Advanced Search (OLGA)

Gene: Usp36 (ubiquitin specific peptidase 36) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Usp36

Name:

ubiquitin specific peptidase 36

RGD ID:

1309937

Description:

Predicted to enable K48-linked deubiquitinase activity; cysteine-type deubiquitinase activity; and histone H2B deubiquitinase activity. Predicted to be involved in several processes, including positive regulation of protein targeting to mitochondrion; protein stabilization; and regulation of macroautophagy. Predicted to be located in cytoplasm; nuclear speck; and nucleolus. Predicted to be active in cytosol and nucleus. Orthologous to human USP36 (ubiquitin specific peptidase 36); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC303700; ubiquitin carboxyl-terminal hydrolase 36; ubiquitin specific protease 36

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	USP36 (ubiquitin specific peptidase 36)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Usp36 (ubiquitin specific peptidase 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Usp36 (ubiquitin specific peptidase 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	USP36 (ubiquitin specific peptidase 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	USP36 (ubiquitin specific peptidase 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Usp36 (ubiquitin specific peptidase 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	USP36 (ubiquitin specific peptidase 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	USP36 (ubiquitin specific peptidase 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Usp36 (ubiquitin specific peptidase 36)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	USP36 (ubiquitin specific peptidase 36)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Usp36 (ubiquitin specific peptidase 36)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	usp36 (ubiquitin specific peptidase 36)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	scny	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	usp36	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	103,995,970 - 104,027,492 (-)	NCBI		GRCr8
mRatBN7.2	10	103,497,349 - 103,528,877 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	103,497,349 - 103,528,877 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	108,597,760 - 108,629,288 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	108,060,891 - 108,092,419 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	103,418,070 - 103,449,598 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	107,292,828 - 107,324,355 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	107,292,828 - 107,324,355 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	106,927,771 - 106,959,353 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	108,264,874 - 108,296,384 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	108,281,139 - 108,310,782 (-)	NCBI
Celera	10	102,057,521 - 102,089,067 (-)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp36	Rat	Idiopathic Generalized Epilepsy		ISO	USP36 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Idiopathic generalized epilepsy	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp36	Rat	(-)-alpha-phellandrene	decreases expression	ISO	USP36 (Homo sapiens)	6480464	alpha phellandrene results in decreased expression of USP36 mRNA	CTD	PMID:25075043
Usp36	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	USP36 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of USP36 mRNA	CTD	PMID:22079256
Usp36	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Usp36 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP36 mRNA	CTD	PMID:36331819
Usp36	Rat	1,2-dichloroethane	decreases expression	ISO	Usp36 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of USP36 mRNA	CTD	PMID:28960355
Usp36	Rat	1,2-dimethylhydrazine	increases expression	ISO	Usp36 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of USP36 mRNA	CTD	PMID:22206623
Usp36	Rat	17beta-estradiol	increases expression	ISO	USP36 (Homo sapiens)	6480464	Estradiol results in increased expression of USP36 mRNA	CTD	PMID:23019147 and PMID:31614463
Usp36	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of USP36 protein	CTD	PMID:32145629
Usp36	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of USP36 mRNA	CTD	PMID:32145629
Usp36	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of USP36 mRNA	CTD	PMID:33387578
Usp36	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of USP36 mRNA	CTD	PMID:21346803
Usp36	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of USP36 mRNA	CTD	PMID:21346803
Usp36	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Usp36 (Mus musculus)	6480464	bisphenol S results in increased expression of USP36 mRNA	CTD	PMID:39298647
Usp36	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Usp36 (Mus musculus)	6480464	bisphenol S affects the methylation of USP36 gene	CTD	PMID:31683443
Usp36	Rat	aflatoxin B1	increases methylation	ISO	USP36 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of USP36 exon	CTD	PMID:30157460
Usp36	Rat	Aflatoxin B2 alpha	increases methylation	ISO	USP36 (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of USP36 exon and aflatoxin B2 results in increased methylation of USP36 polyA tail	CTD	PMID:30157460
Usp36	Rat	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of USP36 mRNA	CTD	PMID:20488242
Usp36	Rat	all-trans-retinoic acid	decreases expression	ISO	USP36 (Homo sapiens)	6480464	Tretinoin results in decreased expression of USP36 mRNA	CTD	PMID:33167477
