Symbol:
Cyld
Name:
CYLD lysine 63 deubiquitinase
RGD ID:
1308346
Description:
Predicted to enable several functions, including deubiquitinase activity; proline-rich region binding activity; and zinc ion binding activity. Involved in regulation of neurotransmitter receptor localization to postsynaptic specialization membrane and regulation protein catabolic process at postsynapse. Is active in glutamatergic synapse and postsynaptic density. Human ortholog(s) of this gene implicated in Brooke-Spiegler syndrome. Orthologous to human CYLD (CYLD lysine 63 deubiquitinase); PARTICIPATES IN nuclear factor kappa B signaling pathway; tumor necrosis factor mediated signaling pathway; Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; acrylamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
40S ribosomal protein S3a-like; cylindromatosis (turban tumor syndrome); deubiquitinating enzyme CYLD; LOC100362727; LOC100911739; LOC312937; LRRGT00003; probable ubiquitin carboxyl-terminal hydrolase CYLD; probable ubiquitin carboxyl-terminal hydrolase CYLD-like; retinitis pigmentosa 1 (autosomal dominant); retinitis pigmentosa 1 homolog; retinitis pigmentosa 1 homolog (human); Rp1; Rp1h; ubiquitin carboxyl-terminal hydrolase CYLD; ubiquitin thioesterase CYLD; ubiquitin thiolesterase CYLD; ubiquitin-specific-processing protease CYLD
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Cyld-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 34,487,491 - 34,547,311 (-) NCBI GRCr8 mRatBN7.2 19 18,310,632 - 18,373,696 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 18,314,019 - 18,373,658 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 19,994,711 - 20,053,224 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 25,189,306 - 25,247,825 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 28,146,665 - 28,205,606 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 19,264,984 - 19,323,817 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 19,265,164 - 19,315,357 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 30,298,220 - 30,357,107 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 19,616,209 - 19,619,221 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 18,203,184 - 18,261,162 (-) NCBI Celera Cytogenetic Map 19 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cyld Rat (1->4)-beta-D-glucan multiple interactions ISO Cyld (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CYLD mRNA CTD PMID:36331819 Cyld Rat 1,2-dimethylhydrazine decreases expression ISO Cyld (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CYLD mRNA CTD PMID:22206623 Cyld Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cyld (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CYLD mRNA CTD PMID:15328365 Cyld Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CYLD mRNA CTD PMID:34747641 Cyld Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CYLD mRNA CTD PMID:32109520 Cyld Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cyld (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CYLD mRNA CTD PMID:21570461 Cyld Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Cyld (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CYLD mRNA CTD PMID:26251327 Cyld Rat 4,4'-sulfonyldiphenol decreases expression ISO Cyld (Mus musculus) 6480464 bisphenol S results in decreased expression of CYLD mRNA CTD PMID:39298647 Cyld Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CYLD mRNA CTD PMID:36041667 Cyld Rat 4-hydroxyphenyl retinamide decreases expression ISO Cyld (Mus musculus) 6480464 Fenretinide results in decreased expression of CYLD mRNA CTD PMID:28973697 Cyld Rat 5-fluorouracil increases response to substance ISO CYLD (Homo sapiens) 6480464 CYLD protein results in increased susceptibility to Fluorouracil CTD PMID:21109933 Cyld Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of CYLD mRNA CTD PMID:28959563 Cyld Rat acrylamide increases expression ISO CYLD (Homo sapiens) 6480464 Acrylamide results in increased expression of CYLD mRNA CTD PMID:32763439 Cyld Rat aflatoxin B1 increases expression ISO Cyld (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of CYLD mRNA CTD PMID:19770486 Cyld Rat aflatoxin B1 increases methylation ISO CYLD (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CYLD exon CTD PMID:30157460 Cyld Rat aflatoxin B1 increases expression ISO CYLD (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CYLD mRNA CTD PMID:21641981 Cyld Rat all-trans-retinoic acid increases expression ISO CYLD (Homo sapiens) 6480464 Tretinoin results in increased expression of