Symbol:
Psmc6
Name:
proteasome 26S subunit, ATPase 6
RGD ID:
1308825
Description:
Predicted to enable identical protein binding activity. Involved in positive regulation of inclusion body assembly. Located in inclusion body. Part of cytosolic proteasome complex. Orthologous to human PSMC6 (proteasome 26S subunit, ATPase 6); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; aripiprazole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
26S protease regulatory subunit 10B; 26S proteasome regulatory subunit 10B; LOC289990; proteasome (prosome, macropain) 26S subunit, ATPase, 6; proteasome (prosome, macropain) 26S subunit, ATPase, 6-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PSMC6 (proteasome 26S subunit, ATPase 6)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Psmc6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Psmc6 (proteasome 26S subunit, ATPase 6)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PSMC6 (proteasome 26S subunit, ATPase 6)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LOC100687259 (26S proteasome regulatory subunit 10B)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Psmc6 (proteasome 26S subunit, ATPase 6)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PSMC6 (proteasome 26S subunit, ATPase 6)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PSMC6 (proteasome 26S subunit, ATPase 6)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Psmc6 (proteasome 26S subunit, ATPase 6)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PSMC6 (proteasome 26S subunit, ATPase 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Psmc6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
psmc6 (proteasome 26S subunit, ATPase 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpt-4
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPT4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpt4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpt4R
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
psmc6
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 21,022,314 - 21,043,785 (+) NCBI GRCr8 mRatBN7.2 15 18,542,585 - 18,564,057 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 18,542,563 - 18,564,055 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 21,337,420 - 21,358,885 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 22,294,373 - 22,315,842 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 20,550,951 - 20,572,416 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 19,667,453 - 19,688,916 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 19,667,453 - 19,688,914 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 23,631,640 - 23,653,072 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 21,217,367 - 21,239,320 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 21,217,379 - 21,238,663 (+) NCBI Celera 15 18,970,916 - 18,992,439 (+) NCBI Celera Cytogenetic Map 15 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psmc6 Rat (R,R,R)-alpha-tocopherol multiple interactions ISO RGD:1318820 6480464 alpha-Tocopherol inhibits the reaction [AGT protein results in increased expression of PSMC6 protein] CTD PMID:17532611 Psmc6 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1318820 6480464 1,2-Dimethylhydrazine results in decreased expression of PSMC6 mRNA CTD PMID:22206623 Psmc6 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1318820 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMC6 mRNA CTD PMID:22206623 Psmc6 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1318820 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMC6 mRNA CTD PMID:17942748 Psmc6 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PSMC6 protein CTD PMID:32145629 Psmc6 Rat 17beta-estradiol increases expression ISO RGD:1318820 6480464 Estradiol results in increased