Usp36	Rat	alpha-phellandrene	decreases expression	ISO	USP36 (Homo sapiens)	6480464	alpha phellandrene results in decreased expression of USP36 mRNA	CTD	PMID:25075043
Usp36	Rat	amphetamine	decreases expression	EXP		6480464	Amphetamine results in decreased expression of USP36 mRNA	CTD	PMID:30779732
Usp36	Rat	amphotericin B	increases expression	ISO	USP36 (Homo sapiens)	6480464	Amphotericin B results in increased expression of USP36 mRNA	CTD	PMID:20849824
Usp36	Rat	arsane	multiple interactions	ISO	USP36 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of USP36 mRNA	CTD	PMID:32525701
Usp36	Rat	arsane	affects methylation	ISO	USP36 (Homo sapiens)	6480464	Arsenic affects the methylation of USP36 gene	CTD	PMID:25304211
Usp36	Rat	arsenic atom	multiple interactions	ISO	USP36 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of USP36 mRNA	CTD	PMID:32525701
Usp36	Rat	arsenic atom	affects methylation	ISO	USP36 (Homo sapiens)	6480464	Arsenic affects the methylation of USP36 gene	CTD	PMID:25304211
Usp36	Rat	benzo[e]pyrene	increases methylation	ISO	USP36 (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of USP36 polyA tail	CTD	PMID:30157460
Usp36	Rat	bisphenol A	increases expression	ISO	Usp36 (Mus musculus)	6480464	bisphenol A results in increased expression of USP36 mRNA	CTD	PMID:26063408
Usp36	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of USP36 mRNA and bisphenol A results in increased expression of USP36 protein	CTD	PMID:25181051 and PMID:32145629
Usp36	Rat	cadmium dichloride	increases expression	ISO	USP36 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of USP36 mRNA	CTD	PMID:38568856
Usp36	Rat	caffeine	decreases phosphorylation	ISO	USP36 (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of USP36 protein	CTD	PMID:35688186
Usp36	Rat	carbon nanotube	decreases expression	ISO	Usp36 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of USP36 mRNA	CTD	PMID:25554681
Usp36	Rat	cisplatin	increases expression	ISO	USP36 (Homo sapiens)	6480464	Cisplatin results in increased expression of USP36 mRNA	CTD	PMID:20849824
Usp36	Rat	cisplatin	decreases expression	ISO	USP36 (Homo sapiens)	6480464	Cisplatin results in decreased expression of USP36 mRNA	CTD	PMID:27392435 and PMID:27594783
Usp36	Rat	cobalt dichloride	increases expression	ISO	USP36 (Homo sapiens)	6480464	cobaltous chloride results in increased expression of USP36 mRNA	CTD	PMID:19376846
Usp36	Rat	coumarin	increases phosphorylation	ISO	USP36 (Homo sapiens)	6480464	coumarin results in increased phosphorylation of USP36 protein	CTD	PMID:35688186
Usp36	Rat	crocidolite asbestos	increases expression	ISO	USP36 (Homo sapiens)	6480464	Asbestos and Crocidolite results in increased expression of USP36 mRNA	CTD	PMID:18687144
Usp36	Rat	cyclophosphamide	increases expression	ISO	USP36 (Homo sapiens)	6480464	Cyclophosphamide results in increased expression of USP36 mRNA	CTD	PMID:20849824
Usp36	Rat	cyclosporin A	increases expression	ISO	USP36 (Homo sapiens)	6480464	Cyclosporine results in increased expression of USP36 mRNA	CTD	PMID:20106945 and PMID:25562108
Usp36	Rat	Dibutyl phosphate	affects expression	ISO	USP36 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of USP36 mRNA	CTD	PMID:37042841
Usp36	Rat	dicrotophos	increases expression	ISO	USP36 (Homo sapiens)	6480464	dicrotophos results in increased expression of USP36 mRNA	CTD	PMID:28302478
Usp36	Rat	dimethylarsinous acid	increases expression	ISO	USP36 (Homo sapiens)	6480464	dimethylarsinous acid results in increased expression of USP36 mRNA	CTD	PMID:23487506
Usp36	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of USP36 mRNA	CTD	PMID:29391264
Usp36	Rat	enzyme inhibitor	multiple interactions	ISO	USP36 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of USP36 protein	CTD	PMID:23301498
Usp36	Rat	epoxiconazole	decreases expression	ISO	Usp36 (Mus musculus)	6480464	epoxiconazole results in decreased expression of USP36 mRNA	CTD	PMID:35436446
Usp36	Rat	ethanol	affects splicing	ISO	Usp36 (Mus musculus)	6480464	Ethanol affects the splicing of USP36 mRNA	CTD	PMID:30319688
Usp36	Rat	fenofibrate	decreases expression	ISO	Usp36 (Mus musculus)	6480464	Fenofibrate results in decreased expression of USP36 mRNA	CTD	PMID:21318169
Usp36	Rat	fenofibrate	multiple interactions	ISO	Usp36 (Mus musculus)	6480464	PPARA protein affects the reaction [Fenofibrate results in decreased expression of USP36 mRNA]	CTD	PMID:21318169
Usp36	Rat	fluoranthene	multiple interactions	ISO	Usp36 (Mus musculus)	6480464	[1-methylanthracene co-treated with fluoranthene] results in increased expression of USP36 mRNA	CTD	PMID:28329830
Usp36	Rat	folic acid	decreases expression	ISO	Usp36 (Mus musculus)	6480464	Folic Acid results in decreased expression of USP36 mRNA	CTD	PMID:25629700
Usp36	Rat	FR900359	affects phosphorylation	ISO	USP36 (Homo sapiens)	6480464	FR900359 affects the phosphorylation of USP36 protein	CTD	PMID:37730182
Usp36	Rat	geldanamycin	increases expression	ISO	USP36 (Homo sapiens)	6480464	geldanamycin results in increased expression of USP36 mRNA	CTD	PMID:26705709
Usp36	Rat	gentamycin	increases expression	ISO	USP36 (Homo sapiens)	6480464	Gentamicins results in increased expression of USP36 mRNA	CTD	PMID:20849824
Usp36	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of USP36 mRNA	CTD	PMID:33387578
Usp36	Rat	leflunomide	increases expression	ISO	USP36 (Homo sapiens)	6480464	leflunomide results in increased expression of USP36 mRNA	CTD	PMID:28988120