CYLD mRNA CTD PMID:33167477 Cyld Rat antirheumatic drug decreases expression ISO CYLD (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CYLD mRNA CTD PMID:24449571 Cyld Rat aripiprazole multiple interactions ISO CYLD (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of CYLD mRNA CTD PMID:31476115 Cyld Rat arsane multiple interactions ISO CYLD (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CYLD mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CYLD mRNA CTD PMID:39836092 Cyld Rat arsenic atom multiple interactions ISO CYLD (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CYLD mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of CYLD mRNA CTD PMID:39836092 Cyld Rat arsenous acid decreases expression ISO CYLD (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CYLD mRNA CTD PMID:15761015 Cyld Rat atazanavir sulfate increases expression ISO CYLD (Homo sapiens) 6480464 Atazanavir Sulfate results in increased expression of CYLD mRNA CTD PMID:32152650 Cyld Rat atazanavir sulfate multiple interactions ISO CYLD (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CYLD mRNA CTD PMID:32152650 Cyld Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of CYLD mRNA CTD PMID:36841081 Cyld Rat benzo[a]pyrene increases expression ISO Cyld (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CYLD mRNA CTD PMID:20504355 Cyld Rat benzo[a]pyrene multiple interactions ISO Cyld (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CYLD mRNA CTD PMID:27858113 Cyld Rat benzo[b]fluoranthene multiple interactions ISO Cyld (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CYLD mRNA CTD PMID:27858113 Cyld Rat bisphenol A decreases expression ISO CYLD (Homo sapiens) 6480464 bisphenol A results in decreased expression of CYLD mRNA CTD PMID:20678512 Cyld Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CYLD mRNA CTD PMID:36041667 Cyld Rat bisphenol A decreases methylation ISO CYLD (Homo sapiens) 6480464 bisphenol A results in decreased methylation of CYLD gene CTD PMID:31601247 Cyld Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CYLD mRNA CTD PMID:25181051 Cyld Rat bisphenol A increases expression ISO Cyld (Mus musculus) 6480464 bisphenol A results in increased expression of CYLD mRNA CTD PMID:20739668 and PMID:33221593 Cyld Rat bisphenol A decreases expression ISO Cyld (Mus musculus) 6480464 bisphenol A results in decreased expression of CYLD mRNA CTD PMID:20739668 Cyld Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CYLD mRNA CTD PMID:36041667 Cyld Rat butanal decreases expression ISO CYLD (Homo sapiens) 6480464 butyraldehyde results in decreased expression of CYLD mRNA CTD PMID:26079696 Cyld Rat cannabidiol increases expression ISO CYLD (Homo sapiens) 6480464 Cannabidiol results in increased expression of CYLD mRNA CTD PMID:31801206 Cyld Rat cannabidiol multiple interactions ISO CYLD (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in increased expression of CYLD mRNA CTD PMID:30096889 Cyld Rat carbon nanotube decreases expression ISO Cyld (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Cyld Rat CGP 52608 multiple interactions ISO CYLD (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CYLD gene] CTD PMID:28238834 Cyld Rat chenodeoxycholic acid multiple interactions ISO CYLD (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CYLD mRNA more ... CTD PMID:32152650 Cyld Rat chlorpyrifos increases expression ISO Cyld (Mus musculus) 6480464 Chlorpyrifos results in increased expression of CYLD mRNA CTD PMID:27737797 Cyld Rat chlorpyrifos decreases expression ISO Cyld (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CYLD mRNA CTD PMID:37019170 Cyld Rat choline multiple interactions ISO Cyld (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CYLD gene CTD PMID:20938992 Cyld Rat chrysene multiple interactions ISO Cyld (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CYLD mRNA CTD PMID:27858113 Cyld Rat cisplatin increases response to substance ISO CYLD (Homo sapiens) 6480464 CYLD protein results in increased susceptibility to Cisplatin CTD PMID:21109933 Cyld Rat cisplatin multiple interactions ISO CYLD (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CYLD mRNA CTD PMID:27392435 Cyld Rat cisplatin increases expression ISO CYLD (Homo sapiens) 6480464 Cisplatin results in increased expression of CYLD mRNA CTD PMID:27594783 Cyld Rat copper atom multiple interactions ISO CYLD (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of CYLD mRNA CTD PMID:20971185 Cyld Rat copper(0) multiple interactions ISO CYLD (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of CYLD mRNA CTD PMID:20971185 Cyld Rat crocidolite asbestos increases expression ISO CYLD (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of CYLD mRNA CTD PMID:18687144 Cyld Rat crocidolite asbestos decreases expression ISO Cyld (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of CYLD mRNA CTD PMID:29279043 Cyld Rat cyclosporin A increases expression ISO CYLD (Homo sapiens) 6480464 Cyclosporine results in increased expression of CYLD mRNA CTD PMID:20106945 and PMID:32152650 Cyld Rat cyclosporin A multiple interactions ISO CYLD (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CYLD mRNA CTD PMID:32152650 Cyld Rat cyclosporin A decreases expression ISO CYLD (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CYLD mRNA CTD PMID:25562108 and PMID:34681664 Cyld Rat cylindrospermopsin increases expression ISO CYLD (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of CYLD mRNA CTD PMID:24921660 Cyld Rat cypermethrin increases expression ISO CYLD (Homo sapiens) 6480464 cypermethrin results in increased expression of CYLD mRNA CTD PMID:27704156 Cyld Rat DDE decreases expression ISO CYLD (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CYLD mRNA CTD PMID:38568856 Cyld Rat deoxycholic acid multiple interactions ISO CYLD (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CYLD mRNA more ... CTD PMID:32152650 Cyld Rat diarsenic trioxide decreases expression ISO CYLD (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CYLD mRNA CTD PMID:15761015 Cyld Rat Dibutyl phosphate affects expression ISO CYLD (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CYLD mRNA CTD PMID:37042841 Cyld Rat dicrotophos decreases expression ISO CYLD (Homo sapiens) 6480464 dicrotophos results in decreased expression of CYLD mRNA CTD PMID:28302478 Cyld Rat dorsomorphin multiple interactions ISO CYLD (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CYLD mRNA CTD PMID:27188386 Cyld Rat doxorubicin increases response to substance ISO CYLD (Homo sapiens) 6480464 CYLD protein results in increased susceptibility to Doxorubicin CTD PMID:21109933 Cyld Rat doxorubicin increases expression ISO Cyld (Mus musculus) 6480464 Doxorubicin results in increased expression of CYLD protein CTD PMID:36195186 Cyld Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of CYLD protein CTD PMID:36195186 Cyld Rat emodin increases expression ISO Cyld (Mus musculus) 6480464 Emodin results in increased expression of CYLD mRNA CTD PMID:21319176 Cyld Rat epoxiconazole decreases expression ISO Cyld (Mus musculus) 6480464 epoxiconazole results in decreased expression of CYLD mRNA CTD PMID:35436446 Cyld Rat ethanol affects splicing ISO Cyld (Mus musculus) 6480464 Ethanol affects the splicing of CYLD mRNA CTD PMID:30319688 Cyld Rat ethanol affects expression ISO Cyld (Mus musculus) 6480464 Ethanol affects the expression of CYLD mRNA CTD PMID:30319688 Cyld Rat ethyl methanesulfonate increases expression ISO CYLD (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of CYLD mRNA CTD PMID:23649840 Cyld Rat fenofibrate decreases expression ISO Cyld (Mus musculus) 6480464 Fenofibrate results in decreased expression of CYLD mRNA CTD PMID:21318169 Cyld Rat fenofibrate multiple interactions ISO Cyld (Mus musculus) 6480464 PPARA protein affects the reaction [Fenofibrate results in decreased expression of CYLD mRNA] CTD PMID:21318169 Cyld Rat fenthion decreases expression ISO Cyld (Mus musculus) 6480464 Fenthion results in decreased expression of CYLD mRNA CTD PMID:34813904 Cyld Rat folic acid multiple interactions ISO Cyld (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CYLD gene CTD PMID:20938992 Cyld Rat formaldehyde increases expression ISO CYLD (Homo sapiens) 6480464 Formaldehyde results in increased expression of CYLD mRNA CTD PMID:23649840 Cyld Rat FR900359 increases phosphorylation ISO CYLD (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of CYLD protein CTD PMID:37730182 Cyld Rat furan increases methylation EXP 6480464 furan results in increased methylation of CYLD gene CTD PMID:22079235 Cyld Rat gallic acid decreases expression ISO CYLD (Homo sapiens) 6480464 Gallic Acid results in decreased expression of CYLD mRNA CTD PMID:34408198 Cyld Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CYLD mRNA CTD PMID:33387578 Cyld Rat glycochenodeoxycholic acid multiple interactions ISO CYLD (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CYLD mRNA more ... CTD PMID:32152650 Cyld Rat glycocholic acid multiple interactions ISO CYLD (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CYLD