Symbol:
Usp3
Name:
ubiquitin specific peptidase 3
RGD ID:
1308852
Description:
Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity and promoter-specific chromatin binding activity. Involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in several cellular components, including Flemming body; cytoplasmic ribonucleoprotein granule; and nucleoplasm. Predicted to be active in cytoplasm and nucleus. Orthologous to human USP3 (ubiquitin specific peptidase 3); PARTICIPATES IN ataxia telangiectasia-mutated (ATM) signaling pathway; histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC363084; ubiquitin carboxyl-terminal hydrolase 3; ubiquitin specific protease 3; ubiquitin thiolesterase 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 75,973,278 - 76,049,151 (-) NCBI GRCr8 mRatBN7.2 8 67,078,249 - 67,154,109 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 67,079,927 - 67,154,111 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 72,592,343 - 72,666,625 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 70,865,164 - 70,939,434 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 68,735,501 - 68,809,701 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 72,207,970 - 72,284,871 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 72,207,972 - 72,284,873 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 71,875,687 - 71,951,083 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 70,821,429 - 70,897,119 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 70,840,484 - 70,916,173 (-) NCBI Celera 8 66,465,505 - 66,539,503 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp3 Rat 1,2-dimethylhydrazine decreases expression ISO Usp3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP3 mRNA CTD PMID:22206623 Usp3 Rat 17beta-estradiol decreases expression ISO Usp3 (Mus musculus) 6480464 Estradiol results in decreased expression of USP3 mRNA CTD PMID:39298647 Usp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP3 mRNA CTD PMID:21215274 Usp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP3 mRNA CTD PMID:33387578 Usp3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO USP3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of USP3 mRNA CTD PMID:22903824 Usp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP3 mRNA CTD PMID:21570461 Usp3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of USP3 mRNA CTD PMID:21346803 Usp3 Rat 4,4'-sulfonyldiphenol affects methylation ISO Usp3 (Mus musculus) 6480464 bisphenol S affects the methylation of USP3 gene CTD PMID:31683443 Usp3 Rat 4-hydroxyphenyl retinamide increases expression ISO Usp3 (Mus musculus) 6480464 Fenretinide results in increased expression of USP3 mRNA CTD PMID:28973697 Usp3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of USP3 mRNA CTD PMID:30047161 Usp3 Rat aflatoxin B1 increases expression ISO Usp3 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of USP3 mRNA CTD PMID:19770486 Usp3 Rat aflatoxin B1 decreases methylation ISO USP3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of USP3 gene CTD PMID:27153756 Usp3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of USP3 mRNA CTD PMID:30047161 Usp3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of USP3 mRNA CTD PMID:30779732 Usp3 Rat antirheumatic drug decreases expression ISO USP3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of USP3 mRNA CTD PMID:24449571 Usp3 Rat arsenous acid increases expression ISO USP3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of USP3 mRNA CTD PMID:20458559 Usp3 Rat Benoxacor increases expression ISO Usp3 (Mus musculus) 6480464 benoxacor results in increased expression of USP3 mRNA CTD PMID:34850242 Usp3 Rat benzene increases expression ISO USP3 (Homo sapiens) 6480464 Benzene results in increased expression of USP3 mRNA CTD PMID:15929907 Usp3 Rat benzo[a]pyrene increases expression ISO Usp3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of USP3 mRNA CTD PMID:22228805 Usp3 Rat benzo[a]pyrene diol epoxide I decreases expression ISO USP3 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Usp3 Rat beta-lapachone increases expression ISO USP3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of USP3 mRNA CTD PMID:38218311 