Usp36	Rat	melphalan	increases expression	ISO	USP36 (Homo sapiens)	6480464	Melphalan results in increased expression of USP36 mRNA	CTD	PMID:22363485
Usp36	Rat	mercury dichloride	increases expression	EXP		6480464	Mercuric Chloride results in increased expression of USP36 mRNA	CTD	PMID:16507785
Usp36	Rat	methapyrilene	increases methylation	ISO	USP36 (Homo sapiens)	6480464	Methapyrilene results in increased methylation of USP36 polyA tail	CTD	PMID:30157460
Usp36	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of USP36 gene	CTD	PMID:35440735
Usp36	Rat	methylmercury chloride	increases expression	ISO	USP36 (Homo sapiens)	6480464	methylmercuric chloride results in increased expression of USP36 mRNA	CTD	PMID:28001369
Usp36	Rat	paracetamol	affects expression	ISO	Usp36 (Mus musculus)	6480464	Acetaminophen affects the expression of USP36 mRNA	CTD	PMID:17562736
Usp36	Rat	perfluorononanoic acid	increases expression	ISO	USP36 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in increased expression of USP36 mRNA	CTD	PMID:32588087
Usp36	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Usp36 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP36 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of USP36 mRNA	CTD	PMID:36331819
Usp36	Rat	pirinixic acid	multiple interactions	ISO	Usp36 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of USP36 mRNA and PPARA protein affects the reaction [pirinixic acid results in decreased expression of USP36 mRNA]	CTD	PMID:19710929 and PMID:21318169
Usp36	Rat	pirinixic acid	decreases expression	ISO	Usp36 (Mus musculus)	6480464	pirinixic acid results in decreased expression of USP36 mRNA	CTD	PMID:21318169 and PMID:23811191
Usp36	Rat	potassium chromate	multiple interactions	ISO	USP36 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of USP36 mRNA	CTD	PMID:22079256
Usp36	Rat	potassium chromate	increases expression	ISO	USP36 (Homo sapiens)	6480464	potassium chromate(VI) results in increased expression of USP36 mRNA	CTD	PMID:22079256
Usp36	Rat	resveratrol	multiple interactions	ISO	Usp36 (Mus musculus)	6480464	Resveratrol inhibits the reaction [titanium dioxide results in increased expression of USP36 mRNA]	CTD	PMID:31298478
Usp36	Rat	serpentine asbestos	decreases methylation	ISO	USP36 (Homo sapiens)	6480464	Asbestos and Serpentine results in decreased methylation of USP36 5' UTR	CTD	PMID:29523930
Usp36	Rat	sodium arsenate	multiple interactions	ISO	USP36 (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of USP36 mRNA	CTD	PMID:32525701
Usp36	Rat	sodium arsenite	increases expression	ISO	USP36 (Homo sapiens)	6480464	sodium arsenite results in increased expression of USP36 mRNA	CTD	PMID:38568856
Usp36	Rat	sodium arsenite	decreases expression	ISO	Usp36 (Mus musculus)	6480464	sodium arsenite results in decreased expression of USP36 mRNA	CTD	PMID:36209798
Usp36	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of USP36 mRNA	CTD	PMID:19281266
Usp36	Rat	sunitinib	increases expression	ISO	USP36 (Homo sapiens)	6480464	Sunitinib results in increased expression of USP36 mRNA	CTD	PMID:31533062
Usp36	Rat	temozolomide	decreases expression	ISO	USP36 (Homo sapiens)	6480464	Temozolomide results in decreased expression of USP36 mRNA	CTD	PMID:31758290
Usp36	Rat	tetrachloromethane	increases expression	ISO	Usp36 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of USP36 mRNA	CTD	PMID:31919559
Usp36	Rat	thapsigargin	increases expression	ISO	USP36 (Homo sapiens)	6480464	Thapsigargin results in increased expression of USP36 mRNA	CTD	PMID:22378314
Usp36	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of USP36 mRNA	CTD	PMID:34492290
Usp36	Rat	thiram	increases expression	ISO	USP36 (Homo sapiens)	6480464	Thiram results in increased expression of USP36 mRNA	CTD	PMID:38568856
Usp36	Rat	titanium dioxide	increases expression	ISO	Usp36 (Mus musculus)	6480464	titanium dioxide results in increased expression of USP36 mRNA	CTD	PMID:29264374 and PMID:31298478
Usp36	Rat	titanium dioxide	decreases methylation	ISO	Usp36 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of USP36 gene	CTD	PMID:35295148
Usp36	Rat	titanium dioxide	multiple interactions	ISO	Usp36 (Mus musculus)	6480464	Resveratrol inhibits the reaction [titanium dioxide results in increased expression of USP36 mRNA]	CTD	PMID:31298478
Usp36	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of USP36 mRNA	CTD	PMID:33387578
Usp36	Rat	Triptolide	increases expression	ISO	Usp36 (Mus musculus)	6480464	triptolide results in increased expression of USP36 mRNA	CTD	PMID:32835833
Usp36	Rat	triptonide	affects expression	ISO	Usp36 (Mus musculus)	6480464	triptonide affects the expression of USP36 mRNA	CTD	PMID:33045310
Usp36	Rat	tunicamycin	increases expression	ISO	USP36 (Homo sapiens)	6480464	Tunicamycin results in increased expression of USP36 mRNA	CTD	PMID:22378314
Usp36	Rat	valproic acid	affects expression	ISO	USP36 (Homo sapiens)	6480464	Valproic Acid affects the expression of USP36 mRNA	CTD	PMID:25979313
Usp36	Rat	vorinostat	decreases expression	ISO	USP36 (Homo sapiens)	6480464	vorinostat results in decreased expression of USP36 mRNA	CTD	PMID:27188386
Usp36	Rat	zinc atom	multiple interactions	ISO	USP36 (Homo sapiens)	6480464	[PCI 5002 co-treated with Zinc] results in increased expression of USP36 mRNA	CTD	PMID:18593933
Usp36	Rat	zinc(0)	multiple interactions	ISO	USP36 (Homo sapiens)	6480464	[PCI 5002 co-treated with Zinc] results in increased expression of USP36 mRNA	CTD	PMID:18593933