expression of PSMC6 mRNA CTD PMID:39298647 Psmc6 Rat 1H-pyrazole increases expression ISO RGD:1318820 6480464 pyrazole results in increased expression of PSMC6 mRNA CTD PMID:17945193 Psmc6 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1318820 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of PSMC6 mRNA CTD PMID:30294300 Psmc6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1318820 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMC6 mRNA CTD PMID:17942748 Psmc6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1318820 6480464 Tetrachlorodibenzodioxin affects the expression of PSMC6 mRNA CTD PMID:24680724 Psmc6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PSMC6 mRNA CTD PMID:21215274 Psmc6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1318820 6480464 Tetrachlorodibenzodioxin results in decreased expression of PSMC6 mRNA CTD PMID:19770486 Psmc6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1318820 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMC6 mRNA CTD PMID:19465110 Psmc6 Rat 2,6-di-tert-butyl-4-methylphenol multiple interactions ISO RGD:1318820 6480464 Butylated Hydroxytoluene inhibits the reaction [AGT protein results in increased expression of PSMC6 protein]; Butylated more ... CTD PMID:12470298|PMID:17532611 Psmc6 Rat 2,6-di-tert-butyl-4-methylphenol multiple interactions ISO RGD:1318819 6480464 Butylated Hydroxytoluene inhibits the reaction [TNF protein results in decreased expression of PSMC6 mRNA] CTD PMID:12470298 Psmc6 Rat 2-palmitoylglycerol increases expression ISO RGD:1318819 6480464 2-palmitoylglycerol results in increased expression of PSMC6 mRNA CTD PMID:37199045 Psmc6 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1318819 6480464 tetrabromobisphenol A results in decreased expression of PSMC6 protein CTD PMID:31675489 Psmc6 Rat 3H-1,2-dithiole-3-thione increases expression ISO RGD:1318820 6480464 1,2-dithiol-3-thione results in increased expression of PSMC6 mRNA CTD PMID:15375163 Psmc6 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1318820 6480464 bisphenol S results in increased expression of PSMC6 mRNA CTD PMID:39298647 Psmc6 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1318819 6480464 bisphenol S results in increased expression of PSMC6 protein CTD PMID:34186270 Psmc6 Rat acetylsalicylic acid decreases expression ISO RGD:1318819 6480464 Aspirin results in decreased expression of PSMC6 mRNA CTD PMID:11906190 Psmc6 Rat acrolein multiple interactions ISO RGD:1318819 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Psmc6 Rat alpha-pinene multiple interactions ISO RGD:1318819 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Psmc6 Rat aripiprazole increases expression EXP 6480464 Aripiprazole results in increased expression of PSMC6 mRNA CTD PMID:17868501 Psmc6 Rat arsane increases methylation ISO RGD:1318819 6480464 Arsenic results in increased methylation of PSMC6 promoter CTD PMID:21291286 Psmc6 Rat arsane multiple interactions ISO RGD:1318819 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc6 Rat arsenic atom increases methylation ISO RGD:1318819 6480464 Arsenic results in increased methylation of PSMC6 promoter CTD PMID:21291286 Psmc6 Rat arsenic atom multiple interactions ISO RGD:1318819 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc6 Rat atrazine increases expression ISO RGD:1318819 6480464 Atrazine results in increased expression of PSMC6 mRNA CTD PMID:22378314 Psmc6 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of PSMC6 mRNA CTD PMID:21839799 Psmc6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMC6 mRNA CTD PMID:25181051 Psmc6 Rat bisphenol A decreases expression ISO RGD:1318820 6480464 bisphenol A results in decreased expression of PSMC6 mRNA CTD PMID:33221593 Psmc6 Rat bisphenol A decreases expression ISO RGD:1318819 