Usp3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO USP3 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of USP3 gene CTD PMID:33872906 Usp3 Rat bisphenol A decreases expression ISO Usp3 (Mus musculus) 6480464 bisphenol A results in decreased expression of USP3 mRNA CTD PMID:26063408 Usp3 Rat bisphenol A increases expression ISO USP3 (Homo sapiens) 6480464 bisphenol A results in increased expression of USP3 mRNA CTD PMID:33670352 Usp3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP3 mRNA CTD PMID:25181051 and PMID:30816183 Usp3 Rat Bisphenol A diglycidyl ether affects splicing ISO Usp3 (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of USP3 mRNA CTD PMID:36464114 Usp3 Rat bisphenol AF affects splicing ISO Usp3 (Mus musculus) 6480464 bisphenol AF affects the splicing of USP3 mRNA CTD PMID:36464114 Usp3 Rat cadmium atom multiple interactions ISO Usp3 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP3 mRNA CTD PMID:37325564 Usp3 Rat cadmium dichloride multiple interactions ISO Usp3 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP3 mRNA CTD PMID:37325564 Usp3 Rat carbon nanotube increases expression ISO Usp3 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of USP3 mRNA CTD PMID:25554681 Usp3 Rat chloroacetaldehyde increases expression ISO USP3 (Homo sapiens) 6480464 chloroacetaldehyde results in increased expression of USP3 mRNA CTD PMID:25596134 Usp3 Rat choline multiple interactions ISO Usp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of USP3 gene CTD PMID:20938992 Usp3 Rat cidofovir anhydrous affects expression ISO USP3 (Homo sapiens) 6480464 Cidofovir affects the expression of USP3 mRNA CTD PMID:25596134 Usp3 Rat copper(II) sulfate increases expression ISO USP3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of USP3 mRNA CTD PMID:19549813 Usp3 Rat coumestrol multiple interactions ISO USP3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of USP3 mRNA CTD PMID:19167446 Usp3 Rat cyclosporin A increases expression ISO USP3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of USP3 mRNA CTD PMID:20106945 more ... Usp3 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of USP3 protein CTD PMID:14561216 Usp3 Rat diarsenic trioxide increases expression ISO USP3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of USP3 mRNA CTD PMID:20458559 Usp3 Rat dioxygen increases expression ISO USP3 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of USP3 mRNA CTD PMID:25596134 Usp3 Rat elemental selenium decreases expression ISO USP3 (Homo sapiens) 6480464 Selenium results in decreased expression of USP3 mRNA CTD PMID:19244175 Usp3 Rat Enterolactone multiple interactions ISO USP3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of USP3 mRNA CTD PMID:19167446 Usp3 Rat ethyl methanesulfonate decreases expression ISO USP3 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of USP3 mRNA CTD PMID:23649840 Usp3 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of USP3 mRNA CTD PMID:25596134 Usp3 Rat fluorescein 5-isothiocyanate affects binding ISO USP3 (Homo sapiens) 6480464 Fluorescein-5-isothiocyanate binds to USP3 protein CTD PMID:27129696 Usp3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of USP3 mRNA CTD PMID:24136188 Usp3 Rat folic acid multiple interactions ISO Usp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of USP3 gene CTD PMID:20938992 Usp3 Rat folic acid decreases expression ISO Usp3 (Mus musculus) 6480464 Folic Acid results in decreased expression of USP3 mRNA CTD PMID:25629700 Usp3 Rat formaldehyde decreases expression ISO USP3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of USP3 mRNA CTD PMID:23649840 Usp3 Rat gallic acid increases expression ISO USP3 (Homo sapiens) 6480464 Gallic Acid results in increased expression of USP3 mRNA CTD PMID:34408198 Usp3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP3 mRNA CTD PMID:22061828 Usp3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of USP3 mRNA CTD PMID:33387578 Usp3 Rat ifosfamide increases expression ISO USP3 (Homo sapiens) 6480464 Ifosfamide results in increased expression of USP3 mRNA CTD PMID:25596134 Usp3 Rat isotretinoin decreases expression ISO USP3 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of