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp36	Rat	chromatin organization	involved_in	ISO	USP36 (Homo sapiens)	1624291	PMID:29274341	RGD	PMID:29274341
Usp36	Rat	chromatin organization	involved_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	chromatin remodeling	involved_in	IEA	GO:0140936	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Usp36	Rat	negative regulation of macroautophagy	involved_in	ISO	USP36 (Homo sapiens)	1624291	PMID:22622177	RGD	PMID:22622177
Usp36	Rat	negative regulation of macroautophagy	involved_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	nucleolus organization	involved_in	ISO	Usp36 (Mus musculus)	1624291	PMID:29273634	RGD	PMID:29273634
Usp36	Rat	nucleolus organization	involved_in	IEA	UniProtKB:B1AQJ2 and ensembl:ENSMUSP00000101903	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	positive regulation of protein targeting to mitochondrion	involved_in	ISO	USP36 (Homo sapiens)	9068941	PMID:24912190	ParkinsonsUK-UCL	PMID:24912190
Usp36	Rat	protein deubiquitination	involved_in	ISO	USP36 (Homo sapiens)	1624291	PMID:19208757 more ...	RGD	PMID:19208757 more ...
Usp36	Rat	protein deubiquitination	involved_in	IEA	UniProtKB:B1AQJ2 and ensembl:ENSMUSP00000101903	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	protein deubiquitination	involved_in	IEA	InterPro:IPR001394	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Usp36	Rat	protein deubiquitination	involved_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	protein deubiquitination	involved_in	ISO	Usp36 (Mus musculus)	1624291	PMID:29273634	RGD	PMID:29273634
Usp36	Rat	protein stabilization	involved_in	ISO	Usp36 (Mus musculus)	1624291	PMID:29273634	RGD	PMID:29273634
Usp36	Rat	protein stabilization	involved_in	IEA	UniProtKB:B1AQJ2 and ensembl:ENSMUSP00000101903	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp36	Rat	regulation of apoptotic process	involved_in	IBA	FB:FBgn0260936 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp36	Rat	regulation of mitophagy	involved_in	ISO	USP36 (Homo sapiens)	9068941	PMID:24912190	ParkinsonsUK-UCL	PMID:24912190
Usp36	Rat	regulation of protein stability	involved_in	ISO	USP36 (Homo sapiens)	1624291	PMID:27445338	RGD	PMID:27445338
Usp36	Rat	regulation of protein stability	involved_in	IBA	FB:FBgn0016756 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp36	Rat	regulation of protein stability	involved_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	regulation of rRNA processing	involved_in	ISO	USP36 (Homo sapiens)	1624291	PMID:19208757	RGD	PMID:19208757
Usp36	Rat	regulation of rRNA processing	involved_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	regulation of rRNA processing	involved_in	ISO	Usp36 (Mus musculus)	1624291	PMID:29273634	RGD	PMID:29273634
Usp36	Rat	regulation of rRNA processing	involved_in	IEA	UniProtKB:B1AQJ2 and ensembl:ENSMUSP00000101903	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp36	Rat	cytoplasm	located_in	ISO	USP36 (Homo sapiens)	1624291	PMID:27445338	RGD	PMID:27445338
Usp36	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	cytosol	is_active_in	IBA	FB:FBgn0016756 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp36	Rat	nuclear speck	located_in	ISO	USP36 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Usp36	Rat	nuclear speck	located_in	IEA	UniProtKB:E9PEW0 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	nuclear speck	located_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	nucleolus	located_in	ISO	USP36 (Homo sapiens)	1624291	PMID:19208757 and PMID:25775507	RGD	GO_REF:0000052 more ...
Usp36	Rat	nucleolus	located_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	nucleolus	located_in	IEA	UniProtKB:E9PEW0 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	nucleoplasm	located_in	ISO	USP36 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Usp36	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	nucleoplasm	located_in	IEA	UniProtKB:E9PEW0 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	nucleus	is_active_in	IBA	FB:FBgn0016756 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Usp36	Rat	cysteine-type deubiquitinase activity	enables	ISO	USP36 (Homo sapiens)	1624291	PMID:14715245	RGD	PMID:14715245
Usp36	Rat	cysteine-type deubiquitinase activity	enables	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	cysteine-type deubiquitinase activity	enables	IBA	FB:FBgn0005632 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Usp36	Rat	cysteine-type deubiquitinase activity	enables	IEA	InterPro:IPR001394 and InterPro:IPR018200	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Usp36	Rat	cysteine-type peptidase activity	enables	IEA	UniProtKB-KW:KW-0788	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp36	Rat	histone H2B deubiquitinase activity	enables	ISO	USP36 (Homo sapiens)	1624291	PMID:29274341	RGD	PMID:29274341
Usp36	Rat	histone H2B deubiquitinase activity	enables	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp36	Rat	K48-linked deubiquitinase activity	enables	IEA	UniProtKB:Q9P275 and ensembl:ENSP00000401119	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Usp36	Rat	K48-linked deubiquitinase activity	enables	ISO	USP36 (Homo sapiens)	1624291	PMID:35989368	RGD	PMID:35989368
Usp36	Rat	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Usp36	Rat	protein binding	enables	ISO	USP36 (Homo sapiens)	1624291	UniProtKB:P04629 more ...	RGD	PMID:19615732 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:14715245	PMID:19208757	PMID:22622177	PMID:22658674	PMID:24912190	PMID:25775507	PMID:27445338	PMID:29273634	PMID:29274341