6480464 bisphenol A results in decreased expression of PSMC6 mRNA CTD PMID:29275510 Psmc6 Rat Bisphenol B increases expression ISO RGD:1318819 6480464 bisphenol B results in increased expression of PSMC6 protein CTD PMID:34186270 Psmc6 Rat bisphenol F increases expression ISO RGD:1318819 6480464 bisphenol F results in increased expression of PSMC6 protein CTD PMID:34186270 Psmc6 Rat butylated hydroxyanisole multiple interactions ISO RGD:1318820 6480464 Butylated Hydroxyanisole inhibits the reaction [Reactive Oxygen Species results in decreased expression of PSMC6 mRNA] CTD PMID:12470298 Psmc6 Rat butylated hydroxyanisole multiple interactions ISO RGD:1318819 6480464 Butylated Hydroxyanisole inhibits the reaction [TNF protein results in decreased expression of PSMC6 mRNA] CTD PMID:12470298 Psmc6 Rat cadmium atom multiple interactions ISO RGD:1318819 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PSMC6 more ... CTD PMID:35301059 Psmc6 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PSMC6 mRNA CTD PMID:33453195 Psmc6 Rat cadmium dichloride multiple interactions ISO RGD:1318819 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PSMC6 more ... CTD PMID:35301059 Psmc6 Rat Calphostin C multiple interactions ISO RGD:1318820 6480464 calphostin C inhibits the reaction [AGT protein results in increased expression of PSMC6 protein] CTD PMID:16257180 Psmc6 Rat clofibrate increases expression ISO RGD:1318820 6480464 Clofibrate results in increased expression of PSMC6 mRNA CTD PMID:23811191 Psmc6 Rat clothianidin decreases expression ISO RGD:1318819 6480464 clothianidin results in decreased expression of PSMC6 mRNA CTD PMID:31626844 Psmc6 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of PSMC6 mRNA CTD PMID:24386269 Psmc6 Rat cobalt dichloride increases expression ISO RGD:1318819 6480464 cobaltous chloride results in increased expression of PSMC6 mRNA CTD PMID:19376846 Psmc6 Rat copper(II) sulfate decreases expression ISO RGD:1318819 6480464 Copper Sulfate results in decreased expression of PSMC6 mRNA CTD PMID:19549813 Psmc6 Rat cyclosporin A decreases expression ISO RGD:1318820 6480464 Cyclosporine results in decreased expression of PSMC6 mRNA CTD PMID:19770486 Psmc6 Rat decabromodiphenyl ether decreases expression ISO RGD:1318819 6480464 decabromobiphenyl ether results in decreased expression of PSMC6 protein CTD PMID:31675489 Psmc6 Rat dicrotophos decreases expression ISO RGD:1318819 6480464 dicrotophos results in decreased expression of PSMC6 mRNA CTD PMID:28302478 Psmc6 Rat doxorubicin affects expression ISO RGD:1318819 6480464 Doxorubicin affects the expression of PSMC6 mRNA CTD PMID:29803840 Psmc6 Rat elesclomol increases expression ISO RGD:1318819 6480464 elesclomol results in increased expression of PSMC6 mRNA CTD PMID:18723479 Psmc6 Rat ethanol multiple interactions ISO RGD:1318820 6480464 Ethanol affects the expression of and affects the splicing of PSMC6 mRNA CTD PMID:30319688 Psmc6 Rat fenofibrate increases expression ISO RGD:1318820 6480464 Fenofibrate results in increased expression of PSMC6 mRNA CTD PMID:21318169 Psmc6 Rat fenofibrate multiple interactions ISO RGD:1318820 6480464 PPARA protein affects the reaction [Fenofibrate results in increased expression of PSMC6 mRNA] CTD PMID:21318169 Psmc6 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMC6 mRNA CTD PMID:24136188 Psmc6 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PSMC6 mRNA CTD PMID:23962444 Psmc6 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMC6 mRNA CTD PMID:24136188 Psmc6 Rat folic acid multiple interactions ISO RGD:1318820 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMC6 mRNA CTD PMID:22206623 Psmc6 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PSMC6 mRNA CTD PMID:24136188 Psmc6 Rat hydralazine multiple interactions