USP3 mRNA CTD PMID:20436886 Usp3 Rat L-methionine multiple interactions ISO Usp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of USP3 gene CTD PMID:20938992 Usp3 Rat lipopolysaccharide multiple interactions EXP 6480464 Lipopolysaccharides inhibits the reaction [USP3 protein binds to ALB promoter] and Lipopolysaccharides inhibits the reaction [USP3 protein binds to GSTA2 promoter] CTD PMID:14561216 Usp3 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of USP3 mRNA CTD PMID:25596134 Usp3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of USP3 mRNA CTD PMID:30047161 Usp3 Rat methotrexate decreases expression ISO USP3 (Homo sapiens) 6480464 Methotrexate results in decreased expression of USP3 mRNA CTD PMID:24449571 Usp3 Rat methyl methanesulfonate decreases expression ISO USP3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of USP3 mRNA CTD PMID:23649840 Usp3 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO USP3 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of USP3 gene CTD PMID:33872906 Usp3 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of USP3 mRNA CTD PMID:24136188 Usp3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP3 mRNA CTD PMID:25729387 Usp3 Rat ozone multiple interactions ISO USP3 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of USP3 mRNA CTD PMID:35430440 Usp3 Rat paracetamol affects expression ISO Usp3 (Mus musculus) 6480464 Acetaminophen affects the expression of USP3 mRNA CTD PMID:17562736 Usp3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of USP3 mRNA CTD PMID:33387578 Usp3 Rat pentachlorophenol decreases expression ISO Usp3 (Mus musculus) 6480464 Pentachlorophenol results in decreased expression of USP3 mRNA CTD PMID:23892564 Usp3 Rat phenobarbital affects expression ISO USP3 (Homo sapiens) 6480464 Phenobarbital affects the expression of USP3 mRNA CTD PMID:19159669 Usp3 Rat pirinixic acid multiple interactions ISO Usp3 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of USP3 mRNA CTD PMID:19710929 Usp3 Rat pirinixic acid increases expression ISO Usp3 (Mus musculus) 6480464 pirinixic acid results in increased expression of USP3 mRNA CTD PMID:17426115 and PMID:23811191 Usp3 Rat selenium atom decreases expression ISO USP3 (Homo sapiens) 6480464 Selenium results in decreased expression of USP3 mRNA CTD PMID:19244175 Usp3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of USP3 mRNA CTD PMID:30047161 Usp3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of USP3 mRNA CTD PMID:23411599 Usp3 Rat titanium dioxide increases expression ISO Usp3 (Mus musculus) 6480464 titanium dioxide results in increased expression of USP3 mRNA CTD PMID:23557971 Usp3 Rat titanium dioxide decreases methylation ISO Usp3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP3 gene CTD PMID:35295148 Usp3 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of USP3 mRNA CTD PMID:25729387 Usp3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP3 mRNA CTD PMID:25729387 Usp3 Rat trichostatin A increases expression ISO USP3 (Homo sapiens) 6480464 trichostatin A results in increased expression of USP3 mRNA CTD PMID:24935251 Usp3 Rat trichostatin A affects expression ISO USP3 (Homo sapiens) 6480464 trichostatin A affects the expression of USP3 mRNA CTD PMID:28542535 Usp3 Rat triphenyl phosphate affects expression ISO USP3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP3 mRNA CTD PMID:37042841 Usp3 Rat valproic acid affects expression ISO Usp3 (Mus musculus) 6480464 Valproic Acid affects the expression of USP3 mRNA CTD PMID:17292431 Usp3 Rat valproic acid decreases expression ISO USP3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of USP3 mRNA CTD PMID:23179753 Usp3 Rat valproic acid decreases methylation ISO USP3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of USP3 gene CTD PMID:29154799 Usp3 Rat valproic acid increases expression ISO USP3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of USP3 mRNA CTD PMID:24935251 Usp3 Rat vitamin E decreases expression ISO USP3 (Homo sapiens) 6480464 Vitamin E results in decreased expression of USP3 mRNA CTD PMID:19244175