Usp36
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	103,995,970 - 104,027,492 (-)	NCBI		GRCr8
mRatBN7.2	10	103,497,349 - 103,528,877 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	103,497,349 - 103,528,877 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	108,597,760 - 108,629,288 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	108,060,891 - 108,092,419 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	103,418,070 - 103,449,598 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	107,292,828 - 107,324,355 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	107,292,828 - 107,324,355 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	106,927,771 - 106,959,353 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	108,264,874 - 108,296,384 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	108,281,139 - 108,310,782 (-)	NCBI
Celera	10	102,057,521 - 102,089,067 (-)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

USP36
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	78,787,381 - 78,841,439 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	78,787,381 - 78,841,441 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	76,783,463 - 76,837,521 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	74,304,560 - 74,348,564 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	74,295,143 - 74,348,457	NCBI
Celera	17	73,390,685 - 73,434,689 (-)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	72,215,406 - 72,259,387 (-)	NCBI		HuRef
CHM1_1	17	76,856,878 - 76,900,907 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	79,682,181 - 79,736,241 (-)	NCBI		T2T-CHM13v2.0

Usp36
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	118,150,477 - 118,181,086 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	118,150,477 - 118,181,070 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	118,259,651 - 118,290,260 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	118,259,651 - 118,290,244 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	118,120,967 - 118,151,558 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	118,075,743 - 118,105,500 (-)	NCBI		MGSCv36	mm8
Celera	11	130,004,579 - 130,035,210 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	83.06	NCBI

Usp36
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	3,824,556 - 3,862,098 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955506	3,824,598 - 3,861,919 (+)	NCBI	ChiLan1.0	ChiLan1.0

USP36
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	94,843,897 - 94,889,092 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	99,673,947 - 99,719,102 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	72,871,379 - 72,916,560 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	78,416,541 - 78,461,683 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	78,416,541 - 78,461,683 (-)	Ensembl	panpan1.1		panPan2

USP36
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	2,547,316 - 2,587,360 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	2,550,452 - 2,585,108 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	3,204,251 - 3,244,344 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	3,198,025 - 3,238,153 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	3,198,174 - 3,237,961 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	3,221,527 - 3,261,605 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	3,346,088 - 3,386,118 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	3,427,024 - 3,467,073 (+)	NCBI		UU_Cfam_GSD_1.0

Usp36
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	3,184,165 - 3,217,117 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	3,194,482 - 3,228,748 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	3,194,842 - 3,228,701 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

USP36
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	3,309,237 - 3,348,525 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	3,309,176 - 3,348,531 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	3,348,808 - 3,388,371 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

USP36
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	70,769,133 - 70,813,274 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	70,769,797 - 70,810,844 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	41,899,622 - 41,944,511 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Usp36
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	8,176,902 - 8,211,592 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	8,177,164 - 8,214,169 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Usp36
111 total Variants

Assembly: mRatBN7.2

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
10	103507072	103507073	G	A	snv	European Variation Archive Release 3, European Variation Archive Release 4, European Variation Archive Release 6, MR/NRrrc (2022), ACI/N (2020), MR/N (2020), ACI/EurMcwi (2019NG), ACI/EurMcwi (2019)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	426
Count of miRNA genes:	220
Interacting mature miRNAs:	282
Transcripts:	ENSRNOT00000064450
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat

RH138209

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	103,498,793 - 103,498,959 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	107,294,273 - 107,294,438	NCBI	Rnor6.0
Rnor_5.0	10	106,929,216 - 106,929,381	UniSTS	Rnor5.0
RGSC_v3.4	10	108,266,319 - 108,266,484	UniSTS	RGSC3.4
Celera	10	102,058,966 - 102,059,131	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064450 ⟹ ENSRNOP00000060530

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	103,497,349 - 103,528,877 (-)	Ensembl
Rnor_6.0 Ensembl	10	107,292,828 - 107,324,355 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000084055 ⟹ ENSRNOP00000071284

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	103,497,357 - 103,528,735 (-)	Ensembl
Rnor_6.0 Ensembl	10	107,295,550 - 107,314,496 (-)	Ensembl

RefSeq Acc Id:

NM_001107069 ⟹ NP_001100539

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	103,995,970 - 104,027,492 (-)	NCBI
mRatBN7.2	10	103,497,349 - 103,528,877 (-)	NCBI
Rnor_6.0	10	107,292,828 - 107,324,355 (-)	NCBI
Rnor_5.0	10	106,927,771 - 106,959,353 (-)	NCBI
RGSC_v3.4	10	108,264,874 - 108,296,384 (-)	RGD
Celera	10	102,057,521 - 102,089,067 (-)	RGD

Sequence:

show sequence

CGCCTCTTAAAGCGACCGCGCCCTCCATGCGGACTCCGGGAAGCACCCCGCAGTGCCGCTCCTTTAAACGTCTTGGTGACACGTGTGTGAGGCTCTGAAGGCCCGGATGGTGCGCATGCTGGCCCGGC
CCGGAGCGTACGCTGGTGCTGCGCGGGCCTTCCGCGGGTTCCCGAGAGGCCTAGGAGGTCGAGGTCGGGCGCGGCGGAACGCAGGAACTTTCGAGGGGCTTGGGACGAGGAGGGTGTACGCTCCTGGC
CGCGGGTTTTGGGAACTCCAGCGAAGGCTGACAGGTGCTGACCTATTTTTGACTCTACACTTGGCAGTGTTGGCGACTGGGCAGGCTGGCAGTGTTGGCTACTGGGCAAGCTGAAGTTCAGGAGAGCG
CCTGCCAGGTCAGTTCCGTGCCACCCTTGAGAACCTGGTCCCCTTACCTGCTGCAGAGAGAAGCAGCAGCCAGGCTCAGGCACCCCAGGCATGCACCATGCCCATCGTGGATAAGCTGAAGGAGGCTC
TAAAGCCTGGCCGCAAGGACTCGGCAGAGGATGGGGACCTGGGCAAGCTGCTGGCGGCCTCCGCCAAGAAGGTCCTCCTGCAGAGGATTGAGTTTGAACCGGCCAGCAAGAGCTTCTCTTACCAGCTG
GAGTCCTTGAAGAGCAAATATGTACTGTTGAACCCCAAGGCTGAGGGTGCCGGGCGCCACAGGAGCGGAGATGAGCCACAGGCCAGGAAACCAGGCACCGAGCGCATGTCTGGAAGTGGAGGCGATGG
AGTCCCTGCCCCACAGAAAGTGCTCTTCCCTGTGGAGCGACTGTCCTTGAGGTGGGAACGCGTATTCCGAGTTGGTGCTGGGCTGCACAACCTGGGTAACACCTGCTTCCTGAACTCCACCATTCAGT
GCTTGACTTACACGCCACCTCTGGCCAACTACTTGCTCTCCAAGGAGCACGCACGGAGCTGTCACCAAGGAAGCTTCTGCATGCTGTGCGTCATGCAGAACCACATGGTCCAGGCCTTTGCCAACAGT
GGCAATGCCATCAAGCCTGTCTCCTTCATCAGAGACCTGAAAAAGATTGCCCGGCACTTCCGATTTGGGAACCAAGAGGATGCACATGAATTCCTGCGGTACACCATCGACGCCATGCAGAAGGCCTG
CTTGAATGGCTATGCTAAGTTGGATCGGCAGACACAGGCTACTACCCTGGTGCATCAGATCTTTGGAGGCTATCTCAGGTCCCGAGTGAAGTGTTCCGTGTGCAGAAGCGTCTCAGACACATACGACC
CCTACTTGGACATAGCGCTGGAGATTCGGCAAGCTGCAAATATTGTGCGTGCTCTGGAACTTTTTGTGAAATCAGATGTCCTGAGTGGAGAGAACGCCTATATGTGTGCTAAGTGTAAGAAGAAGGTT
CCAGCTAGCAAGCGCTTCAGCATCCATAGAACATCCAATGTCCTGACTCTGTCCCTCAAGCGCTTTGCCAACTTCAGTGGGGGGAAGATCACCAAGGATGTTGGCTATCCAGAGTTCCTGAACATCCG
TCCATACATGTCGCAGAGCAGTGGAGACCCTGTCATGTATGGGCTCTATGCTGTTCTGGTGCACTCAGGCTACAGCTGCCACGCGGGGCACTACTACTGCTACGTGAAGGCCAGCAATGGACAGTGGT
ACCAGATGAACGACTCCTTGGTCCATTCCAGCAATGTCAAGGTGGTTCTGAGCCAGCAGGCCTACGTGCTCTTCTATCTGCGGATTCCAGGCTCTAAGAAAAGTCCTGAGGGCCCTGTCTCCAGGGTG
GGTGCCACTCTTCCTAGCCGTCCCAAGGTCATTCCAGAGCACCCCAAGAAGAGCCCTGGCAATGGGGTTGTTTCCTCCCCACTGATGGCAAAGCGACAAGACTCTCTAATGATGAGAAAGTTGCAGTC
CCCTGAGGAGGTTGGCATGCCTGTGTCCAGAAATGGCTCCATTTCTGGTCTGAAGTTACAGAATGGATGTGCTCCTGCAAAGTCACCTGCCGGGTCCCCCTCCCCGAGACTCGCTCCGACACCCACAC