mRNA more ... CTD PMID:32152650 Cyld Rat glycodeoxycholic acid multiple interactions ISO CYLD (Homo sapiens) 6480464 [Atazanavir Sulfate co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CYLD mRNA more ... CTD PMID:32152650 Cyld Rat glyphosate increases expression ISO CYLD (Homo sapiens) 6480464 Glyphosate results in increased expression of CYLD mRNA CTD PMID:31874349 Cyld Rat hexadecanoic acid increases expression EXP 6480464 Palmitic Acid results in increased expression of CYLD mRNA and Palmitic Acid results in increased expression of CYLD protein CTD PMID:34774660 Cyld Rat hexadecanoic acid multiple interactions EXP 6480464 CYLD protein affects the reaction [Palmitic Acid results in decreased expression of CCND1 protein] more ... CTD PMID:34774660 Cyld Rat L-methionine multiple interactions ISO Cyld (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CYLD gene CTD PMID:20938992 Cyld Rat leflunomide decreases expression ISO CYLD (Homo sapiens) 6480464 leflunomide results in decreased expression of CYLD mRNA CTD PMID:28988120 Cyld Rat lipopolysaccharide increases expression ISO CYLD (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of CYLD mRNA CTD PMID:35811015 Cyld Rat lipopolysaccharide multiple interactions ISO CYLD (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CYLD mRNA CTD PMID:35811015 Cyld Rat manganese atom multiple interactions ISO CYLD (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CYLD mRNA CTD PMID:39836092 Cyld Rat manganese(0) multiple interactions ISO CYLD (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CYLD mRNA CTD PMID:39836092 Cyld Rat manganese(II) chloride multiple interactions ISO CYLD (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CYLD mRNA CTD PMID:39836092 Cyld Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of CYLD mRNA CTD PMID:16393664 Cyld Rat methidathion decreases expression ISO Cyld (Mus musculus) 6480464 methidathion results in decreased expression of CYLD mRNA CTD PMID:34813904 Cyld Rat methotrexate affects expression ISO Cyld (Mus musculus) 6480464 Methotrexate affects the expression of CYLD mRNA CTD PMID:18502557 Cyld Rat methyl methanesulfonate increases expression ISO CYLD (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of CYLD mRNA CTD PMID:23649840 Cyld Rat methylmercury chloride decreases expression ISO CYLD (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of CYLD mRNA CTD PMID:28001369 Cyld Rat methylseleninic acid increases expression ISO CYLD (Homo sapiens) 6480464 methylselenic acid results in increased expression of CYLD mRNA CTD PMID:18548127 Cyld Rat nefazodone multiple interactions ISO CYLD (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CYLD mRNA CTD PMID:32152650 Cyld Rat nefazodone increases expression ISO CYLD (Homo sapiens) 6480464 nefazodone results in increased expression of CYLD mRNA CTD PMID:32152650 Cyld Rat nickel atom increases expression ISO CYLD (Homo sapiens) 6480464 Nickel results in increased expression of CYLD mRNA CTD PMID:24768652 Cyld Rat ozone multiple interactions ISO CYLD (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of CYLD mRNA CTD PMID:31476115 Cyld Rat ozone increases expression ISO CYLD (Homo sapiens) 6480464 Ozone results in increased expression of CYLD mRNA CTD PMID:31476115 Cyld Rat paracetamol affects expression ISO Cyld (Mus musculus) 6480464 Acetaminophen affects the expression of CYLD mRNA CTD PMID:17562736 Cyld Rat paracetamol increases expression ISO CYLD (Homo sapiens) 6480464 Acetaminophen results in increased expression of CYLD mRNA CTD PMID:29067470 Cyld Rat pentanal decreases expression ISO CYLD (Homo sapiens) 6480464 pentanal results in decreased expression of CYLD mRNA CTD PMID:26079696 Cyld Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cyld (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CYLD mRNA CTD PMID:36331819 Cyld Rat pirinixic acid decreases expression ISO Cyld (Mus musculus) 6480464 pirinixic acid results in decreased expression of CYLD mRNA CTD PMID:20813756 Cyld Rat pirinixic acid multiple interactions ISO Cyld (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CYLD mRNA CTD PMID:19710929 Cyld Rat raloxifene increases expression ISO Cyld (Mus musculus) 6480464 Raloxifene Hydrochloride results in increased expression of CYLD mRNA CTD PMID:33269387 Cyld Rat raloxifene multiple interactions ISO Cyld (Mus musculus) 6480464 [SOD1 protein mutant form affects the susceptibility to Raloxifene Hydrochloride] which results in decreased expression of CYLD mRNA CTD