Symbol:
Otud7b
Name:
OTU deubiquitinase 7B
RGD ID:
1308111
Description:
Predicted to enable K48-linked deubiquitinase activity; K63-linked polyubiquitin modification-dependent protein binding activity; and cysteine-type deubiquitinase activity. Predicted to be involved in several processes, including negative regulation of protein localization to nucleus; protein deubiquitination; and regulation of intracellular signal transduction. Predicted to act upstream of or within in utero embryonic development and protein deubiquitination. Predicted to be active in cytoplasm and nucleus. Orthologous to human OTUD7B (OTU deubiquitinase 7B); INTERACTS WITH 1,2-dimethylhydrazine; 2,2',4,4'-Tetrabromodiphenyl ether; 2,2',5,5'-tetrachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cellular zinc finger anti-NF-kappaB Cezanne; LOC310677; OTU domain containing 7B; OTU domain-containing protein 7B; RGD1308111; similar to zinc finger protein Cezanne
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 186,350,811 - 186,411,461 (+) NCBI GRCr8 mRatBN7.2 2 183,661,955 - 183,722,584 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 183,662,163 - 183,718,674 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 191,325,797 - 191,384,171 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 189,130,056 - 189,188,470 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 183,958,342 - 184,016,709 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 198,231,353 - 198,302,220 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 198,231,291 - 198,300,201 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 217,720,895 - 217,789,205 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 190,905,522 - 190,964,454 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 190,868,275 - 190,938,314 (+) NCBI Celera 2 176,190,012 - 176,247,856 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Otud7b Rat (1->4)-beta-D-glucan multiple interactions ISO Otud7b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of OTUD7B mRNA CTD PMID:36331819 Otud7b Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of OTUD7B mRNA CTD PMID:27840820 Otud7b Rat 1,2-dimethylhydrazine decreases expression ISO Otud7b (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of OTUD7B mRNA CTD PMID:22206623 Otud7b Rat 17beta-estradiol increases expression ISO OTUD7B (Homo sapiens) 6480464 Estradiol results in increased expression of OTUD7B mRNA CTD PMID:23019147 Otud7b Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO OTUD7B (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of OTUD7B mRNA CTD PMID:29581250 Otud7b Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Otud7b Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Otud7b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Otud7b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of OTUD7B mRNA CTD PMID:21570461 Otud7b Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Otud7b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of OTUD7B mRNA CTD PMID:26251327 Otud7b Rat 4,4'-sulfonyldiphenol increases expression ISO Otud7b (Mus musculus) 6480464 bisphenol S results in increased expression of OTUD7B mRNA CTD PMID:39298647 Otud7b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of OTUD7B mRNA CTD PMID:24780913 and PMID:30047161 Otud7b Rat aflatoxin B1 increases expression ISO Otud7b (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of OTUD7B mRNA CTD PMID:19770486 Otud7b Rat aflatoxin B1 increases methylation ISO OTUD7B (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of OTUD7B 3' UTR CTD PMID:30157460 Otud7b Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of OTUD7B mRNA CTD PMID:20488242 Otud7b Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of OTUD7B mRNA CTD PMID:30047161 Otud7b Rat arsenite(3-) multiple interactions ISO OTUD7B (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to OTUD7B mRNA] CTD PMID:32406909 Otud7b Rat atrazine increases expression ISO OTUD7B (Homo sapiens) 6480464 Atrazine results in increased expression of OTUD7B mRNA CTD PMID:22378314 Otud7b Rat benzo[a]pyrene