ATATGCCCACCATTCTGGACGAGCCTGGGGAGAAGGTGAAGAAGTCAGCCCCGCCACAGTCTCGCACCACGTCCCCAACTGCTTCTCAGGGCTTTCCTGGGACCGGCGAGTCCAGGAGCCAGCGGCCT
GGCTCCTGGGCGAGCAGAGACAGCATCTTCTCTACCTCACCAAAGCTGGCCAAAGCCATTACTAACGGGCACAGGCTGAAGGGGGAAGGCAATGGTGTGGACCTGGAGAAGGGGGATTCCAGCAGCTC
GAGCCCCGAGCACTCTGCCAGCAGTGACGCTGCCAAGGCCCCGCAGACCTCAGAGGGCAGAGCTGCACATGTCTGTGATTCTCAGGGAACAAACTGCCCAGCCACTGGCCATTCAAAAGTGCTGTCGA
ACGGAGTCGATGCCAAGATGGGGAAGTTGAAGTCCCCTGCCCTGAGCAGCACCACCACCGAGCCCACAAGCCTCATGTCGCCTCCACCAGCCAAAAAACTGGCCCTGTCAGCCAAGAAGGCCAGCACC
CTGCGGAGGGCGACCGGCAATGACATCGGTTCACCTTCCCCCTCAGCATTCTGCGATCTCACCTCCCCCATGAAAGCCACCCACCCCGTCGTTGCCTCCCCTGGGCCTGTCAGTAAAACCAGGGCTGC
TGCCGCACCTGCTCCCCAACCGTCTCCCCACCCCCACTCTGCATCACTGTCCAGTAGTAGCGCCAAGCCCTTAGGGACATCAGAGCCACAGAGCTGCTGCTCCTCTGCCTGGACACCCCTGCCTCAGG
TCAATGGACACTTCACGTCCCACTTACACCAACTGCCAGAGGCCAATGAGGCCCTACACAGCCCCTCCAGAAAGAGGAAGAAGACTCCTAGTGGAGATCCCCAGAGACTGGGCAGAGACACACACCTC
CCACAGTGCCTCGAGGGAGCACCTGCAACAGCACGCAGGAAGAAGAGGAAGAAGAAGAAGGACCTGGAGGGTGTGGGCGACACAGCTACCCAGCAGGAAAGCCAGTCTCAGGACCAGCCTTGGAGTCC
CAGGGGCCGGAAGGAAGAGGGTACGCAGCTTCAGGTAAATGGCCATCAAGTGAGTCACATCCTGGACAGTTACCATGCGAGCAGCAGGAAAAGGAGGAAGAGAAAAAGATCAGAAGGGCTCAGCCAAG
AAGCCACCGTGTGCCAGGACCTACTTCAGCATGGCTGCTCCCCTGCAGACCACTGGCTGGGACGGGCACCTCTTGTTACCTGGAACAGAGATCAAGAACCGGATGTGGTCCAGGAGTTGCTTCAGGAC
TCGTCTGATACGGCTTATGGGAAAAAAGTTTTGACCTGGGATGGTGAGCCTTCAGCCATCAGTCAGGACGCCATGAAAGACAGCAGACTGGCCCGGACCCAGACCGTGGTTGATGACTGGGATGAAGA
GTTTGATCGAGGGAAGAAAAAAGGAGAGAACAGTGCTCCATGATGGGTCTGCTGGTTGAGTCTTCCAGCCGAACGTGATCAGTCATCTTTGTGTGGCCTCGGTTCCGGATGTCATGTCCAGGAGTGCT
GTGGGCTCCGTGTTATCTCGTGTGGGGGGGAGGGGGCAGGCACCTTCAGGGACAGGCATTGTCTCTTCTTCTGAGGAGTTGCCACCCTTCTGGTAGTAGCTGCTTCCTGGGTACATTTGTTTTTCTTT
ACGGCTTTCTCTAGTAGAAAGTTGTAAAGCTGCCAGCACAAAATGGATTGTCTCCCGTGTCTCCTCCATATTGGTTCCTTTGTGCAGTAGATTACACATTGTAAAGTCTCCAGGGGCATATAGTCCAC
TGTCTCTTGGGCAGTCATGATCCCCCATCTGCCATCCTGACTAATGGCAGCTTGTGTTGCTGTCACTGAAGGCAAGTCCTTTTCTTCCTTAGAAGCCATTAGGAACAGGCCATAGGCGGAATGAGTTC
TCGGTGACATGTACTGACATAAATGAAGCTTTTCTAAAAGTAGTCATGCTGTTGGATCAAATCAGTTTGAACTTTGTGCTTGGCAGTAGATGTGGCTTAGGCCCACTTGCAGAGGGCCACCTCCCTGG
TGTTTCTGTTCTTGCTCACCTGCCTGTTAGGGGCTGTTTCTGTCCAACATCCTGTGTGGCTGCGTCTGTGTGTGTGCAGGACTCCCTGTACTCTTCCCCTTCCTCTGTGGGGGTGCCCAGATAGTGCC
AAGATCTTGGTGCAATAAAGTAATGCATTTTCTGTGATT

hide sequence

RefSeq Acc Id:

XM_039086201 ⟹ XP_038942129

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	103,995,972 - 104,027,487 (-)	NCBI
mRatBN7.2	10	103,497,351 - 103,528,872 (-)	NCBI