Usp3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 75,973,278 - 76,049,151 (-) NCBI GRCr8 mRatBN7.2 8 67,078,249 - 67,154,109 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 67,079,927 - 67,154,111 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 72,592,343 - 72,666,625 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 70,865,164 - 70,939,434 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 68,735,501 - 68,809,701 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 72,207,970 - 72,284,871 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 72,207,972 - 72,284,873 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 71,875,687 - 71,951,083 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 70,821,429 - 70,897,119 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 70,840,484 - 70,916,173 (-) NCBI Celera 8 66,465,505 - 66,539,503 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
USP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 63,504,593 - 63,594,633 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 63,504,511 - 63,594,640 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 63,796,792 - 63,886,832 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 61,583,863 - 61,670,716 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 61,583,862 - 61,670,714 NCBI Celera 15 40,676,343 - 40,763,066 (+) NCBI Celera Cytogenetic Map 15 q22.31 NCBI HuRef 15 40,621,287 - 40,711,268 (+) NCBI HuRef CHM1_1 15 63,915,941 - 64,006,065 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 61,311,846 - 61,401,872 (+) NCBI T2T-CHM13v2.0
Usp3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 66,421,573 - 66,501,996 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 66,421,919 - 66,500,424 (-) Ensembl GRCm39 Ensembl GRCm38 9 66,514,639 - 66,593,148 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 66,514,637 - 66,593,142 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 66,365,688 - 66,440,787 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 66,315,887 - 66,390,986 (-) NCBI MGSCv36 mm8 Celera 9 63,751,848 - 63,826,987 (-) NCBI Celera Cytogenetic Map 9 C NCBI cM Map 9 35.96 NCBI
Usp3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 11,727,104 - 11,802,462 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 11,729,433 - 11,802,462 (-) NCBI ChiLan1.0 ChiLan1.0
USP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 52,752,572 - 52,839,422 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 56,928,338 - 57,018,712 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 42,450,782 - 42,541,162 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 60,769,071 - 60,834,312 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 60,746,406 - 60,830,535 (+) Ensembl panpan1.1 panPan2
USP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 28,073,484 - 28,184,121 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 28,072,655 - 28,181,749 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 27,994,320 - 28,105,523 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 28,247,380 - 28,358,779 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 28,247,372 - 28,356,897 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 28,184,910 - 28,296,144 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 28,247,406 - 28,358,439 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 28,485,422 - 28,596,600 (+) NCBI UU_Cfam_GSD_1.0
Usp3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 106,190,114 - 106,282,480 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 24,035,655 - 24,130,997 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 24,032,644 - 24,130,543 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP3
USP3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 19,947,806 - 20,030,515 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 19,948,453 - 19,992,638 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 121,366,857 - 121,451,299 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp3
.
Predicted Target Of
Count of predictions: 76 Count of miRNA genes: 68 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000057739 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
BE097110
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 67,091,786 - 67,091,949 (+) MAPPER mRatBN7.2 Rnor_6.0 8 72,219,833 - 72,219,995 NCBI Rnor6.0 Rnor_5.0 8 71,888,380 - 71,888,542 UniSTS Rnor5.0 RGSC_v3.4 8 70,834,122 - 70,834,284 UniSTS RGSC3.4 Celera 8 66,477,355 - 66,477,517 UniSTS RH 3.4 Map 8 849.5 UniSTS Cytogenetic Map 8 q24 UniSTS
AA925744
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 67,079,960 - 67,080,074 (+) MAPPER mRatBN7.2 Rnor_6.0 8 72,208,006 - 72,208,119 NCBI Rnor6.0 Rnor_5.0 8 71,875,723 - 71,875,836 UniSTS Rnor5.0 RGSC_v3.4 8 70,821,465 - 70,821,578 UniSTS RGSC3.4 Celera 8 66,465,541 - 66,465,654 UniSTS RH 3.4 Map 8 849.8 UniSTS Cytogenetic Map 8 q24 UniSTS
RH138449
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 67,099,323 - 67,099,458 (+) MAPPER mRatBN7.2 Rnor_6.0 8 72,227,370 - 72,227,504 NCBI Rnor6.0 Rnor_5.0 8 71,896,037 - 71,896,171 UniSTS Rnor5.0 RGSC_v3.4 8 70,841,789 - 70,841,923 UniSTS RGSC3.4 Celera 8 66,484,943 - 66,485,077 UniSTS RH 3.4 Map 8 845.9 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000057739 ⟹ ENSRNOP00000054551
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 67,079,927 - 67,154,111 (-) Ensembl Rnor_6.0 Ensembl 8 72,207,972 - 72,284,873 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000080319 ⟹ ENSRNOP00000073732
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 67,079,927 - 67,154,090 (-) Ensembl Rnor_6.0 Ensembl 8 72,207,972 - 72,284,852 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094873 ⟹ ENSRNOP00000084539
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 67,079,927 - 67,154,111 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100745 ⟹ ENSRNOP00000086159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 67,079,927 - 67,137,755 (-) Ensembl
RefSeq Acc Id:
NM_001025424 ⟹ NP_001020595
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 75,974,954 - 76,049,151 (-) NCBI mRatBN7.2 8 67,079,925 - 67,154,109 (-) NCBI Rnor_6.0 8 72,207,970 - 72,284,871 (-) NCBI Rnor_5.0 8 71,875,687 - 71,951,083 (-) NCBI RGSC_v3.4 8 70,821,429 - 70,897,119 (-) RGD Celera 8 66,465,505 - 66,539,503 (-) RGD
Sequence:
CGCGGGGAGCCACCTTCTGCCCAGCGCCGGGTCAGAAGCGACCCCAGACGGAGCCTCCGAAGTCCCTCCGCCCCAGAGCCTCGGCCGTCCCCGCCGCCGTCCTCGTGGCCATGGAGTGTCCGCACCTC
hide sequence
RefSeq Acc Id:
XM_039081750 ⟹ XP_038937678
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 75,973,278 - 76,034,667 (-) NCBI mRatBN7.2 8 67,078,249 - 67,134,112 (-) NCBI
RefSeq Acc Id:
XM_039081751 ⟹ XP_038937679
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 75,973,278 - 76,048,951 (-) NCBI mRatBN7.2 8 67,078,249 - 67,153,903 (-) NCBI
RefSeq Acc Id:
XM_063265769 ⟹ XP_063121839
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 75,973,278 - 76,048,238 (-) NCBI
RefSeq Acc Id:
NP_001020595 ⟸ NM_001025424
- UniProtKB:
Q4JL29 (UniProtKB/TrEMBL)
- Sequence:
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVLCGRYVNGHAKKHYEDAQIPLLNHKRSEKQEKAQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQSLENSAFTA
hide sequence
Ensembl Acc Id:
ENSRNOP00000073732 ⟸ ENSRNOT00000080319
Ensembl Acc Id:
ENSRNOP00000054551 ⟸ ENSRNOT00000057739
RefSeq Acc Id:
XP_038937679 ⟸ XM_039081751
- Peptide Label:
isoform X2
- UniProtKB:
Q4JL29 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038937678 ⟸ XM_039081750
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A351 (UniProtKB/TrEMBL), Q4JL29 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000086159 ⟸ ENSRNOT00000100745
Ensembl Acc Id:
ENSRNOP00000084539 ⟸ ENSRNOT00000094873
RefSeq Acc Id:
XP_063121839 ⟸ XM_063265769
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A351 (UniProtKB/TrEMBL), Q4JL29 (UniProtKB/TrEMBL)
RGD ID: 13696089 Promoter ID: EPDNEW_R6613 Type: multiple initiation site Name: Usp3_1 Description: ubiquitin specific peptidase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 72,284,898 - 72,284,958 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Usp3
ubiquitin specific peptidase 3
ubiquitin specific protease 3
Name updated
1299863 APPROVED
2005-12-06
Usp3
ubiquitin specific protease 3
Usp3_predicted
ubiquitin specific protease 3 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Usp3_predicted
ubiquitin specific protease 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