increases expression ISO Otud7b (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of OTUD7B mRNA CTD PMID:21569818 and PMID:22228805 Otud7b Rat benzo[a]pyrene increases methylation ISO OTUD7B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of OTUD7B promoter CTD PMID:27901495 Otud7b Rat benzo[a]pyrene affects methylation ISO OTUD7B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of OTUD7B 5' UTR CTD PMID:27901495 Otud7b Rat benzo[e]pyrene increases methylation ISO OTUD7B (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of OTUD7B 3' UTR CTD PMID:30157460 Otud7b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of OTUD7B mRNA CTD PMID:25181051 Otud7b Rat bisphenol A multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of OTUD7B gene CTD PMID:31601247 Otud7b Rat bisphenol A increases expression ISO Otud7b (Mus musculus) 6480464 bisphenol A results in increased expression of OTUD7B mRNA CTD PMID:33221593 Otud7b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of OTUD7B mRNA CTD PMID:34947998 Otud7b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of OTUD7B mRNA CTD PMID:30816183 Otud7b Rat butanal decreases expression ISO OTUD7B (Homo sapiens) 6480464 butyraldehyde results in decreased expression of OTUD7B mRNA CTD PMID:26079696 Otud7b Rat cadmium atom multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of OTUD7B mRNA CTD PMID:35301059 Otud7b Rat cadmium dichloride increases expression ISO OTUD7B (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of OTUD7B mRNA CTD PMID:38568856 Otud7b Rat cadmium dichloride multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of OTUD7B mRNA CTD PMID:35301059 Otud7b Rat caffeine decreases phosphorylation ISO OTUD7B (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of OTUD7B protein CTD PMID:35688186 Otud7b Rat calcitriol increases expression ISO OTUD7B (Homo sapiens) 6480464 Calcitriol results in increased expression of OTUD7B mRNA CTD PMID:21592394 Otud7b Rat calcitriol multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of OTUD7B mRNA CTD PMID:21592394 Otud7b Rat chlorpyrifos increases expression ISO Otud7b (Mus musculus) 6480464 Chlorpyrifos results in increased expression of OTUD7B mRNA CTD PMID:20350560 Otud7b Rat clofibrate multiple interactions ISO Otud7b (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of OTUD7B mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of OTUD7B mRNA] CTD PMID:17585979 Otud7b Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of OTUD7B mRNA CTD PMID:26577399 and PMID:27523638 Otud7b Rat curcumin decreases expression ISO OTUD7B (Homo sapiens) 6480464 Curcumin results in decreased expression of OTUD7B mRNA CTD PMID:18421014 Otud7b Rat DDE decreases expression ISO OTUD7B (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of OTUD7B mRNA CTD PMID:38568856 Otud7b Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of OTUD7B mRNA CTD PMID:23640034 Otud7b Rat dibutyl phthalate increases expression ISO Otud7b (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of OTUD7B mRNA CTD PMID:21266533 Otud7b Rat diethylstilbestrol increases expression ISO OTUD7B (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of OTUD7B mRNA CTD PMID:36621641 Otud7b Rat dorsomorphin multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Otud7b Rat doxorubicin decreases expression ISO OTUD7B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of OTUD7B mRNA CTD PMID:29803840 Otud7b Rat doxorubicin increases expression ISO Otud7b (Mus musculus) 6480464 Doxorubicin results in increased expression of OTUD7B mRNA and Doxorubicin results in increased expression of OTUD7B protein CTD PMID:36639017 Otud7b Rat doxorubicin multiple interactions ISO Otud7b (Mus musculus) 6480464 OTUD7B protein affects the reaction [Doxorubicin results in increased expression of CASP3 protein] more ... CTD PMID:36639017 Otud7b Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of OTUD7B mRNA and Doxorubicin results in increased expression of OTUD7B protein CTD PMID:36639017 Otud7b Rat doxorubicin multiple interactions EXP 6480464 OTUD7B protein inhibits the reaction [Doxorubicin results in decreased expression of SQSTM1 protein] more ... CTD PMID:36639017 Otud7b Rat entinostat decreases expression ISO OTUD7B (Homo sapiens) 6480464 entinostat results in decreased expression of OTUD7B mRNA CTD PMID:26272509 Otud7b Rat entinostat multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OTUD7B mRNA CTD PMID:27188386 Otud7b Rat ethanol affects splicing ISO Otud7b (Mus musculus) 6480464 Ethanol affects the splicing of OTUD7B mRNA CTD PMID:30319688 Otud7b Rat ethanol increases expression ISO Otud7b (Mus musculus) 6480464 Ethanol results in increased expression of OTUD7B mRNA CTD PMID:30319688 Otud7b Rat fulvestrant multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of OTUD7B gene CTD PMID:31601247 Otud7b Rat furan increases expression ISO Otud7b (Mus musculus) 6480464 furan results in increased expression of OTUD7B mRNA CTD PMID:24183702 Otud7b Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of OTUD7B mRNA CTD PMID:33387578 Otud7b Rat glyphosate increases expression ISO Otud7b (Mus musculus) 6480464 Glyphosate results in increased expression of OTUD7B mRNA CTD PMID:35897073 Otud7b Rat inulin multiple interactions ISO Otud7b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of OTUD7B mRNA CTD PMID:36331819 Otud7b Rat methapyrilene increases methylation ISO OTUD7B (Homo sapiens) 6480464 Methapyrilene results in increased methylation of OTUD7B 3' UTR CTD PMID:30157460 Otud7b Rat methidathion increases expression ISO Otud7b (Mus musculus) 6480464 methidathion results in increased expression of OTUD7B mRNA CTD PMID:34813904 Otud7b Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of OTUD7B mRNA CTD PMID:30047161 Otud7b Rat nickel atom decreases expression ISO OTUD7B (Homo sapiens) 6480464 Nickel results in decreased expression of OTUD7B mRNA CTD PMID:25583101 Otud7b Rat nitrates multiple interactions ISO Otud7b (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of OTUD7B mRNA CTD PMID:35964746 Otud7b Rat paracetamol multiple interactions ISO Otud7b (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of OTUD7B mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of OTUD7B mRNA] CTD PMID:17585979 Otud7b Rat paracetamol affects expression ISO Otud7b (Mus musculus) 6480464 Acetaminophen affects the expression of OTUD7B mRNA CTD PMID:17562736 Otud7b Rat parathion increases expression ISO Otud7b (Mus musculus) 6480464 Parathion results in increased expression of OTUD7B mRNA CTD PMID:34813904 Otud7b Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:23829299 Otud7b Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Otud7b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of OTUD7B mRNA more ... CTD PMID:36331819 Otud7b Rat phenylmercury acetate increases expression ISO OTUD7B (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of OTUD7B mRNA CTD PMID:26272509 Otud7b Rat phenylmercury acetate multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of OTUD7B mRNA CTD PMID:27188386 Otud7b Rat pirinixic acid increases expression ISO Otud7b (Mus musculus) 6480464 pirinixic acid results in increased expression of OTUD7B mRNA CTD PMID:18301758 Otud7b Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Otud7b (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of OTUD7B mRNA CTD PMID:28903501 Otud7b Rat pyrimidifen decreases expression ISO OTUD7B (Homo sapiens) 6480464 pyrimidifen results in decreased expression of OTUD7B mRNA CTD PMID:33512557 Otud7b Rat raloxifene multiple interactions ISO Otud7b (Mus musculus) 6480464 [SOD1 protein mutant form affects the susceptibility to Raloxifene Hydrochloride] which results in increased expression of OTUD7B mRNA CTD PMID:33269387 Otud7b Rat raloxifene increases expression ISO Otud7b (Mus musculus) 6480464 Raloxifene Hydrochloride results in increased expression of OTUD7B mRNA CTD PMID:33269387 Otud7b Rat rotenone decreases expression ISO OTUD7B (Homo sapiens) 6480464 Rotenone results in decreased expression of OTUD7B mRNA CTD PMID:33512557 Otud7b Rat SB 431542 multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Otud7b Rat sirolimus multiple interactions ISO Otud7b (Mus musculus) 6480464 Sirolimus inhibits the reaction [OTUD7B protein inhibits the reaction [Doxorubicin results in decreased expression of SQSTM1 protein]] and Sirolimus inhibits the reaction [OTUD7B protein inhibits the reaction [Doxorubicin results in increased expression of ATG5 protein]] CTD PMID:36639017 Otud7b Rat sirolimus multiple interactions EXP 6480464 Sirolimus inhibits the reaction [OTUD7B protein inhibits the reaction [Doxorubicin results in decreased expression of SQSTM1 protein]] more ... CTD PMID:36639017 Otud7b Rat sodium arsenite increases expression ISO OTUD7B (Homo sapiens) 6480464 sodium arsenite results in increased expression of OTUD7B mRNA CTD PMID:38568856 Otud7b Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of OTUD7B mRNA CTD PMID:30047161 Otud7b Rat testosterone multiple interactions ISO OTUD7B (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of OTUD7B mRNA CTD PMID:21592394 Otud7b Rat testosterone increases expression ISO OTUD7B (Homo sapiens) 6480464 Testosterone results in increased expression of OTUD7B mRNA CTD PMID:21592394 Otud7b Rat tetrachloromethane affects expression ISO Otud7b (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of OTUD7B mRNA CTD PMID:17484886 Otud7b Rat thiram increases expression ISO OTUD7B (Homo sapiens) 6480464 Thiram results in increased expression of OTUD7B mRNA CTD PMID:38568856 Otud7b Rat titanium dioxide increases methylation ISO Otud7b (Mus musculus) 6480464 titanium dioxide results in increased methylation of OTUD7B promoter CTD PMID:35295148 Otud7b Rat titanium dioxide decreases methylation ISO Otud7b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of OTUD7B gene CTD PMID:35295148 Otud7b Rat trichloroethene increases expression ISO Otud7b (Mus musculus) 6480464 Trichloroethylene results in increased expression of OTUD7B mRNA CTD PMID:25549359 Otud7b Rat triphenyl phosphate affects expression ISO OTUD7B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of OTUD7B mRNA CTD PMID:37042841 Otud7b Rat troglitazone decreases expression ISO Otud7b (Mus musculus) 6480464 troglitazone results in decreased expression of OTUD7B mRNA CTD PMID:28973697 Otud7b Rat tungsten decreases expression ISO Otud7b (Mus musculus) 6480464 Tungsten results in decreased expression of OTUD7B mRNA CTD PMID:30912803 Otud7b Rat urethane increases expression ISO OTUD7B (Homo sapiens) 6480464 Urethane results in increased expression of OTUD7B mRNA CTD PMID:28818685 Otud7b Rat valproic acid increases expression ISO Otud7b (Mus musculus) 6480464 Valproic Acid results in increased expression of OTUD7B mRNA CTD PMID:21427059
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (EXP,ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP) amitrole (EXP) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) chlorpyrifos (ISO) clofibrate (ISO) Cuprizon (EXP) curcumin (ISO) DDE (ISO) decabromodiphenyl ether (EXP) dibutyl phthalate (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) entinostat (ISO) ethanol (ISO) fulvestrant (ISO) furan (ISO) gentamycin (EXP) glyphosate (ISO) inulin (ISO) methapyrilene (ISO) methidathion (ISO) methimazole (EXP) nickel atom (ISO) nitrates (ISO) paracetamol (ISO) parathion (ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) pyrimidifen (ISO) raloxifene (ISO) rotenone (ISO) SB 431542 (ISO) sirolimus (EXP,ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) testosterone (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO)
Biological Process
in utero embryonic development (IEA,ISO) mucosal immune response (IEA,ISO,ISS) negative regulation of canonical NF-kappaB signal transduction (IBA,IEA,ISO,ISS) negative regulation of interleukin-8 production (IEA,ISO,ISS) negative regulation of protein localization to nucleus (IEA,ISO,ISS) negative regulation of TORC1 signaling (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS) positive regulation of TORC2 signaling (IEA,ISO) protein deubiquitination (IEA,ISO) protein deubiquitination involved in ubiquitin-dependent protein catabolic process (IBA) protein K11-linked deubiquitination (IEA,ISO,ISS) protein K48-linked deubiquitination (IEA,ISO,ISS) protein K63-linked deubiquitination (IEA,ISO,ISS)
Otud7b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 186,350,811 - 186,411,461 (+) NCBI GRCr8 mRatBN7.2 2 183,661,955 - 183,722,584 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 183,662,163 - 183,718,674 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 191,325,797 - 191,384,171 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 189,130,056 - 189,188,470 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 183,958,342 - 184,016,709 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 198,231,353 - 198,302,220 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 198,231,291 - 198,300,201 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 217,720,895 - 217,789,205 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 190,905,522 - 190,964,454 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 190,868,275 - 190,938,314 (+) NCBI Celera 2 176,190,012 - 176,247,856 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
OTUD7B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 149,937,812 - 150,067,653 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 149,937,812 - 150,010,726 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 149,909,705 - 149,982,675 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 148,178,855 - 148,249,310 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 146,728,409 - 146,795,602 NCBI Celera 1 123,028,202 - 123,098,656 (-) NCBI Celera Cytogenetic Map 1 q21.2 NCBI HuRef 1 121,292,712 - 121,362,691 (-) NCBI HuRef CHM1_1 1 151,308,456 - 151,378,863 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 149,062,296 - 149,192,273 (-) NCBI T2T-CHM13v2.0
Otud7b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 96,011,759 - 96,068,446 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 96,011,839 - 96,068,446 (+) Ensembl GRCm39 Ensembl GRCm38 3 96,104,504 - 96,161,129 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 96,104,527 - 96,161,129 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 95,908,450 - 95,965,052 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 96,189,932 - 96,246,534 (+) NCBI MGSCv36 mm8 Celera 3 97,540,463 - 97,597,279 (+) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 41.65 NCBI
Otud7b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 751,546 - 812,605 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 758,098 - 812,605 (+) NCBI ChiLan1.0 ChiLan1.0
OTUD7B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 99,828,379 - 99,901,338 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 99,583,331 - 99,653,002 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 125,282,599 - 125,355,441 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 128,941,260 - 129,005,678 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 128,944,782 - 128,976,474 (-) Ensembl panpan1.1 panPan2
OTUD7B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 59,225,640 - 59,280,875 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 59,229,362 - 59,280,934 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 58,672,817 - 58,728,223 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 60,221,922 - 60,277,210 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 60,221,941 - 60,276,960 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 59,071,375 - 59,126,610 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 59,155,099 - 59,210,354 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 59,882,202 - 59,937,666 (-) NCBI UU_Cfam_GSD_1.0
Otud7b
OTUD7B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 99,054,426 - 99,114,162 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 99,054,426 - 99,111,649 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 108,609,708 - 108,632,906 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OTUD7B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666038 13,235,718 - 13,366,144 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Otud7b
.
Predicted Target Of
Count of predictions: 396 Count of miRNA genes: 205 Interacting mature miRNAs: 276 Transcripts: ENSRNOT00000046739 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
D2Rat134
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 183,719,124 - 183,719,262 (+) MAPPER mRatBN7.2 Rnor_6.0 2 198,298,764 - 198,298,901 NCBI Rnor6.0 Rnor_5.0 2 217,785,747 - 217,785,884 UniSTS Rnor5.0 RGSC_v3.4 2 190,963,017 - 190,963,154 UniSTS RGSC3.4 Celera 2 176,246,419 - 176,246,556 UniSTS RH 3.4 Map 2 1223.0 UniSTS RH 3.4 Map 2 1223.0 RGD RH 2.0 Map 2 898.3 RGD FHH x ACI Map 2 78.8099 RGD Cytogenetic Map 2 q34 UniSTS
AI462125
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 183,718,362 - 183,718,466 (+) MAPPER mRatBN7.2 Rnor_6.0 2 198,298,002 - 198,298,105 NCBI Rnor6.0 Rnor_5.0 2 217,784,985 - 217,785,088 UniSTS Rnor5.0 RGSC_v3.4 2 190,962,255 - 190,962,358 UniSTS RGSC3.4 Celera 2 176,245,657 - 176,245,760 UniSTS Cytogenetic Map 2 q34 UniSTS
RH142787
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 183,718,278 - 183,718,415 (+) MAPPER mRatBN7.2 Rnor_6.0 2 198,297,918 - 198,298,054 NCBI Rnor6.0 Rnor_5.0 2 217,784,901 - 217,785,037 UniSTS Rnor5.0 RGSC_v3.4 2 190,962,171 - 190,962,307 UniSTS RGSC3.4 Celera 2 176,245,573 - 176,245,709 UniSTS RH 3.4 Map 2 1222.7 UniSTS Cytogenetic Map 2 q34 UniSTS
RH141601
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 183,720,158 - 183,720,375 (+) MAPPER mRatBN7.2 Rnor_6.0 2 198,299,797 - 198,300,013 NCBI Rnor6.0 Rnor_5.0 2 217,786,780 - 217,786,996 UniSTS Rnor5.0 RGSC_v3.4 2 190,964,050 - 190,964,266 UniSTS RGSC3.4 Celera 2 176,247,452 - 176,247,668 UniSTS RH 3.4 Map 2 1221.5 UniSTS Cytogenetic Map 2 q34 UniSTS
BE117295
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 183,687,097 - 183,687,296 (+) MAPPER mRatBN7.2 Rnor_6.0 2 198,267,069 - 198,267,267 NCBI Rnor6.0 Rnor_5.0 2 217,754,356 - 217,754,554 UniSTS Rnor5.0 RGSC_v3.4 2 190,930,693 - 190,930,891 UniSTS RGSC3.4 Celera 2 176,214,936 - 176,215,134 UniSTS RH 3.4 Map 2 1222.7 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000046739 ⟹ ENSRNOP00000039488
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 198,231,353 - 198,300,201 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078288 ⟹ ENSRNOP00000073488
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 183,662,163 - 183,718,674 (+) Ensembl Rnor_6.0 Ensembl 2 198,231,291 - 198,297,323 (+) Ensembl
RefSeq Acc Id:
NM_001107697 ⟹ NP_001101167
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,350,844 - 186,409,440 (+) NCBI mRatBN7.2 2 183,661,955 - 183,720,563 (+) NCBI Rnor_6.0 2 198,231,353 - 198,300,201 (+) NCBI Rnor_5.0 2 217,720,895 - 217,789,205 (+) NCBI RGSC_v3.4 2 190,905,522 - 190,964,454 (+) RGD Celera 2 176,190,012 - 176,247,856 (+) RGD
Sequence:
CGGACGGCCAAAAGCCACCGATCCTGAACCAGCCGCTGGAGTCGGAGTGGCGACCCGGTGTGGAGCCGGCGGAAAGCCATTGGGAAGAGGCCAGCTCCGGTCAGTCCCGGCTTGGCTCCAGCTCCATC
hide sequence
RefSeq Acc Id:
XM_006232957 ⟹ XP_006233019
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,350,963 - 186,411,461 (+) NCBI mRatBN7.2 2 183,662,106 - 183,722,584 (+) NCBI Rnor_6.0 2 198,231,552 - 198,302,220 (+) NCBI Rnor_5.0 2 217,720,895 - 217,789,205 (+) NCBI
Sequence:
CGGACCCCGGGGTCACTGCCGAGGAATGAGGCGAGGCGGCCGGGCCCCGCGCCCCGCCCCGGCCTAAAGCCTTGCCCTGAGAGTCGCGAGGTGCACCAGCCTGTGGGAAAATCGCAAGACTATGGCGG
hide sequence
RefSeq Acc Id:
XM_063281880 ⟹ XP_063137950
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,350,963 - 186,411,461 (+) NCBI
RefSeq Acc Id:
XM_063281881 ⟹ XP_063137951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,376,453 - 186,411,461 (+) NCBI
RefSeq Acc Id:
XM_063281882 ⟹ XP_063137952
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,354,942 - 186,411,461 (+) NCBI
RefSeq Acc Id:
XM_063281883 ⟹ XP_063137953
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,350,811 - 186,411,461 (+) NCBI
RefSeq Acc Id:
XM_063281884 ⟹ XP_063137954
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,389,133 - 186,411,461 (+) NCBI
RefSeq Acc Id:
XM_063281885 ⟹ XP_063137955
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,350,816 - 186,411,461 (+) NCBI
RefSeq Acc Id:
XM_063281886 ⟹ XP_063137956
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 186,389,127 - 186,411,461 (+) NCBI
RefSeq Acc Id:
NP_001101167 ⟸ NM_001107697
- UniProtKB:
A6K349 (UniProtKB/TrEMBL), A0A0G2K5N0 (UniProtKB/TrEMBL)
- Sequence:
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVSAALSDFEQLRQVHAGNLSPPFSGGSTCPKTPEKGGSDREPTRPSRPILQRQDDIIQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSSEHPL
hide sequence
RefSeq Acc Id:
XP_006233019 ⟸ XM_006232957
- Peptide Label:
isoform X1
- UniProtKB:
A6K349 (UniProtKB/TrEMBL), A0A0G2K5N0 (UniProtKB/TrEMBL)
- Sequence:
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVSAALSDFEQLRQVHAGNLSPPFSGGSTCPKTPEKGGSDREPTRPSRPILQRQDDIIQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSSEHPL
hide sequence
Ensembl Acc Id:
ENSRNOP00000073488 ⟸ ENSRNOT00000078288
Ensembl Acc Id:
ENSRNOP00000039488 ⟸ ENSRNOT00000046739
RefSeq Acc Id:
XP_063137953 ⟸ XM_063281883
- Peptide Label:
isoform X1
- UniProtKB:
A6K349 (UniProtKB/TrEMBL), A0A0G2K5N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137955 ⟸ XM_063281885
- Peptide Label:
isoform X1
- UniProtKB:
A6K349 (UniProtKB/TrEMBL), A0A0G2K5N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137950 ⟸ XM_063281880
- Peptide Label:
isoform X1
- UniProtKB:
A6K349 (UniProtKB/TrEMBL), A0A0G2K5N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137952 ⟸ XM_063281882
- Peptide Label:
isoform X1
- UniProtKB:
A6K349 (UniProtKB/TrEMBL), A0A0G2K5N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137951 ⟸ XM_063281881
- Peptide Label:
isoform X1
- UniProtKB:
A6K349 (UniProtKB/TrEMBL), A0A0G2K5N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137956 ⟸ XM_063281886
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063137954 ⟸ XM_063281884
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K5N0 (UniProtKB/TrEMBL)
RGD ID: 13691565 Promoter ID: EPDNEW_R2089 Type: initiation region Name: Otud7b_1 Description: OTU deubiquitinase 7B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 198,231,372 - 198,231,432 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-03-13
Otud7b
OTU deubiquitinase 7B
Otud7b
OTU domain containing 7B
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-26
Otud7b
OTU domain containing 7B
RGD1308111_predicted
similar to zinc finger protein Cezanne; cellular zinc finger anti-NF-kappaB Cezanne (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1308111_predicted
similar to zinc finger protein Cezanne; cellular zinc finger anti-NF-kappaB Cezanne (predicted)
LOC310677_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC310677_predicted
similar to zinc finger protein Cezanne; cellular zinc finger anti-NF-kappaB Cezanne (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