RefSeq Acc Id:

XM_039086203 ⟹ XP_038942131

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	103,995,972 - 104,027,487 (-)	NCBI
mRatBN7.2	10	103,497,351 - 103,528,872 (-)	NCBI

RefSeq Acc Id:

XM_063269242 ⟹ XP_063125312

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,004,667 - 104,027,487 (-)	NCBI


Protein RefSeqs	NP_001100539	(Get FASTA)	NCBI Sequence Viewer
	XP_038942129	(Get FASTA)	NCBI Sequence Viewer
	XP_038942131	(Get FASTA)	NCBI Sequence Viewer
	XP_063125312	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM06751	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060530
	ENSRNOP00000060530.2
	ENSRNOP00000071284
	ENSRNOP00000071284.2

RefSeq Acc Id:

NP_001100539 ⟸ NM_001107069

- UniProtKB:

D3ZNQ4 (UniProtKB/TrEMBL), A6HL46 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPIVDKLKEALKPGRKDSAEDGDLGKLLAASAKKVLLQRIEFEPASKSFSYQLESLKSKYVLLNPKAEGAGRHRSGDEPQARKPGTERMSGSGGDGVPAPQKVLFPVERLSLRWERVFRVGAGLHNLG
NTCFLNSTIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHMVQAFANSGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGYAKLDRQTQATTLVHQIFGGYLRSRVKCS
VCRSVSDTYDPYLDIALEIRQAANIVRALELFVKSDVLSGENAYMCAKCKKKVPASKRFSIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLNIRPYMSQSSGDPVMYGLYAVLVHSGYSCHAGHYY
CYVKASNGQWYQMNDSLVHSSNVKVVLSQQAYVLFYLRIPGSKKSPEGPVSRVGATLPSRPKVIPEHPKKSPGNGVVSSPLMAKRQDSLMMRKLQSPEEVGMPVSRNGSISGLKLQNGCAPAKSPAGS
PSPRLAPTPTHMPTILDEPGEKVKKSAPPQSRTTSPTASQGFPGTGESRSQRPGSWASRDSIFSTSPKLAKAITNGHRLKGEGNGVDLEKGDSSSSSPEHSASSDAAKAPQTSEGRAAHVCDSQGTNC
PATGHSKVLSNGVDAKMGKLKSPALSSTTTEPTSLMSPPPAKKLALSAKKASTLRRATGNDIGSPSPSAFCDLTSPMKATHPVVASPGPVSKTRAAAAPAPQPSPHPHSASLSSSSAKPLGTSEPQSC
CSSAWTPLPQVNGHFTSHLHQLPEANEALHSPSRKRKKTPSGDPQRLGRDTHLPQCLEGAPATARRKKRKKKKDLEGVGDTATQQESQSQDQPWSPRGRKEEGTQLQVNGHQVSHILDSYHASSRKRR
KRKRSEGLSQEATVCQDLLQHGCSPADHWLGRAPLVTWNRDQEPDVVQELLQDSSDTAYGKKVLTWDGEPSAISQDAMKDSRLARTQTVVDDWDEEFDRGKKKGENSAP

hide sequence

Ensembl Acc Id:

ENSRNOP00000071284 ⟸ ENSRNOT00000084055

Ensembl Acc Id:

ENSRNOP00000060530 ⟸ ENSRNOT00000064450

RefSeq Acc Id:	XP_038942131 ⟸ XM_039086203
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K033 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038942129 ⟸ XM_039086201
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K033 (UniProtKB/TrEMBL)

Protein Domains

USP

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZNQ4-F1-model_v2	AlphaFold	D3ZNQ4	1-1005	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-22520	BioCyc
Ensembl Genes	ENSRNOG00000028255	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064450	ENTREZGENE
	ENSRNOT00000064450.4	UniProtKB/TrEMBL
	ENSRNOT00000084055	ENTREZGENE
	ENSRNOT00000084055.2	UniProtKB/TrEMBL
Gene3D-CATH	Cysteine proteinases	UniProtKB/TrEMBL
InterPro	Papain_like_cys_pep_sf	UniProtKB/TrEMBL
	Pept_C19ubi-hydrolase_C_CS	UniProtKB/TrEMBL
	Peptidase_C19	UniProtKB/TrEMBL
	Peptidase_C19	UniProtKB/TrEMBL
	UCH/PAN2	UniProtKB/TrEMBL
KEGG Report	rno:303700	UniProtKB/TrEMBL
NCBI Gene	303700	ENTREZGENE
PANTHER	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE	UniProtKB/TrEMBL
	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 36	UniProtKB/TrEMBL
Pfam	UCH	UniProtKB/TrEMBL
PhenoGen	Usp36	PhenoGen
PROSITE	UCH_2_1	UniProtKB/TrEMBL
	UCH_2_2	UniProtKB/TrEMBL
	UCH_2_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000028255	RatGTEx
Superfamily-SCOP	SSF54001	UniProtKB/TrEMBL
UniProt	A0A0G2K033	ENTREZGENE, UniProtKB/TrEMBL
	A6HL46	ENTREZGENE, UniProtKB/TrEMBL
	D3ZNQ4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Usp36	ubiquitin specific peptidase 36	Usp36_predicted	ubiquitin specific protease 36 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Usp36_predicted	ubiquitin specific protease 36 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar