA4 mRNA and Paraquat results in increased expression of GSTA4 protein CTD PMID:20553223 more ... Gsta4 Rat perfluorononanoic acid decreases expression ISO GSTA4 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of GSTA4 mRNA CTD PMID:32588087 Gsta4 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of GSTA4 mRNA CTD PMID:19162173 Gsta4 Rat phenobarbital decreases expression ISO GSTA4 (Homo sapiens) 6480464 Phenobarbital results in decreased expression of GSTA4 mRNA CTD PMID:19084549 Gsta4 Rat phenobarbital multiple interactions EXP 6480464 [Phenobarbital co-treated with Diethylnitrosamine] results in increased expression of GSTA4 protein CTD PMID:20935162 Gsta4 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of GSTA4 mRNA and Phenobarbital results in increased expression of GSTA4 protein CTD PMID:19162173 and PMID:9794803 Gsta4 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of GSTA4 mRNA CTD PMID:33945839 Gsta4 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of GSTA4 mRNA CTD PMID:22484513 Gsta4 Rat potassium chromate multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of GSTA4 mRNA CTD PMID:22079256 Gsta4 Rat potassium chromate decreases expression ISO GSTA4 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of GSTA4 mRNA CTD PMID:22079256 and PMID:22714537 Gsta4 Rat potassium dichromate decreases expression EXP 6480464 Potassium Dichromate results in decreased expression of GSTA4 mRNA CTD PMID:23470461 Gsta4 Rat potassium dichromate multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Potassium Dichromate results in decreased expression of GSTA4 mRNA] CTD PMID:23470461 Gsta4 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of GSTA4 mRNA CTD PMID:19162173 Gsta4 Rat pyrazinecarboxamide increases expression EXP 6480464 Pyrazinamide results in increased expression of GSTA4 mRNA CTD PMID:22431067 Gsta4 Rat quercetin decreases expression ISO GSTA4 (Homo sapiens) 6480464 Quercetin results in decreased expression of GSTA4 mRNA CTD PMID:21632981 Gsta4 Rat reactive oxygen species affects expression ISO GSTA4 (Homo sapiens) 6480464 Reactive Oxygen Species affects the expression of GSTA4 mRNA CTD PMID:25800948 Gsta4 Rat resveratrol increases expression ISO GSTA4 (Homo sapiens) 6480464 resveratrol results in increased expression of GSTA4 mRNA CTD PMID:12002526 Gsta4 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of GSTA4 mRNA CTD PMID:28374803 Gsta4 Rat sarin decreases expression ISO GSTA4 (Homo sapiens) 6480464 Sarin results in decreased expression of GSTA4 mRNA CTD PMID:19522546 Gsta4 Rat senecionine decreases expression ISO GSTA4 (Homo sapiens) 6480464 senecionine results in decreased expression of GSTA4 mRNA CTD PMID:26100227 Gsta4 Rat silicon dioxide decreases expression ISO GSTA4 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of GSTA4 mRNA CTD PMID:25895662 Gsta4 Rat silver atom decreases expression ISO GSTA4 (Homo sapiens) 6480464 Silver results in decreased expression of GSTA4 mRNA CTD PMID:26551752 Gsta4 Rat silver(0) decreases expression ISO GSTA4 (Homo sapiens) 6480464 Silver results in decreased expression of GSTA4 mRNA CTD PMID:26551752 Gsta4 Rat sodium arsenate multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of GSTA4 mRNA CTD PMID:32525701 Gsta4 Rat sodium arsenite decreases expression ISO GSTA4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GSTA4 mRNA CTD PMID:38568856 Gsta4 Rat sodium arsenite multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GSTA4 mRNA CTD PMID:39836092 Gsta4 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of GSTA4 mRNA CTD PMID:27257137 Gsta4 Rat stilbene oxide increases expression EXP 6480464 stilbene oxide results in increased expression of GSTA4 protein CTD PMID:9794803 Gsta4 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of GSTA4 protein CTD PMID:14693714 Gsta4 Rat sunitinib decreases expression ISO GSTA4 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GSTA4 mRNA CTD PMID:31533062 Gsta4 Rat Sunset Yellow FCF multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with 6-hydroxy-5-((p- sulfophenyl)azo)-2-naphthalenesulfonic acid disodium salt] results in increased expression of GSTA4 mRNA CTD PMID:33819548 Gsta4 Rat tartrazine multiple interactions ISO GSTA4 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in decreased expression of GSTA4 mRNA CTD PMID:33819548 Gsta4 Rat temozolomide increases expression ISO GSTA4 (Homo sapiens) 6480464 Temozolomide results in increased expression of GSTA4 mRNA CTD PMID:31758290 Gsta4 Rat tert-butyl hydroperoxide decreases expression ISO GSTA4 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of GSTA4 mRNA CTD PMID:15336504 and PMID:31627909 Gsta4 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GSTA4 mRNA] CTD PMID:31150632 Gsta4 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GSTA4 mRNA CTD PMID:31150632 Gsta4 Rat thiram decreases expression ISO GSTA4 (Homo sapiens) 6480464 Thiram results in decreased expression of GSTA4 mRNA CTD PMID:38568856 Gsta4 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of GSTA4 mRNA CTD PMID:25729387 Gsta4 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of GSTA4 mRNA CTD PMID:25729387 Gsta4 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of GSTA4 mRNA CTD PMID:33387578 Gsta4 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of GSTA4 mRNA CTD PMID:30589522 Gsta4 Rat urethane decreases expression ISO GSTA4 (Homo sapiens) 6480464 Urethane results in decreased expression of GSTA4 mRNA CTD PMID:28818685 Gsta4 Rat valproic acid decreases expression ISO GSTA4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GSTA4 mRNA CTD PMID:23179753 Gsta4 Rat valproic acid affects expression ISO GSTA4 (Homo sapiens) 6480464 Valproic Acid affects the expression of GSTA4 mRNA CTD PMID:25979313 Gsta4 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of GSTA4 mRNA CTD PMID:20566332 Gsta4 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of GSTA4 gene CTD PMID:31079544 Gsta4 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of GSTA4 mRNA CTD PMID:11717422 Gsta4 Rat zinc sulfate multiple interactions EXP 6480464 [Acetylcysteine co-treated with EUK-134] promotes the reaction [[Zinc Sulfate co-treated with Paraquat] results in increased activity of GSTA4 protein] more ... CTD PMID:20553223 and PMID:25724285 Gsta4 Rat zinc sulfate increases expression EXP 6480464 Zinc Sulfate results in increased expression of GSTA4 mRNA CTD PMID:20553223 and PMID:25724285 Gsta4 Rat zinc sulfate increases activity EXP 6480464 Zinc Sulfate results in increased activity of GSTA4 protein CTD PMID:25724285 Gsta4 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of GSTA4 mRNA CTD PMID:11717422
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (E)-4-hydroxynon-2-enal (EXP) (S)-nicotine (EXP) 1-chloro-2,4-dinitrobenzene (EXP,ISO) 13-oxo-9,11-octadecadienoic acid (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-hexenal (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-hydroxynon-2-enal (EXP,ISO) 4-phenylbutyric acid (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrolein (EXP) acrylamide (EXP) aflatoxin B1 (EXP,ISO) Allylamine (EXP) amitrole (EXP) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bilirubin IXalpha (ISO) bisphenol A (EXP,ISO) bucladesine (ISO) butyric acid (ISO) cadmium dichloride (EXP,ISO) CGP 52608 (ISO) chenodeoxycholic acid (EXP,ISO) chlorohydrocarbon (EXP) chlorpyrifos (EXP,ISO) cholic acid (EXP) chromium(6+) (ISO) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) curcumin (ISO) Cyanoginosin (EXP) cyclosporin A (ISO) cypermethrin (EXP) deoxycholic acid (ISO) Diallyl sulfide (EXP) diazinon (EXP) dichlorine (EXP) diclofenac (ISO) dicrotophos (ISO) dimethylarsinic acid (ISO) dinophysistoxin 1 (ISO) diuron (EXP) doxorubicin (ISO) ellagic acid (ISO) endosulfan (EXP) etacrynic acid (EXP) ethanol (ISO) ethoxyquin (EXP) EUK-134 (EXP) fenitrothion (EXP) fipronil (EXP) flutamide (EXP) gamma-glutamyl-glutathione (EXP) gentamycin (EXP) glutathione (EXP,ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) indole-3-methanol (EXP) inulin (ISO) iodide salt (EXP) irinotecan (EXP) iron atom (EXP) iron(0) (EXP) kojic acid (EXP) KT 5720 (ISO) L-ascorbic acid (EXP) lead diacetate (EXP) lead(0) (EXP,ISO) leflunomide (EXP,ISO) lithium atom (EXP) lithium hydride (EXP) lithocholic acid (EXP) lithocholic acid sulfate (EXP) maneb (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) methapyrilene (EXP) methylmercury chloride (EXP,ISO) microcystin (EXP) mono(2-ethylhexyl) phthalate (EXP) N-acetyl-beta-D-glucosamine (ISO) N-acetyl-D-glucosamine (ISO) N-acetyl-L-cysteine (EXP) N-hydroxy-PhIP (EXP) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) nicotine (EXP) nimesulide (EXP) nitrofen (EXP) ochratoxin A (EXP) oxaliplatin (EXP) ozone (EXP) p-toluidine (EXP) paracetamol (EXP,ISO) paraquat (EXP) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (EXP,ISO) PhIP (EXP) piperonyl butoxide (EXP) potassium chromate (ISO) potassium dichromate (EXP) pregnenolone 16alpha-carbonitrile (EXP) pyrazinecarboxamide (EXP) quercetin (ISO) reactive oxygen species (ISO) resveratrol (ISO) rotenone (EXP) sarin (ISO) senecionine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium fluoride (EXP) stilbene oxide (EXP) streptozocin (EXP) sunitinib (ISO) Sunset Yellow FCF (ISO) tartrazine (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thiram (ISO) topotecan (EXP) trichloroethene (EXP) triphenyl phosphate (EXP) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (EXP) zinc sulfate (EXP) zinc(0) (EXP)
1.
Biochemical and molecular mechanisms of N-acetyl cysteine and silymarin-mediated protection against maneb- and paraquat-induced hepatotoxicity in rats.
Ahmad I, etal., Chem Biol Interact. 2013 Jan 25;201(1-3):9-18. doi: 10.1016/j.cbi.2012.10.027. Epub 2012 Nov 16.
2.
Down-regulation of glutatione S-transferase alpha 4 (hGSTA4) in the muscle of thermally injured patients is indicative of susceptibility to bacterial infection.
Apidianakis Y, etal., FASEB J. 2012 Feb;26(2):730-7. Epub 2011 Oct 28.
3.
Preferential effects of nicotine and 4-(N-methyl-N-nitrosamine)-1-(3-pyridyl)-1-butanone on mitochondrial glutathione S-transferase A4-4 induction and increased oxidative stress in the rat brain.
Bhagwat SV, etal., Biochem Pharmacol. 1998 Oct 1;56(7):831-9.
4.
Downregulation of adipose glutathione S-transferase A4 leads to increased protein carbonylation, oxidative stress, and mitochondrial dysfunction.
Curtis JM, etal., Diabetes. 2010 May;59(5):1132-42. Epub 2010 Feb 11.
5.
Selective expression of detoxifying glutathione transferases in mouse colon: effect of experimental colitis and the presence of bacteria.
Edalat M, etal., Histochem Cell Biol. 2004 Aug;122(2):151-9.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Effect of zinc and paraquat co-exposure on neurodegeneration: Modulation of oxidative stress and expression of metallothioneins, toxicant responsive and transporter genes in rats.
Kumar A, etal., Free Radic Res. 2010 Aug;44(8):950-65.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
Elevated mitochondrial cytochrome P450 2E1 and glutathione S-transferase A4-4 in streptozotocin-induced diabetic rats: tissue-specific variations and roles in oxidative stress.
Raza H, etal., Diabetes. 2004 Jan;53(1):185-94.
12.
Characterization of 4-hydroxy-2-nonenal metabolism in stellate cell lines derived from normal and cirrhotic rat liver.
Reichard JF, etal., Biochim Biophys Acta. 2000 Sep 27;1487(2-3):222-32.
13.
GOA pipeline
RGD automated data pipeline
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
The effect of mood stabilizer lithium on expression and activity of glutathione s-transferase isoenzymes.
Shao L, etal., Neuroscience. 2008 Jan 24;151(2):518-24. Epub 2007 Nov 13.
16.
Melatonin or silymarin reduces maneb- and paraquat-induced Parkinson's disease phenotype in the mouse.
Singhal NK, etal., J Pineal Res. 2011 Mar;50(2):97-109. doi: 10.1111/j.1600-079X.2010.00819.x. Epub 2010 Oct 22.
17.
Glutathione S-transferase: genetics and role in toxicology.
Strange RC, etal., Toxicol Lett 2000 Mar 15;112-113:357-63.
18.
Naturally Occurring Genetic Variability in Expression of Gsta4 is Associated with Differential Survival of Axotomized Rat Motoneurons.
Strom M, etal., Neuromolecular Med. 2011 Dec 8.
19.
Protective effect of Phellinus linteus polysaccharide extracts against thioacetamide-induced liver fibrosis in rats: a proteomics analysis.
Wang H, etal., Chin Med. 2012 Oct 18;7(1):23. doi: 10.1186/1749-8546-7-23.
Gsta4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 87,947,247 - 87,964,490 (+) NCBI GRCr8 mRatBN7.2 8 79,066,967 - 79,084,193 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 79,066,934 - 79,084,182 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 84,554,453 - 84,571,445 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 82,831,109 - 82,848,101 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 80,653,832 - 80,670,824 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 85,497,557 - 85,514,732 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 85,497,557 - 85,518,879 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 85,062,036 - 85,078,502 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 83,165,139 - 83,183,055 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 78,811,797 - 78,829,038 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
GSTA4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 52,977,953 - 52,995,284 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 52,977,948 - 52,995,304 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 52,842,751 - 52,860,082 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 52,950,710 - 52,968,099 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 52,950,709 - 52,968,099 NCBI Celera 6 54,504,520 - 54,521,952 (-) NCBI Celera Cytogenetic Map 6 p12.2 NCBI HuRef 6 52,674,221 - 52,691,656 (-) NCBI HuRef CHM1_1 6 52,844,511 - 52,861,941 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 52,817,518 - 52,834,853 (-) NCBI T2T-CHM13v2.0
Gsta4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 78,099,248 - 78,116,631 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 78,090,056 - 78,116,631 (+) Ensembl GRCm39 Ensembl GRCm38 9 78,191,966 - 78,209,349 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 78,182,774 - 78,209,349 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 78,039,773 - 78,057,156 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 77,977,701 - 77,995,033 (+) NCBI MGSCv36 mm8 Celera 9 75,369,930 - 75,387,302 (+) NCBI Celera Cytogenetic Map 9 E1 NCBI cM Map 9 43.65 NCBI
GSTA4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 67,449,101 - 67,466,562 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 63,325,479 - 63,342,938 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 52,532,942 - 52,550,404 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 54,171,609 - 54,189,032 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 54,171,318 - 54,188,976 (-) Ensembl panpan1.1 panPan2
GSTA4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 20,426,724 - 20,443,200 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 20,426,726 - 20,443,200 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 20,321,558 - 20,337,691 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 20,924,034 - 20,940,269 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 20,923,735 - 20,940,277 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 20,429,613 - 20,445,821 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 20,534,140 - 20,550,406 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 20,672,284 - 20,688,436 (-) NCBI UU_Cfam_GSD_1.0
LOC101958062 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 56,071,901 - 56,087,021 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 7,873,194 - 7,889,048 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 7,873,218 - 7,888,301 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GSTA4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 46,635,902 - 46,656,450 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 46,635,903 - 46,656,491 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 134,379,987 - 134,400,475 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GSTA4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 19,575,835 - 19,591,713 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 19,575,876 - 19,591,919 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 52,829,812 - 52,845,691 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gsta4
.