ISO RGD:1318819 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PSMC6 mRNA CTD PMID:17183730 Psmc6 Rat hydrogen peroxide affects expression ISO RGD:1318819 6480464 Hydrogen Peroxide affects the expression of PSMC6 mRNA CTD PMID:20044591 Psmc6 Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of PSMC6 mRNA CTD PMID:30303030 Psmc6 Rat ivermectin decreases expression ISO RGD:1318819 6480464 Ivermectin results in decreased expression of PSMC6 protein CTD PMID:32959892 Psmc6 Rat kojic acid decreases expression ISO RGD:1318819 6480464 kojic acid results in decreased expression of PSMC6 mRNA CTD PMID:16595896 Psmc6 Rat lead diacetate increases expression ISO RGD:1318820 6480464 lead acetate results in increased expression of PSMC6 mRNA CTD PMID:21829687 Psmc6 Rat manganese atom multiple interactions ISO RGD:1318819 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc6 Rat manganese(0) multiple interactions ISO RGD:1318819 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc6 Rat manganese(II) chloride multiple interactions ISO RGD:1318819 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Psmc6 Rat miconazole decreases expression ISO RGD:1318820 6480464 Miconazole results in decreased expression of PSMC6 mRNA CTD PMID:27462272 Psmc6 Rat mifepristone increases expression ISO RGD:1318819 6480464 Mifepristone results in increased expression of PSMC6 mRNA CTD PMID:17584828 Psmc6 Rat monocrotaline increases expression EXP 6480464 Monocrotaline results in increased expression of PSMC6 mRNA CTD PMID:18801959 Psmc6 Rat monocrotaline multiple interactions EXP 6480464 Pentoxifylline inhibits the reaction [Monocrotaline results in increased expression of PSMC6 mRNA] CTD PMID:18801959 Psmc6 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO RGD:1318819 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMC6 mRNA CTD PMID:31806706 Psmc6 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMC6 mRNA CTD PMID:24136188 Psmc6 Rat ozone multiple interactions ISO RGD:1318819 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268|PMID:35430440 Psmc6 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PSMC6 mRNA CTD PMID:33387578 Psmc6 Rat Pentoxifylline multiple interactions EXP 6480464 Pentoxifylline inhibits the reaction [Monocrotaline results in increased expression of PSMC6 mRNA] CTD PMID:18801959 Psmc6 Rat perfluorohexanesulfonic acid increases expression ISO RGD:1318820 6480464 perfluorohexanesulfonic acid results in increased expression of PSMC6 mRNA CTD PMID:37995155 Psmc6 Rat perfluorooctane-1-sulfonic acid affects expression ISO RGD:1318820 6480464 perfluorooctane sulfonic acid affects the expression of PSMC6 mRNA CTD PMID:19429403 Psmc6 Rat perfluorooctanoic acid affects expression ISO RGD:1318820 6480464 perfluorooctanoic acid affects the expression of PSMC6 mRNA CTD PMID:19429403 Psmc6 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of PSMC6 mRNA CTD PMID:20345932 Psmc6 Rat phlorizin decreases expression ISO RGD:1318820 6480464 Phlorhizin results in decreased expression of PSMC6 mRNA CTD PMID:22538082 Psmc6 Rat phorbol 13-acetate 12-myristate increases expression ISO RGD:1318820 6480464 Tetradecanoylphorbol Acetate results in increased expression of PSMC6 protein CTD PMID:16343552 Psmc6 Rat pirinixic acid increases expression ISO RGD:1318820 6480464 pirinixic acid results in increased expression of PSMC6 mRNA CTD PMID:15375163|PMID:23811191 Psmc6 Rat reactive oxygen species multiple interactions ISO RGD:1318820 6480464 Butylated Hydroxyanisole inhibits the reaction [Reactive Oxygen Species results in decreased expression of PSMC6 mRNA]; more ... CTD PMID:12470298 Psmc6 Rat reactive oxygen species decreases expression ISO RGD:1318820 6480464 Reactive Oxygen Species results in decreased expression of PSMC6 mRNA CTD PMID:12470298 Psmc6 Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of PSMC6 mRNA CTD PMID:25905778 Psmc6 Rat resveratrol multiple interactions ISO RGD:1318819 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PSMC6 mRNA CTD PMID:23557933 Psmc6 Rat rotenone increases expression ISO RGD:1318819 6480464 Rotenone results in increased expression of PSMC6 mRNA CTD PMID:33512557 Psmc6 Rat silicon dioxide decreases expression ISO RGD:1318820 6480464 Silicon Dioxide results in decreased expression of PSMC6 mRNA CTD PMID:19073995 Psmc6 Rat sodium arsenite increases expression ISO RGD:1318820 6480464 sodium arsenite results in increased expression of PSMC6 mRNA CTD PMID:16014739 Psmc6 Rat sodium arsenite multiple interactions ISO RGD:1318819 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:33939924|PMID:39836092 Psmc6 Rat sodium arsenite increases expression ISO RGD:1318819 6480464 sodium arsenite results in increased expression of PSMC6 mRNA CTD PMID:38568856 Psmc6 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PSMC6 mRNA CTD PMID:19281266 Psmc6 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of PSMC6 mRNA CTD PMID:24136188 Psmc6 Rat temozolomide increases expression ISO RGD:1318819 6480464 Temozolomide results in increased expression of PSMC6 mRNA CTD PMID:31758290 Psmc6 Rat tetrachloroethene increases expression ISO RGD:1318820 6480464 Tetrachloroethylene results in increased expression of PSMC6 mRNA CTD PMID:28973375 Psmc6 Rat tetrachloromethane increases expression ISO RGD:1318820 6480464 Carbon Tetrachloride results in increased expression of PSMC6 mRNA CTD PMID:31919559 Psmc6 Rat thiram increases expression ISO RGD:1318819 6480464 Thiram results in increased expression of PSMC6 mRNA CTD PMID:38568856 Psmc6 Rat trichloroethene affects expression ISO RGD:1318820 6480464 Trichloroethylene affects the expression of PSMC6 mRNA CTD PMID:21135412 Psmc6 Rat triphenyl phosphate affects expression ISO RGD:1318819 6480464 triphenyl phosphate affects the expression of PSMC6 mRNA CTD PMID:37042841 Psmc6 Rat tungsten increases expression ISO RGD:1318820 6480464 Tungsten results in increased expression of PSMC6 mRNA CTD PMID:30912803 Psmc6 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMC6 mRNA CTD PMID:24136188 Psmc6 Rat valproic acid decreases methylation ISO RGD:1318819 6480464 Valproic Acid results in decreased methylation of PSMC6 gene CTD PMID:29154799 Psmc6 Rat valproic acid multiple interactions ISO RGD:1318819 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PSMC6 mRNA CTD PMID:17183730 Psmc6 Rat valproic acid decreases expression ISO RGD:1318819 6480464 Valproic Acid results in decreased expression of PSMC6 mRNA CTD PMID:23179753|PMID:27188386
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Psmc6 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Psmc6 Rat ATP binding enables IEA InterPro:IPR003959|InterPro:IPR003960 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Psmc6 Rat ATP hydrolysis activity enables IEA InterPro:IPR003593|InterPro:IPR003959|InterPro:IPR003960 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Psmc6 Rat identical protein binding enables ISO RGD:1318819 1624291 UniProtKB:P62333 PMID:25416956, PMID:32296183 RGD PMID:25416956|PMID:32296183 Psmc6 Rat identical protein binding enables IEA UniProtKB:P62333|ensembl:ENSP00000401802 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Psmc6 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Psmc6 Rat protein binding enables ISO RGD:1318819 1624291 UniProtKB:O00233|UniProtKB:O00560|UniProtKB:O43304|UniProtKB:O76024|UniProtKB:P04792|UniProtKB:P17980|UniProtKB:P22607|UniProtKB:P43686|UniProtKB:P46108|UniProtKB:P46109|UniProtKB:P52655|UniProtKB:P55036|UniProtKB:P59595|UniProtKB:P62191|UniProtKB:P62195|UniProtKB:Q13895|UniProtKB:Q14957|UniProtKB:Q14997|UniProtKB:Q16543|UniProtKB:Q6BCY4|UniProtKB:Q7KZS0|UniProtKB:Q8IYE0-2|UniProtKB:Q8TAB5|UniProtKB:Q969G3 PMID:16189514, PMID:16763564, PMID:16990800, PMID:18845680, PMID:19490896, PMID:20478047, PMID:21516116, PMID:25416956, PMID:26496610, PMID:26871637, PMID:27342858, PMID:28514442, PMID:29636472, more ... RGD PMID:16189514|PMID:16763564|PMID:16990800|PMID:18845680|PMID:19490896|PMID:20478047|PMID:21516116|PMID:25416956|PMID:26496610|PMID:26871637|PMID:27342858|PMID:28514442|PMID:29636472|PMID:31515488|PMID:32296183|PMID:32814053|PMID:33961781|PMID:35271311
Imported Annotations - KEGG (archival)
(R,R,R)-alpha-tocopherol (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-di-tert-butyl-4-methylphenol (ISO) 2-palmitoylglycerol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (ISO) acetylsalicylic acid (ISO) acrolein (ISO) alpha-pinene (ISO) aripiprazole (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (EXP) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) butylated hydroxyanisole (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) Calphostin C (ISO) clofibrate (ISO) clothianidin (ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dicrotophos (ISO) doxorubicin (ISO) elesclomol (ISO) ethanol (ISO) fenofibrate (ISO) finasteride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) glafenine (EXP) hydralazine (ISO) hydrogen peroxide (ISO) isoprenaline (EXP) ivermectin (ISO) kojic acid (ISO) lead diacetate (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) miconazole (ISO) mifepristone (ISO) monocrotaline (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nefazodone (EXP) ozone (ISO) paracetamol (EXP) Pentoxifylline (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenytoin (EXP) phlorizin (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) reactive oxygen species (ISO) resveratrol (EXP,ISO) rotenone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) sulindac (EXP) temozolomide (ISO) tetrachloroethene (ISO) tetrachloromethane (ISO) thiram (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) tungsten (ISO) valdecoxib (EXP) valproic acid (ISO)
Psmc6 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 21,022,314 - 21,043,785 (+) NCBI GRCr8 mRatBN7.2 15 18,542,585 - 18,564,057 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 18,542,563 - 18,564,055 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 21,337,420 - 21,358,885 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 22,294,373 - 22,315,842 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 20,550,951 - 20,572,416 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 19,667,453 - 19,688,916 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 19,667,453 - 19,688,914 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 23,631,640 - 23,653,072 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 21,217,367 - 21,239,320 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 21,217,379 - 21,238,663 (+) NCBI Celera 15 18,970,916 - 18,992,439 (+) NCBI Celera Cytogenetic Map 15 p14 NCBI
PSMC6 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 52,707,200 - 52,728,590 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 52,707,178 - 52,728,590 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 53,173,918 - 53,195,308 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 52,243,668 - 52,264,466 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 52,243,667 - 52,264,465 NCBI Celera 14 33,041,500 - 33,062,289 (+) NCBI Celera Cytogenetic Map 14 q22.1 NCBI HuRef 14 33,334,988 - 33,355,703 (+) NCBI HuRef CHM1_1 14 53,112,814 - 53,133,601 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 46,915,014 - 46,936,383 (+) NCBI T2T-CHM13v2.0
Psmc6 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 45,567,285 - 45,587,150 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 45,567,245 - 45,587,162 (+) Ensembl GRCm39 Ensembl GRCm38 14 45,329,823 - 45,349,074 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 45,329,788 - 45,349,705 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 45,949,499 - 45,968,746 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 44,251,701 - 44,270,948 (+) NCBI MGSCv36 mm8 Celera 14 41,509,669 - 41,529,121 (+) NCBI Celera Cytogenetic Map 14 C1 NCBI cM Map 14 22.89 NCBI
Psmc6 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 10,452,615 - 10,475,100 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 10,454,210 - 10,474,872 (-) NCBI ChiLan1.0 ChiLan1.0
PSMC6 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 53,838,194 - 53,859,022 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 53,054,704 - 53,075,532 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 33,303,689 - 33,324,502 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 51,587,467 - 51,608,044 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 51,587,467 - 51,608,044 (+) Ensembl panpan1.1 panPan2
LOC100687259 (Canis lupus familiaris - dog)
Psmc6 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 76,348,572 - 76,369,833 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936697 2,121,677 - 2,144,066 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936697 2,122,727 - 2,143,988 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMC6 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 182,328,521 - 182,354,958 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 182,329,070 - 182,354,959 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 202,599,698 - 202,625,501 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMC6 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 29,784,825 - 29,807,701 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 29,784,826 - 29,807,490 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 18,060,172 - 18,082,302 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Psmc6 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 153 Count of miRNA genes: 109 Interacting mature miRNAs: 126 Transcripts: ENSRNOT00000009649 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat
RH139811
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 18,563,710 - 18,563,914 (+) MAPPER mRatBN7.2 Rnor_6.0 15 19,688,570 - 19,688,773 NCBI Rnor6.0 Rnor_5.0 15 23,652,726 - 23,652,929 UniSTS Rnor5.0 RGSC_v3.4 15 21,238,974 - 21,239,177 UniSTS RGSC3.4 Celera 15 18,992,093 - 18,992,296 UniSTS RH 3.4 Map 15 156.3 UniSTS Cytogenetic Map 15 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009649 ⟹ ENSRNOP00000009649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 18,542,585 - 18,564,055 (+) Ensembl Rnor_6.0 Ensembl 15 19,667,453 - 19,688,914 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099537 ⟹ ENSRNOP00000091801
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 18,542,563 - 18,555,669 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105410 ⟹ ENSRNOP00000082787
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 18,542,632 - 18,563,263 (+) Ensembl
RefSeq Acc Id:
NM_001100509 ⟹ NP_001093979
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 21,022,314 - 21,043,785 (+) NCBI mRatBN7.2 15 18,542,585 - 18,564,057 (+) NCBI Rnor_6.0 15 19,667,453 - 19,688,916 (+) NCBI Rnor_5.0 15 23,631,640 - 23,653,072 (+) NCBI RGSC_v3.4 15 21,217,367 - 21,239,320 (+) RGD Celera 15 18,970,916 - 18,992,439 (+) NCBI
Sequence:
CGCCCGGGCTGCTATGGCCCTTCCCGGCATCCCCTATGAGCGACGGCTTCTCATCATGGCGGACCCTAGAGATAAGGCGCTTCAGGACTACCGCAAGAAGCTGCTAGAACACAAGGAGATTGACGGCC GTCTTAAGGAGCTAAGGGAACAATTAAAAGAACTTACCAAGCAGTATGAAAAGTCTGAAAATGATCTGAAGGCACTACAAAGTGTTGGACAGATTGTAGGCGAAGTGCTTAAACAGTTAACAGAAGAA AAGTTCATTGTTAAAGCAACAAACGGACCAAGATACGTCGTAGGCTGTCGTCGGCAGCTTGATAAAAGTAAGCTGAAGCCAGGAACCAGAGTTGCTTTGGATATGACCACCCTAACCATCATGAGGTA TCTGCCGAGAGAGGTGGATCCATTGGTTTATAACATGTCTCATGAGGATCCTGGAAATGTATCTTATTCTGAGATTGGAGGCCTGTCAGAACAGATTCGGGAATTAAGAGAGGTAATAGAATTACCTC TTACAAATCCAGAATTATTCCAGCGTGTAGGAATAATACCTCCAAAAGGCTGTTTGCTCTATGGACCACCAGGCACTGGGAAAACACTCTTGGCACGAGCTGTCGCCAGCCAGCTGGACTGCAACTTC CTAAAGGTTGTGTCAAGCTCTATTGTAGACAAGTACATTGGGGAAAGCGCTCGTTTGATTAGAGAAATGTTTAATTATGCCAGGGACCACCAGCCATGCATCATTTTTATGGATGAAATAGATGCTAT TGGTGGTCGTCGGTTTTCTGAGGGAACATCAGCTGACAGAGAGATTCAGAGAACTTTAATGGAGTTACTAAATCAAATGGATGGATTTGACACTCTTCATAGAGTTAAAATGATCATGGCTACAAACA GACCAGATACACTGGATCCTGCTTTGCTGCGCCCAGGAAGATTAGATAGAAAAATACATATTGATTTACCAAATGAACAAGCAAGATTAGATATATTGAAAATCCACGCTGGTCCTATTACAAAGCAT GGTGAAATAGATTATGAAGCCATTGTAAAGCTTTCAGATGGCTTTAATGGAGCAGACCTGAGAAATGTTTGTACTGAAGCAGGTATGTTTGCAATTCGTGCTGATCATGATTTTGTAGTTCAGGAAGA CTTCATGAAAGCAGTCAGAAAAGTGGCTGACTCCAAGAAGCTAGAGTCCAAACTGGACTATAAACCTGTGTAATTTTCTATAAGGTTTTTGGTGGCTGCATGACAGACATTGGCTTAATGTAAAAATA AAGTTAAGGAAAATAATGTATGTATTGGCAATGATCTCATTAAAAGTGAATAAACATGTATAAGCAACATAATAAGCAATGTAACAGTAATTCCTTTAAAACTGGTACAGAAGAAAGTTGTATGTTTG TTAATGTTGCATTTACTGCAGCAGAACTTACAAAAGACATGCTGAAGCTTTTCGTATTTGCTTTGTGAGCATTTTGTACAACATTCAAAATGGTTGAGATAGTAGAGGAGAGCATTTCTTATGACTTA TTTCATATCTTGTTTTCCTCGTCCTAAAAAAAAAAGCAATAAAGTCTGTTTTAGCTGTCCTGTATATATTCCTGTCTTTTCTAAGAGCATTTATTCTAGACCTTTTGGATCAGTAAGTACATGATTTG AGAGCCTGGGAAACTGAAAATTAAAATAGGACTTTGAATTTTATTTTAAAACAATATTCAGGGGCTGGGGTAGTAGCTCAGTGGTAGAGCGCTTGCCTAGGAAGCGCAAGGCCCTGGGTTCGGTCCCC AGCTCCGAAAAAAAGAACCAAAAAAAAAAAAACAATATTCAAAGAGTCTACAAAATTGTCTTCTTGTATATATCATACAGTGTGGGTATGGAATGCATACATGCATTTGTGTCTTCCAAGAAATCTCT GTACCTGCTGCAGTTAGGCTATAACTTAAAGATTATGACTGGGAGTAATGCTCATAGTTAATTTGGTTTATGTCAAAAAGTAATTGCCTTTTGAGGTCTGGATCCAGGAAAGGTCCGTGTGGACATAT AATTTTACATATCCATGATTTCTAGAGATGTATTATTTATTTCCTAGGCTCACCAACAGATGCTATAACCATCTTCCGGTAGATACCAGGCTGAGAGTGTCTATTCTATGGAATGTGAATGTCAGAAA TGTTCAAAATAAAAGTTCTGTTATCTATACACAATTCTAATTTCATGTGGCAATCAAAAGTTGTATAAGGAAATTGTCAATGTCTAAAACTTGATTATTTATAGTTAAAGCTTTGTTTAAATAAAGAT ACCAAACTTCAATTTCATAAGTACCAAAGGACTAACCATAAATATAAATGATCTGGCTAGGTATGTAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039093096 ⟹ XP_038949024
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 21,022,355 - 21,043,004 (+) NCBI mRatBN7.2 15 18,542,664 - 18,563,275 (+) NCBI
RefSeq Acc Id:
NP_001093979 ⟸ NM_001100509
- UniProtKB:
G3V6W6 (UniProtKB/TrEMBL), Q32PW9 (UniProtKB/TrEMBL), A6KDZ6 (UniProtKB/TrEMBL)
- Sequence:
MALPGIPYERRLLIMADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPRE VDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRR FSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKA VRKVADSKKLESKLDYKPV
hide sequence
Ensembl Acc Id:
ENSRNOP00000009649 ⟸ ENSRNOT00000009649
RefSeq Acc Id:
XP_038949024 ⟸ XM_039093096
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000082787 ⟸ ENSRNOT00000105410
Ensembl Acc Id:
ENSRNOP00000091801 ⟸ ENSRNOT00000099537
RGD ID: 13699596
Promoter ID: EPDNEW_R10119
Type: multiple initiation site
Name: Psmc6_1
Description: proteasome 26S subunit, ATPase 6
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 19,667,488 - 19,667,548 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-19
Psmc6
proteasome 26S subunit, ATPase 6
Psmc6
proteasome (prosome, macropain) 26S subunit, ATPase, 6
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-03-30
Psmc6
proteasome (prosome, macropain) 26S subunit, ATPase, 6
Symbol and Name updated
1299863
APPROVED
2006-03-07
Psmc6
proteasome (prosome, macropain) 26S subunit, ATPase, 6
Psmc6_predicted
proteasome (prosome, macropain) 26S subunit, ATPase, 6 (predicted)
Symbol and Name status set to approved
1299863
APPROVED
2005-01-12
Psmc6_predicted
proteasome (prosome, macropain) 26S subunit, ATPase, 6 (predicted)
Symbol and Name status set to approved
70820
APPROVED