Symbol:
Usp12
Name:
ubiquitin specific peptidase 12
RGD ID:
1308045
Description:
Predicted to enable cysteine-type deubiquitinase activity and cysteine-type endopeptidase activity. Predicted to be involved in regulation of protein stability. Predicted to act upstream of or within protein deubiquitination. Predicted to be located in cytoplasm and plasma membrane. Predicted to be active in cytosol and nucleus. Orthologous to human USP12 (ubiquitin specific peptidase 12); PARTICIPATES IN histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
deubiquitinating enzyme 12; LOC360763; ubiquitin carboxyl-terminal hydrolase 12; ubiquitin specific protease 12; ubiquitin thioesterase 12; ubiquitin thiolesterase 12; ubiquitin-specific-processing protease 12
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 13,423,625 - 13,477,547 (+) NCBI GRCr8 GRCr8 GRCr8 GRCr8 Ensembl 12 13,422,427 - 13,477,547 (+) Ensembl GRCr8 mRatBN7.2 12 8,309,845 - 8,363,686 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 8,309,750 - 8,363,656 (+) Ensembl mRatBN7.2 UTH_Rnor_SHR_Utx 12 9,111,238 - 9,161,842 (+) NCBI UTH_Rnor_SHR_Utx UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 9,734,421 - 9,785,026 (+) NCBI UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 8,757,863 - 8,808,472 (+) NCBI UTH_Rnor_WKY_Bbb_1.0 UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 10,037,686 - 10,087,685 (+) NCBI Rnor_6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 10,063,117 - 10,087,685 (+) Ensembl rn6 Rnor6.0 Rnor_5.0 12 12,145,472 - 12,195,185 (+) NCBI Rnor_5.0 Rnor_5.0 rn5 RGSC_v3.4 12 8,757,532 - 8,808,106 (+) NCBI RGSC_v3.4 RGSC_v3.4 rn4 Celera 12 10,126,987 - 10,177,393 (+) NCBI Celera RGSC_v3.1 12 8,787,433 - 8,839,672 (+) NCBI Cytogenetic Map 12 p11 NCBI
JBrowse:
Gene Location: 12:13423625..13477547
13.425M 13.430M 13.435M 13.440M 13.445M 13.450M 13.455M 13.460M 13.465M 13.470M 13.475M
Only show annotations with direct experimental evidence (0 objects hidden)
Usp12 Rat (1->4)-beta-D-glucan multiple interactions ISO Usp12 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP12 mRNA CTD PMID:36331819 Usp12 Rat 1,2-dimethylhydrazine multiple interactions ISO Usp12 (Mus musculus) 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of USP12 mRNA CTD PMID:22206623 Usp12 Rat 17beta-estradiol affects expression ISO USP12 (Homo sapiens) 6480464 Estradiol affects the expression of USP12 mRNA CTD PMID:22574217 Usp12 Rat 17beta-estradiol increases expression ISO USP12 (Homo sapiens) 6480464 Estradiol results in increased expression of USP12 mRNA CTD PMID:31614463 Usp12 Rat 17beta-estradiol multiple interactions ISO USP12 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of USP12 mRNA CTD PMID:20823114 Usp12 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Usp12 (Mus musculus) 6480464 AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in increased expression of USP12 mRNA] CTD PMID:19759094 Usp12 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP12 mRNA CTD PMID:33387578 Usp12 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Usp12 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of USP12 mRNA CTD PMID:19759094 Usp12 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran affects the expression of USP12 mRNA CTD PMID:32109520 Usp12 Rat 2-hydroxypropanoic acid affects expression ISO USP12 (Homo sapiens) 6480464 Lactic Acid affects the expression of USP12 mRNA CTD PMID:30851411 Usp12 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Usp12 (Mus musculus) 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of USP12 mRNA CTD PMID:20188158 Usp12 Rat 4,4'-diaminodiphenylmethane increases expression ISO Usp12 (Mus musculus) 6480464 4,4'-diaminodiphenylmethane results in increased expression of USP12 mRNA CTD PMID:18648102 Usp12 Rat 4,4'-sulfonyldiphenol decreases expression ISO Usp12 (Mus musculus) 6480464 bisphenol S results in decreased expression of USP12 mRNA CTD PMID:39298647 Usp12 Rat aflatoxin B1 decreases methylation ISO USP12 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of USP12 gene CTD PMID:27153756 Usp12 Rat aflatoxin M1 decreases expression ISO USP12 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of USP12 mRNA CTD PMID:30928695 Usp12 Rat all-trans-retinoic acid decreases expression ISO USP12 (Homo sapiens) 6480464 Tretinoin results in decreased expression of USP12 mRNA CTD PMID:33167477 Usp12 Rat aristolochic acid A decreases expression ISO USP12 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP12 mRNA CTD PMID:33212167 Usp12 Rat arsenite(3-) multiple interactions ISO USP12 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to USP12 mRNA] CTD PMID:32406909 Usp12 Rat avobenzone increases expression ISO USP12 (Homo sapiens) 6480464 avobenzone results in increased expression of USP12 mRNA CTD PMID:31016361 Usp12 Rat benzo[a]pyrene increases methylation ISO Usp12 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of USP12 exon; Benzo(a)pyrene results in increased methylation of USP12 more ... CTD PMID:27901495 Usp12 Rat bis(2-ethylhexyl) phthalate increases expression ISO USP12 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of USP12 mRNA CTD PMID:32143396 Usp12 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP12 mRNA CTD PMID:25181051 Usp12 Rat bisphenol A decreases methylation ISO USP12 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of USP12 gene CTD PMID:31601247 Usp12 Rat bisphenol A increases methylation ISO Usp12 (Mus musculus) 6480464 bisphenol A results in increased methylation of USP12 promoter CTD PMID:27312807 Usp12 Rat bisphenol F increases expression ISO Usp12 (Mus musculus) 6480464 bisphenol F results in increased expression of USP12 mRNA CTD PMID:38685157 Usp12 Rat bucladesine multiple interactions ISO USP12 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of USP12 mRNA CTD PMID:20823114 Usp12 Rat Butylbenzyl phthalate affects methylation ISO Usp12 (Mus musculus) 6480464 butylbenzyl phthalate affects the methylation of USP12 intron CTD PMID:28392331 Usp12 Rat cisplatin multiple interactions ISO USP12 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of USP12 mRNA CTD PMID:27392435 Usp12 Rat cisplatin decreases expression ISO USP12 (Homo sapiens) 6480464 Cisplatin results in decreased expression of USP12 mRNA CTD PMID:27392435 Usp12 Rat clofibrate multiple interactions ISO Usp12 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of USP12 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Usp12 Rat clofibrate increases expression ISO Usp12 (Mus musculus) 6480464 Clofibrate results in increased expression of USP12 mRNA CTD PMID:17585979 Usp12 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of USP12 mRNA CTD PMID:26577399 Usp12 Rat Dibutyl phosphate affects expression ISO USP12 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP12 mRNA CTD PMID:37042841 Usp12 Rat dicrotophos decreases expression ISO USP12 (Homo sapiens) 6480464 dicrotophos results in decreased expression of USP12 mRNA CTD PMID:28302478 Usp12 Rat dioxygen multiple interactions ISO Usp12 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of USP12 mRNA CTD PMID:30529165 Usp12 Rat doxorubicin decreases expression ISO USP12 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of USP12 mRNA CTD PMID:29803840 Usp12 Rat ethanol affects splicing ISO Usp12 (Mus musculus) 6480464 Ethanol affects the splicing of USP12 mRNA CTD PMID:30319688 Usp12 Rat folic acid multiple interactions ISO Usp12 (Mus musculus) 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of USP12 mRNA CTD PMID:22206623 Usp12 Rat formaldehyde increases expression ISO USP12 (Homo sapiens) 6480464 Formaldehyde results in increased expression of USP12 mRNA CTD PMID:23649840 Usp12 Rat geldanamycin increases expression ISO USP12 (Homo sapiens) 6480464 geldanamycin results in increased expression of USP12 mRNA CTD PMID:26705709 Usp12 Rat hypochlorous acid increases expression ISO Usp12 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of USP12 mRNA CTD PMID:19376150 Usp12 Rat lead(0) increases expression ISO USP12 (Homo sapiens) 6480464 Lead results in increased expression of USP12 mRNA CTD PMID:19921347 Usp12 Rat lead(0) affects splicing ISO USP12 (Homo sapiens) 6480464 Lead affects the splicing of USP12 mRNA CTD PMID:28903495 Usp12 Rat leflunomide increases expression ISO USP12 (Homo sapiens) 6480464 leflunomide results in increased expression of USP12 mRNA CTD PMID:28988120 Usp12 Rat lipopolysaccharide multiple interactions ISO USP12 (Homo sapiens) 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of USP12 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Usp12 Rat lipopolysaccharide increases expression ISO USP12 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of USP12 mRNA CTD PMID:35811015 Usp12 Rat medroxyprogesterone acetate multiple interactions ISO USP12 (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of USP12 mRNA CTD PMID:20823114 Usp12 Rat okadaic acid increases expression ISO USP12 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of USP12 mRNA CTD PMID:38832940 Usp12 Rat oxycodone decreases expression EXP 6480464 Oxycodone results in decreased expression of USP12 mRNA CTD PMID:23439660 Usp12 Rat paracetamol multiple interactions ISO Usp12 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of USP12 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Usp12 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of USP12 mRNA CTD PMID:33387578 Usp12 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp12 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP12 mRNA CTD PMID:36331819 Usp12 Rat phenobarbital affects expression ISO USP12 (Homo sapiens) 6480464 Phenobarbital affects the expression of USP12 mRNA CTD PMID:19159669 Usp12 Rat pirinixic acid multiple interactions ISO Usp12 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in decreased expression of USP12 mRNA] CTD PMID:21318169 Usp12 Rat pirinixic acid decreases expression ISO Usp12 (Mus musculus) 6480464 pirinixic acid results in decreased expression of USP12 mRNA CTD PMID:17426115|PMID:21318169 Usp12 Rat potassium chromate decreases expression ISO USP12 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of USP12 mRNA CTD PMID:22714537 Usp12 Rat rac-lactic acid affects expression ISO USP12 (Homo sapiens) 6480464 Lactic Acid affects the expression of USP12 mRNA CTD PMID:30851411 Usp12 Rat rotenone decreases expression ISO Usp12 (Mus musculus) 6480464 Rotenone results in decreased expression of USP12 mRNA CTD PMID:23186747 Usp12 Rat rotenone increases expression ISO USP12 (Homo sapiens) 6480464 Rotenone results in increased expression of USP12 protein CTD PMID:39603559 Usp12 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO USP12 (Homo sapiens) 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of USP12 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Usp12 Rat silicon dioxide decreases expression ISO Usp12 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of USP12 mRNA CTD PMID:19073995 Usp12 Rat sodium arsenite affects methylation ISO USP12 (Homo sapiens) 6480464 sodium arsenite affects the methylation of USP12 gene CTD PMID:28589171 Usp12 Rat sodium arsenite increases expression ISO USP12 (Homo sapiens) 6480464 sodium arsenite results in increased expression of USP12 mRNA CTD PMID:38568856 Usp12 Rat sulforaphane multiple interactions ISO Usp12 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of USP12 mRNA CTD PMID:30529165 Usp12 Rat sunitinib increases expression ISO USP12 (Homo sapiens) 6480464 Sunitinib results in increased expression of USP12 mRNA CTD PMID:31533062 Usp12 Rat testosterone decreases expression ISO Usp12 (Mus musculus) 6480464 Testosterone results in decreased expression of USP12 mRNA CTD PMID:21669218 Usp12 Rat thiram increases expression ISO USP12 (Homo sapiens) 6480464 Thiram results in increased expression of USP12 mRNA CTD PMID:38568856 Usp12 Rat titanium dioxide increases expression ISO Usp12 (Mus musculus) 6480464 titanium dioxide results in increased expression of USP12 mRNA CTD PMID:27760801 Usp12 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of USP12 mRNA CTD PMID:33387578 Usp12 Rat triphenyl phosphate affects expression ISO USP12 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP12 mRNA CTD PMID:37042841 Usp12 Rat urethane increases expression ISO USP12 (Homo sapiens) 6480464 Urethane results in increased expression of USP12 mRNA CTD PMID:28818685 Usp12 Rat valproic acid increases methylation ISO USP12 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of USP12 gene CTD PMID:29154799 Usp12 Rat valproic acid affects expression ISO USP12 (Homo sapiens) 6480464 Valproic Acid affects the expression of USP12 mRNA CTD PMID:25979313 Usp12 Rat valproic acid decreases expression ISO USP12 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of USP12 mRNA CTD PMID:23179753|PMID:24935251 Usp12 Rat vincristine increases expression ISO USP12 (Homo sapiens) 6480464 Vincristine results in increased expression of USP12 mRNA CTD PMID:23649840 Usp12 Rat vorinostat decreases expression ISO USP12 (Homo sapiens) 6480464 vorinostat results in decreased expression of USP12 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-hydroxypropanoic acid (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) avobenzone (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bucladesine (ISO) Butylbenzyl phthalate (ISO) cisplatin (ISO) clofibrate (ISO) Cuprizon (EXP) Dibutyl phosphate (ISO) dicrotophos (ISO) dioxygen (ISO) doxorubicin (ISO) ethanol (ISO) folic acid (ISO) formaldehyde (ISO) geldanamycin (ISO) hypochlorous acid (ISO) lead(0) (ISO) leflunomide (ISO) lipopolysaccharide (ISO) medroxyprogesterone acetate (ISO) okadaic acid (ISO) oxycodone (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) rac-lactic acid (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulforaphane (ISO) sunitinib (ISO) testosterone (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vincristine (ISO) vorinostat (ISO)
Usp12 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 13,423,625 - 13,477,547 (+) NCBI GRCr8 GRCr8 GRCr8 GRCr8 Ensembl 12 13,422,427 - 13,477,547 (+) Ensembl GRCr8 mRatBN7.2 12 8,309,845 - 8,363,686 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 8,309,750 - 8,363,656 (+) Ensembl mRatBN7.2 UTH_Rnor_SHR_Utx 12 9,111,238 - 9,161,842 (+) NCBI UTH_Rnor_SHR_Utx UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 9,734,421 - 9,785,026 (+) NCBI UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 8,757,863 - 8,808,472 (+) NCBI UTH_Rnor_WKY_Bbb_1.0 UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 10,037,686 - 10,087,685 (+) NCBI Rnor_6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 10,063,117 - 10,087,685 (+) Ensembl rn6 Rnor6.0 Rnor_5.0 12 12,145,472 - 12,195,185 (+) NCBI Rnor_5.0 Rnor_5.0 rn5 RGSC_v3.4 12 8,757,532 - 8,808,106 (+) NCBI RGSC_v3.4 RGSC_v3.4 rn4 Celera 12 10,126,987 - 10,177,393 (+) NCBI Celera RGSC_v3.1 12 8,787,433 - 8,839,672 (+) NCBI Cytogenetic Map 12 p11 NCBI
USP12 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 27,066,156 - 27,171,811 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 27,066,156 - 27,171,811 (-) Ensembl hg38 GRCh38 GRCh37 13 27,640,293 - 27,745,948 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 26,540,433 - 26,644,028 (-) NCBI Build 36 Build 36 hg18 NCBI36 Build 34 13 26,540,437 - 26,644,029 NCBI Celera 13 8,709,187 - 8,814,916 (-) NCBI Celera Cytogenetic Map 13 q12.13 NCBI HuRef 13 8,462,522 - 8,512,964 (-) NCBI HuRef CHM1_1 13 27,608,845 - 27,714,492 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 26,286,900 - 26,392,536 (-) NCBI T2T-CHM13v2.0
Usp12 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 146,671,619 - 146,731,817 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 146,671,619 - 146,731,816 (-) Ensembl GRCm39 Ensembl GRCm39 GRCm38 5 146,734,809 - 146,794,956 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 146,734,809 - 146,795,006 (-) Ensembl mm10 GRCm38 MGSCv37 5 147,546,388 - 147,606,532 (-) NCBI MGSCv37 MGSCv37 mm9 NCBIm37 MGSCv36 5 147,045,161 - 147,105,305 (-) NCBI MGSCv36 mm8 Celera 5 144,724,140 - 144,752,267 (-) NCBI Celera Cytogenetic Map 5 G3 NCBI cM Map 5 86.0 NCBI
Usp12 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955497 6,524,487 - 6,556,675 (-) Ensembl ChiLan1.0 NW_004955497 6,524,487 - 6,613,403 (-) NCBI ChiLan1.0 ChiLan1.0
USP12 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 26,643,372 - 26,769,527 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 17,753,004 - 17,878,242 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 8,334,651 - 8,463,102 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 26,704,822 - 26,755,416 (-) NCBI PanPan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 26,707,951 - 26,758,019 (-) Ensembl panPan2 panpan1.1
USP12 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 12,389,360 - 12,477,406 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 12,338,673 - 12,474,362 (+) Ensembl canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 12,452,353 - 12,540,441 (+) NCBI Dog10K_Boxer_Tasha Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 12,520,683 - 12,608,824 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 12,565,428 - 12,608,828 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 12,411,883 - 12,499,972 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 12,406,487 - 12,494,667 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 12,451,474 - 12,539,361 (+) NCBI UU_Cfam_GSD_1.0 UU_Cfam_GSD_1.0
Usp12 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 173,484,469 - 173,561,737 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936472 22,392,583 - 22,467,947 (-) Ensembl SpeTri2.0 Ensembl SpeTri2.0 NW_004936472 22,390,418 - 22,467,690 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP12 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 4,612,277 - 4,689,432 (-) Ensembl susScr11 Sscrofa11.1 Sscrofa11.1 11 4,612,274 - 4,689,791 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 4,029,964 - 4,070,715 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP12
Usp12
.
Predicted Target Of
Count of predictions: 38 Count of miRNA genes: 33 Interacting mature miRNAs: 37 Transcripts: ENSRNOT00000044038 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 5921918 25247790 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 11200494 52308831 Rat 2306789 Ean6 Experimental allergic neuritis QTL 6 4.9 nervous system integrity trait (VT:0010566) experimental autoimmune neuritis severity score (CMO:0001528) 12 1 29775522 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 11200494 52308831 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 11200494 52308831 Rat 1357337 Gluco3 Glucose level QTL 3 0.0004 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 12 1 16966671 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 3489416 48489416 Rat 1331739 Hrtrt14 Heart rate QTL 14 3.56232 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 12 1 38687564 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 11200497 52308831 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 1 33700600 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 11743528 52308831 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 11200494 52308831 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 11869600 16966542 Rat 61334 Gluco17 Glucose level QTL 17 6.3 adipocyte glucose uptake trait (VT:0004185) adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874) 12 1 16966671 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 1 38635130 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 28133365 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 12233000 30490641 Rat 1300174 Bw15 Body weight QTL 15 2.93 body mass (VT:0001259) body weight loss (CMO:0001399) 12 1 28606299 Rat 1331787 Rf41 Renal function QTL 41 2.998 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 12 1 33700556 Rat 724526 Uae3 Urinary albumin excretion QTL 3 4.9 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 12 1 15486827 Rat 1331763 Wbc2 White blood cell count QTL 2 3.162 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 12 11200494 52308831 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 1 24849755 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 11200494 52308831 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 41361854 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 2747694 47747694 Rat 2303568 Bw88 Body weight QTL 88 3 body mass (VT:0001259) body weight (CMO:0000012) 12 1 28606299 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 3087180 48087180 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 11200494 52308831 Rat 7243862 Mcs30 Mammary carcinoma susceptibility QTL 30 8.62 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 12 5633306 50633306 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 7901625 33938215 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 11200494 52308831 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
16
12
67
164
91
90
59
92
59
6
356
192
11
143
81
92
31
17
17
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000044038 ⟹ ENSRNOP00000050887
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 12 13,423,651 - 13,474,845 (+) Ensembl mRatBN7.2 Ensembl 12 8,335,423 - 8,363,656 (+) Ensembl Rnor_6.0 Ensembl 12 10,063,117 - 10,087,685 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097611 ⟹ ENSRNOP00000085102
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 12 13,449,616 - 13,477,547 (+) Ensembl mRatBN7.2 Ensembl 12 8,335,755 - 8,363,656 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114389 ⟹ ENSRNOP00000080030
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 8,309,750 - 8,363,656 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116604 ⟹ ENSRNOP00000097485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 12 13,422,427 - 13,474,840 (+) Ensembl mRatBN7.2 Ensembl 12 8,336,134 - 8,363,656 (+) Ensembl
RefSeq Acc Id:
NM_001166576 ⟹ NP_001160048
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 13,423,858 - 13,477,547 (+) NCBI mRatBN7.2 12 8,309,992 - 8,363,686 (+) NCBI Rnor_6.0 12 10,037,686 - 10,087,685 (+) NCBI Rnor_5.0 12 12,145,472 - 12,195,185 (+) NCBI RGSC_v3.4 12 8,757,532 - 8,808,106 (+) RGD Celera 12 10,126,987 - 10,177,393 (+) RGD
Sequence:
ATGGAAATCCTAATGACAGTCTCCAAATTCGCCTCCATCTGTACCATGGGCGCCAATGCCTCGGCATTAGAGAAAGAGATTGGTCCAGAACAGTTTCCGGTCAACGAGCACTATTTTGGATTAGTCAA
hide sequence
RefSeq Acc Id:
XM_039089548 ⟹ XP_038945476
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 13,423,625 - 13,477,547 (+) NCBI mRatBN7.2 12 8,309,845 - 8,363,686 (+) NCBI
RefSeq Acc Id:
XM_063271443 ⟹ XP_063127513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 13,423,626 - 13,477,547 (+) NCBI
RefSeq Acc Id:
XM_063271444 ⟹ XP_063127514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 13,426,506 - 13,477,547 (+) NCBI
RefSeq Acc Id:
NP_001160048 ⟸ NM_001166576
- UniProtKB:
D0RB01 (UniProtKB/TrEMBL), F1LWD4 (UniProtKB/TrEMBL), A6K1C6 (UniProtKB/TrEMBL)
- Sequence:
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFRDKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEF
hide sequence
Ensembl Acc Id:
ENSRNOP00000050887 ⟸ ENSRNOT00000044038
RefSeq Acc Id:
XP_038945476 ⟸ XM_039089548
- Peptide Label:
isoform X2
- UniProtKB:
A6K1C6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085102 ⟸ ENSRNOT00000097611
Ensembl Acc Id:
ENSRNOP00000080030 ⟸ ENSRNOT00000114389
Ensembl Acc Id:
ENSRNOP00000097485 ⟸ ENSRNOT00000116604
RefSeq Acc Id:
XP_063127513 ⟸ XM_063271443
- Peptide Label:
isoform X1
- UniProtKB:
A6K1C6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127514 ⟸ XM_063271444
- Peptide Label:
isoform X3
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-05-24
Usp12
ubiquitin specific peptidase 12
LOC684318
similar to ubiquitin specific protease 12
Data merged from RGD:1591494
1643240 APPROVED
2008-03-04
Usp12
ubiquitin specific peptidase 12
Usp12_predicted
ubiquitin specific protease 12 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC684318
similar to ubiquitin specific protease 12
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Usp12_predicted
ubiquitin specific protease 12 (predicted)
Symbol and Name status set to approved
70820 APPROVED