Predicted Target Of
Count of predictions: 11 Count of miRNA genes: 11 Interacting mature miRNAs: 11 Transcripts: ENSRNOT00000012348 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 10450865 Bw175 Body weight QTL 175 4.1 total fat pad mass (VT:0015008) adipose tissue molecular composition measurement (CMO:0000484) 8 75311777 84531599 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 634332 Pia18 Pristane induced arthritis QTL 18 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 75311938 82925521 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat
RH131281
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 87,541,165 - 87,541,377 (+) MAPPER mRatBN7.2 mRatBN7.2 4 120,320,186 - 120,320,396 (+) MAPPER mRatBN7.2 Rnor_6.0 4 119,765,305 - 119,765,514 NCBI Rnor6.0 Rnor_6.0 8 85,518,643 - 85,518,854 NCBI Rnor6.0 Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012348 ⟹ ENSRNOP00000012346
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 79,072,633 - 79,084,182 (+) Ensembl Rnor_6.0 Ensembl 8 85,503,224 - 85,514,670 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090146 ⟹ ENSRNOP00000075572
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 79,066,934 - 79,084,180 (+) Ensembl Rnor_6.0 Ensembl 8 85,497,557 - 85,518,879 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115538 ⟹ ENSRNOP00000086066
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 79,071,470 - 79,084,182 (+) Ensembl
RefSeq Acc Id:
NM_001106840 ⟹ NP_001100310
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 87,947,265 - 87,964,490 (+) NCBI mRatBN7.2 8 79,066,967 - 79,084,193 (+) NCBI Rnor_6.0 8 85,497,557 - 85,514,732 (+) NCBI Rnor_5.0 8 85,062,036 - 85,078,502 (+) NCBI RGSC_v3.4 8 83,165,139 - 83,183,055 (+) RGD Celera 8 78,811,797 - 78,829,038 (+) RGD
Sequence:
GCTCAACAGCCTTTCTCTAGTTCCTGCAGACAAAATCCCAGAATAAGGAAACTCTGAACCAGGAGTCATGGAAGTCAAACCCAAGCTCTACTACTTTCAAGGCAGGGGAAGGATGGAGTCGATCCGCT
hide sequence
RefSeq Acc Id:
XM_063265184 ⟹ XP_063121254
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 87,947,247 - 87,964,489 (+) NCBI
RefSeq Acc Id:
XM_063265185 ⟹ XP_063121255
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 87,959,106 - 87,964,489 (+) NCBI
RefSeq Acc Id:
NP_001100310 ⟸ NM_001106840
- UniProtKB:
P14942 (UniProtKB/Swiss-Prot), A9UMW1 (UniProtKB/TrEMBL), B6DYP9 (UniProtKB/TrEMBL), A6HBU1 (UniProtKB/TrEMBL)
- Sequence:
MEVKPKLYYFQGRGRMESIRWLLATAGVEFEEEFLETREQYEKLQKDGCLLFGQVPLVEIDGMLLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIIGAPFKAPQEKEESLALAVKRA
hide sequence
Ensembl Acc Id:
ENSRNOP00000075572 ⟸ ENSRNOT00000090146
Ensembl Acc Id:
ENSRNOP00000012346 ⟸ ENSRNOT00000012348
Ensembl Acc Id:
ENSRNOP00000086066 ⟸ ENSRNOT00000115538
RefSeq Acc Id:
XP_063121254 ⟸ XM_063265184
- Peptide Label:
isoform X1
- UniProtKB:
P14942 (UniProtKB/Swiss-Prot), A9UMW1 (UniProtKB/TrEMBL), B6DYP9 (UniProtKB/TrEMBL), A6HBU1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063121255 ⟸ XM_063265185
- Peptide Label:
isoform X2
RGD ID: 13696144 Promoter ID: EPDNEW_R6667 Type: initiation region Name: Gsta4_1 Description: glutathione S-transferase alpha 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 85,497,534 - 85,497,594 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-02-04
Gsta4
glutathione S-transferase alpha 4
Gsta4
glutathione S-transferase A4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-03
Gsta4
glutathione S-transferase A4
Gsta4
glutathione S-transferase, alpha 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Gsta4
glutathione S-transferase, alpha 4
Gsta4_predicted
glutathione S-transferase, alpha 4 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Gsta4_predicted
glutathione S-transferase, alpha 4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