PMID:33269387 Cyld Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CYLD (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CYLD mRNA CTD PMID:35811015 Cyld Rat SB 431542 multiple interactions ISO CYLD (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CYLD mRNA CTD PMID:27188386 Cyld Rat silicon dioxide increases expression ISO CYLD (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of CYLD mRNA CTD PMID:25351596 Cyld Rat sodium arsenite increases expression ISO CYLD (Homo sapiens) 6480464 sodium arsenite results in increased expression of CYLD mRNA and sodium arsenite results in increased expression of CYLD protein alternative form CTD PMID:23562784 and PMID:38568856 Cyld Rat sodium arsenite affects methylation ISO CYLD (Homo sapiens) 6480464 sodium arsenite affects the methylation of CYLD gene CTD PMID:28589171 Cyld Rat sodium arsenite multiple interactions ISO CYLD (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of CYLD mRNA more ... CTD PMID:23562784 and PMID:39836092 Cyld Rat sodium dichromate increases expression ISO CYLD (Homo sapiens) 6480464 sodium bichromate results in increased expression of CYLD mRNA CTD PMID:17685462 Cyld Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of CYLD mRNA CTD PMID:19281266 Cyld Rat sorafenib increases expression ISO CYLD (Homo sapiens) 6480464 [sorafenib results in increased expression of CYLD protein] which results in increased expression of NFKBIA protein more ... CTD PMID:21109933 Cyld Rat tetraphene multiple interactions ISO Cyld (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CYLD mRNA CTD PMID:27858113 Cyld Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CYLD mRNA CTD PMID:34492290 Cyld Rat thiram increases expression ISO CYLD (Homo sapiens) 6480464 Thiram results in increased expression of CYLD mRNA CTD PMID:38568856 Cyld Rat titanium dioxide decreases methylation ISO Cyld (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CYLD gene and titanium dioxide results in decreased methylation of CYLD promoter CTD PMID:35295148 Cyld Rat triclosan decreases expression ISO CYLD (Homo sapiens) 6480464 Triclosan results in decreased expression of CYLD mRNA CTD PMID:34681664 Cyld Rat triptonide affects expression ISO Cyld (Mus musculus) 6480464 triptonide affects the expression of CYLD mRNA CTD PMID:33045310 Cyld Rat tyrphostin AG 1478 increases expression ISO CYLD (Homo sapiens) 6480464 [RTKI cpd results in increased expression of CYLD protein] which results in increased expression of NFKBIA protein more ... CTD PMID:21109933 Cyld Rat urethane increases expression ISO CYLD (Homo sapiens) 6480464 Urethane results in increased expression of CYLD mRNA CTD PMID:28818685 Cyld Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of CYLD mRNA CTD PMID:21318169 Cyld Rat valproic acid multiple interactions ISO CYLD (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CYLD mRNA CTD PMID:27188386 Cyld Rat valproic acid increases expression ISO CYLD (Homo sapiens) 6480464 Valproic Acid results in increased expression of CYLD mRNA CTD PMID:19101580 more ... Cyld Rat valproic acid affects expression ISO CYLD (Homo sapiens) 6480464 Valproic Acid affects the expression of CYLD mRNA CTD PMID:25979313 Cyld Rat vincristine increases expression ISO CYLD (Homo sapiens) 6480464 Vincristine results in increased expression of CYLD mRNA CTD PMID:23649840 Cyld Rat vorinostat increases expression ISO CYLD (Homo sapiens) 6480464 vorinostat results in increased expression of CYLD mRNA CTD PMID:22083351 Cyld Rat zinc atom multiple interactions ISO CYLD (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CYLD mRNA CTD PMID:18593933 Cyld Rat zinc(0) multiple interactions ISO CYLD (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CYLD mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aripiprazole (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atazanavir sulfate (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butanal (ISO) cannabidiol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chlorpyrifos (ISO) choline (ISO) chrysene (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) cypermethrin (ISO) DDE (ISO) deoxycholic acid (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) emodin (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenofibrate (ISO) fenthion (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furan (EXP) gallic acid (ISO) gentamycin (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glyphosate (ISO) hexadecanoic acid (EXP) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (EXP) methidathion (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) nefazodone (ISO) nickel atom (ISO) ozone (ISO) paracetamol (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) raloxifene (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (ISO) Soman (EXP) sorafenib (ISO) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triclosan (ISO) triptonide (ISO) tyrphostin AG 1478 (ISO) urethane (ISO) valproic acid (EXP,ISO) vincristine (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
biological_process (ND) CD4-positive or CD8-positive, alpha-beta T cell lineage commitment (IEA,ISO) cell differentiation (IEA) homeostasis of number of cells (IEA,ISO) immune system process (IEA) innate immune response (IEA,ISO,ISS) necroptotic process (IBA,IEA,ISO) negative regulation of canonical NF-kappaB signal transduction (IEA,ISO,ISS) negative regulation of canonical Wnt signaling pathway (IEA,ISO,ISS) negative regulation of inflammatory response (IEA,ISO,ISS) negative regulation of interleukin-18-mediated signaling pathway (IEA,ISO,ISS) negative regulation of JNK cascade (IBA,IEA,ISO,ISS) negative regulation of NF-kappaB transcription factor activity (ISO,ISS) negative regulation of non-canonical NF-kappaB signal transduction (IBA,IEA,ISO,ISS) negative regulation of p38MAPK cascade (IBA,IEA,ISO,ISS) positive regulation of extrinsic apoptotic signaling pathway (IBA,IEA,ISO) positive regulation of protein localization (IEA,ISO) positive regulation of T cell differentiation (IEA,ISO) positive regulation of T cell receptor signaling pathway (IEA,ISO) protein deubiquitination (IEA,ISO,ISS) protein K63-linked deubiquitination (IBA,IEA,ISO) protein linear deubiquitination (IEA,ISO,ISS) proteolysis (IEA) regulation of B cell differentiation (IEA,ISO) regulation of cilium assembly (IEA,ISO,ISS) regulation of inflammatory response (IEA,ISO,ISS) regulation of intrinsic apoptotic signaling pathway (IBA,IEA,ISO) regulation of microtubule cytoskeleton organization (IEA,ISO) regulation of mitotic cell cycle (IBA,IEA,ISO) regulation of necroptotic process (IEA,ISO) regulation of neurotransmitter receptor localization to postsynaptic specialization membrane (IDA,IMP) regulation of tumor necrosis factor-mediated signaling pathway (IEA,ISO,ISS) regulation protein catabolic process at postsynapse (IDA,IEP,IMP) ripoptosome assembly involved in necroptotic process (IEA,ISO) translation (IEA) Wnt signaling pathway (IEA)
Cellular Component
cell projection (IEA) centriolar satellite (IEA,ISO) centrosome (IEA,ISO,ISS) ciliary basal body (IEA,ISO,ISS) ciliary tip (IEA,ISO,ISS) cytoplasm (IEA) cytoplasmic microtubule (IEA,ISO,ISS) cytoplasmic side of plasma membrane (IEA,ISO) cytoskeleton (IEA) cytosol (IBA,IEA,ISO,ISS) cytosolic small ribosomal subunit (IEA) glutamatergic synapse (IDA,IEP,IMP) membrane (IEA) microtubule (IEA) midbody (IEA,ISO,ISS) nucleolus (IEA) nucleoplasm (IEA,ISO) nucleus (IEA) perinuclear region of cytoplasm (IEA) plasma membrane (IEA) postsynaptic density (IDA) ribonucleoprotein complex (IEA) ribosome (IEA) spindle (IEA,ISO,ISS)
Molecular Function
cysteine-type deubiquitinase activity (IBA,IEA,ISO,ISS) cysteine-type peptidase activity (IEA) hydrolase activity (IEA) K48-linked deubiquitinase activity (IEA,ISO) K63-linked deubiquitinase activity (IBA,IEA,ISO,ISS) Met1-linked polyubiquitin deubiquitinase activity (ISO) metal ion binding (IEA) peptidase activity (IEA) proline-rich region binding (IEA,ISO) protein binding (ISO) protein kinase binding (IEA,ISO) structural constituent of ribosome (IEA) zinc ion binding (IEA,ISO,ISS)
1.
Identification of the familial cylindromatosis tumour-suppressor gene.
Bignell GR, etal., Nat Genet. 2000 Jun;25(2):160-5.
2.
Regulation of NF-kappaB by ubiquitination.
Chen J and Chen ZJ, Curr Opin Immunol. 2013 Feb;25(1):4-12. doi: 10.1016/j.coi.2012.12.005. Epub 2013 Jan 8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Deubiquitinases in the regulation of NF-kappaB signaling.
Harhaj EW and Dixit VM, Cell Res. 2011 Jan;21(1):22-39. doi: 10.1038/cr.2010.166. Epub 2010 Nov 30.
6.
Proteasome-independent polyubiquitin linkage regulates synapse scaffolding, efficacy, and plasticity.
Ma Q, etal., Proc Natl Acad Sci U S A. 2017 Oct 10;114(41):E8760-E8769. doi: 10.1073/pnas.1620153114. Epub 2017 Sep 25.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
CaMKII mediates recruitment and activation of the deubiquitinase CYLD at the postsynaptic density.
Thein S, etal., PLoS One. 2014 Mar 10;9(3):e91312. doi: 10.1371/journal.pone.0091312. eCollection 2014.
Cyld Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 34,487,491 - 34,547,311 (-) NCBI GRCr8 mRatBN7.2 19 18,310,632 - 18,373,696 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 18,314,019 - 18,373,658 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 19,994,711 - 20,053,224 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 25,189,306 - 25,247,825 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 28,146,665 - 28,205,606 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 19,264,984 - 19,323,817 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 19,265,164 - 19,315,357 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 30,298,220 - 30,357,107 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 19,616,209 - 19,619,221 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 18,203,184 - 18,261,162 (-) NCBI Celera Cytogenetic Map 19 p11 NCBI
CYLD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 50,742,086 - 50,801,935 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 50,742,050 - 50,801,935 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 50,775,997 - 50,835,846 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 49,333,462 - 49,393,347 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 49,333,485 - 49,390,029 NCBI Celera 16 35,291,289 - 35,351,164 (+) NCBI Celera Cytogenetic Map 16 q12.1 NCBI HuRef 16 36,663,187 - 36,723,275 (+) NCBI HuRef CHM1_1 16 52,183,487 - 52,243,322 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 56,539,727 - 56,599,616 (+) NCBI T2T-CHM13v2.0
Cyld Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 89,423,506 - 89,478,574 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 89,423,675 - 89,478,573 (+) Ensembl GRCm39 Ensembl GRCm38 8 88,696,878 - 88,751,946 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 88,697,028 - 88,751,945 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 91,220,927 - 91,275,844 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 91,587,180 - 91,638,560 (+) NCBI MGSCv36 mm8 Celera 8 92,977,380 - 93,032,328 (+) NCBI Celera Cytogenetic Map 8 C3 NCBI cM Map 8 43.51 NCBI
Cyld Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 8,788,655 - 8,845,925 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 8,788,867 - 8,845,925 (+) NCBI ChiLan1.0 ChiLan1.0
CYLD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 60,198,381 - 60,258,607 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 66,104,132 - 66,168,240 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 31,004,393 - 31,064,546 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 49,882,751 - 49,942,629 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 49,882,751 - 49,942,629 (+) Ensembl panpan1.1 panPan2
CYLD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 64,561,684 - 64,628,829 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 64,562,503 - 64,628,175 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 61,134,885 - 61,201,742 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 65,106,294 - 65,174,257 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 65,102,752 - 65,174,189 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 61,931,223 - 61,997,967 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 62,949,929 - 63,017,871 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 63,838,510 - 63,905,381 (-) NCBI UU_Cfam_GSD_1.0
Cyld Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 55,773,668 - 55,838,158 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 3,750,882 - 3,812,118 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 3,750,917 - 3,812,118 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CYLD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 34,059,081 - 34,121,264 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 34,058,091 - 34,121,939 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 30,402,013 - 30,416,351 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CYLD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 36,541,022 - 36,600,874 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 36,541,764 - 36,595,417 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 39,901,441 - 39,961,399 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cyld
.
Predicted Target Of
Count of predictions: 63 Count of miRNA genes: 54 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000018888 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 631840 Niddm38 Non-insulin dependent diabetes mellitus QTL 38 3.86 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 19 10323180 23069265 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018888 ⟹ ENSRNOP00000018888
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 18,314,019 - 18,373,644 (-) Ensembl Rnor_6.0 Ensembl 19 19,265,164 - 19,315,357 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091626 ⟹ ENSRNOP00000070060
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 18,314,019 - 18,337,204 (-) Ensembl Rnor_6.0 Ensembl 19 19,265,164 - 19,287,643 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096013 ⟹ ENSRNOP00000094491
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 18,314,019 - 18,337,204 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103615 ⟹ ENSRNOP00000089810
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 18,314,019 - 18,373,644 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106199 ⟹ ENSRNOP00000080956
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 18,314,934 - 18,373,658 (-) Ensembl
RefSeq Acc Id:
NM_001017380 ⟹ NP_001017380
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,488,582 - 34,547,118 (-) NCBI mRatBN7.2 19 18,315,110 - 18,373,650 (-) NCBI Rnor_6.0 19 19,264,984 - 19,323,817 (-) NCBI Rnor_5.0 19 30,298,220 - 30,357,107 (-) NCBI Celera 19 18,203,184 - 18,261,162 (-) RGD
Sequence:
GGCCCAGGTAGCAGGTTCGGCTGCGCGGGGGCCCGCGCGCCTGAGGCACTTTGAATTGCTGTCTTTTTACAACATGGATGCCAGGTTGCTAAAATCTTGCTTTGGGACTTACAGTGAGTTCATTTTTT
hide sequence
RefSeq Acc Id:
XM_039097803 ⟹ XP_038953731
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,510,569 (-) NCBI mRatBN7.2 19 18,310,632 - 18,337,160 (-) NCBI
RefSeq Acc Id:
XM_063278084 ⟹ XP_063134154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,546,954 (-) NCBI
RefSeq Acc Id:
XM_063278085 ⟹ XP_063134155
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,546,954 (-) NCBI
RefSeq Acc Id:
XM_063278086 ⟹ XP_063134156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,547,129 (-) NCBI
RefSeq Acc Id:
XM_063278087 ⟹ XP_063134157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,547,079 (-) NCBI
RefSeq Acc Id:
XM_063278088 ⟹ XP_063134158
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,546,934 (-) NCBI
RefSeq Acc Id:
XM_063278090 ⟹ XP_063134160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,546,921 (-) NCBI
RefSeq Acc Id:
XM_063278091 ⟹ XP_063134161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,546,969 (-) NCBI
RefSeq Acc Id:
XM_063278092 ⟹ XP_063134162
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,547,311 (-) NCBI
RefSeq Acc Id:
XM_063278093 ⟹ XP_063134163
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,547,092 (-) NCBI
RefSeq Acc Id:
XM_063278094 ⟹ XP_063134164
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,546,954 (-) NCBI
RefSeq Acc Id:
XM_063278095 ⟹ XP_063134165
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,547,311 (-) NCBI
RefSeq Acc Id:
XM_063278096 ⟹ XP_063134166
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,547,311 (-) NCBI
RefSeq Acc Id:
XM_063278097 ⟹ XP_063134167
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,547,311 (-) NCBI
RefSeq Acc Id:
XM_063278098 ⟹ XP_063134168
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,547,311 (-) NCBI
RefSeq Acc Id:
XM_063278099 ⟹ XP_063134169
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 34,487,491 - 34,546,954 (-) NCBI
RefSeq Acc Id:
NP_001017380 ⟸ NM_001017380
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
- Sequence:
MSSGLWNQEKVTSPYWEERLFYLLLQECSVTDKQTQKLLRVPKGSIGQYIQDRSVGHSRVPSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERLSLFRNRIRLSKGLQVDVG
hide sequence
Ensembl Acc Id:
ENSRNOP00000018888 ⟸ ENSRNOT00000018888
Ensembl Acc Id:
ENSRNOP00000070060 ⟸ ENSRNOT00000091626
RefSeq Acc Id:
XP_038953731 ⟸ XM_039097803
- Peptide Label:
isoform X7
Ensembl Acc Id:
ENSRNOP00000080956 ⟸ ENSRNOT00000106199
Ensembl Acc Id:
ENSRNOP00000094491 ⟸ ENSRNOT00000096013
Ensembl Acc Id:
ENSRNOP00000089810 ⟸ ENSRNOT00000103615
RefSeq Acc Id:
XP_063134167 ⟸ XM_063278097
- Peptide Label:
isoform X4
- UniProtKB:
F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134166 ⟸ XM_063278096
- Peptide Label:
isoform X3
- UniProtKB:
F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134168 ⟸ XM_063278098
- Peptide Label:
isoform X5
- UniProtKB:
F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134165 ⟸ XM_063278095
- Peptide Label:
isoform X2
- UniProtKB:
F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134162 ⟸ XM_063278092
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134156 ⟸ XM_063278086
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134163 ⟸ XM_063278093
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134157 ⟸ XM_063278087
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134161 ⟸ XM_063278091
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134164 ⟸ XM_063278094
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134155 ⟸ XM_063278085
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134169 ⟸ XM_063278099
- Peptide Label:
isoform X6
- UniProtKB:
F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134154 ⟸ XM_063278084
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134158 ⟸ XM_063278088
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063134160 ⟸ XM_063278090
- Peptide Label:
isoform X1
- UniProtKB:
Q66H62 (UniProtKB/Swiss-Prot), A6KD96 (UniProtKB/TrEMBL), F1LPJ6 (UniProtKB/TrEMBL)
RGD ID: 13700980 Promoter ID: EPDNEW_R11498 Type: initiation region Name: Cyld_1 Description: CYLD lysine 63 deubiquitinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 19,287,681 - 19,287,741 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Cyld
CYLD lysine 63 deubiquitinase
LOC100911739
40S ribosomal protein S3a-like
Data merged from RGD:6490778
737654 PROVISIONAL
2016-02-24
Cyld
CYLD lysine 63 deubiquitinase
Cyld
cylindromatosis (turban tumor syndrome)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-07-29
Cyld
cylindromatosis (turban tumor syndrome)
LOC100362727
ubiquitin carboxyl-terminal hydrolase CYLD
Data merged from RGD:2324131
737654 PROVISIONAL
2013-05-24
Cyld
cylindromatosis (turban tumor syndrome)
LOC100360670
probable ubiquitin carboxyl-terminal hydrolase CYLD-like
Data merged from RGD:2321687
1643240 APPROVED
2012-07-05
LOC100911739
40S ribosomal protein S3a-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2010-05-06
LOC100360670
probable ubiquitin carboxyl-terminal hydrolase CYLD-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2010-05-06
LOC100362727
ubiquitin carboxyl-terminal hydrolase CYLD
Symbol and Name status set to provisional
70820 PROVISIONAL
2007-04-04
Cyld
cylindromatosis (turban tumor syndrome)
Rp1h
retinitis pigmentosa 1 homolog (human)
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2006-03-30
Rp1h
retinitis pigmentosa 1 homolog (human)
Rp1
retinitis pigmentosa 1 (autosomal dominant)
Symbol and Name updated
1299863 APPROVED
2005-12-06
Rp1
retinitis pigmentosa 1 (autosomal dominant)
Rp1_predicted
retinitis pigmentosa 1 (autosomal dominant) (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Rp1_predicted
retinitis pigmentosa 1 (autosomal dominant) (predicted)
Symbol and Name status set to approved
70820 APPROVED
