Advanced Search (OLGA)

Gene: Ctsg (cathepsin G) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ctsg

Name:

cathepsin G

RGD ID:

1307681

Description:

Predicted to enable several functions, including caspase binding activity; heparin binding activity; and serine-type endopeptidase activity. Predicted to be involved in several processes, including biofilm matrix disassembly; defense response to bacterium; and regulation of cell-cell adhesion. Predicted to act upstream of or within defense response to fungus; positive regulation of immune response; and response to bacterium. Predicted to be located in several cellular components, including cytoplasmic stress granule; lysosome; and secretory granule. Predicted to be active in extracellular space. Orthologous to human CTSG (cathepsin G); PARTICIPATES IN Entamoebiasis pathway; renin-angiotensin cascade pathway; systemic lupus erythematosus pathway; INTERACTS WITH anilines; bisphenol A; corn oil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC290257

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CTSG (cathepsin G)	HGNC	EggNOG, Ensembl, HomoloGene, OrthoDB, Treefam
Mus musculus (house mouse):	Ctsg (cathepsin G)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CTSG (cathepsin G)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CTSG (cathepsin G)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC100154047 (cathepsin G)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CTSG (cathepsin G)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	UBA6 (ubiquitin like modifier activating enzyme 6)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CTSG (cathepsin G)	Alliance	DIOPT (HGNC\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,901,230 - 33,907,596 (-)	NCBI		GRCr8
mRatBN7.2	15	29,930,988 - 29,937,353 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,931,003 - 29,937,353 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	31,780,745 - 31,783,332 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,927,946 - 32,930,533 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	31,186,079 - 31,188,666 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	35,107,333 - 35,113,678 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	35,111,091 - 35,113,678 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,994,558 - 39,000,903 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	34,622,211 - 34,624,798 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	34,637,918 - 34,648,441 (-)	NCBI
Celera	15	29,509,460 - 29,512,047 (-)	NCBI		Celera
Cytogenetic Map	15	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ctsg	Rat	Reperfusion Injury		ISO	Ctsg (Mus musculus)	7242055		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ctsg	Rat	Brain-Lung-Thyroid Syndrome		ISO	CTSG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brain-lung-thyroid syndrome	ClinVar	PMID:25741868
Ctsg	Rat	lysinuric protein intolerance		ISO	CTSG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Lysinuric protein intolerance	ClinVar	PMID:28492532
Ctsg	Rat	Specific Granule Deficiency		ISO	CTSG (Homo sapiens)	8554872	ClinVar Annotator: match by term: Specific granule deficiency	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ctsg	Rat	(-)-alpha-phellandrene	decreases expression	ISO	CTSG (Homo sapiens)	6480464	alpha phellandrene results in decreased expression of CTSG mRNA	CTD	PMID:25075043
Ctsg	Rat	(-)-trans-epsilon-viniferin	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	epsilon-viniferin inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein]	CTD	PMID:34144024
Ctsg	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	CTSG (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Ctsg	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Ctsg (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of CTSG mRNA	CTD	PMID:16114106
Ctsg	Rat	2,4,6-tribromophenol	decreases expression	ISO	CTSG (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Ctsg	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Ctsg (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Ctsg	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	CTSG (Homo sapiens)	6480464	tetrabromobisphenol A results in decreased expression of CTSG protein	CTD	PMID:31675489
Ctsg	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Ctsg (Mus musculus)	6480464	bisphenol S results in decreased expression of CTSG mRNA	CTD	PMID:39298647
Ctsg	Rat	aflatoxin B1	increases expression	ISO	Ctsg (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of CTSG mRNA	CTD	PMID:19770486
Ctsg	Rat	all-trans-retinoic acid	decreases expression	ISO	Ctsg (Mus musculus)	6480464	Tretinoin results in decreased expression of CTSG mRNA	CTD	PMID:16604517
Ctsg	Rat	all-trans-retinoic acid	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	[Tretinoin co-treated with arsenic trioxide] results in decreased expression of CTSG mRNA	CTD	PMID:15894607
Ctsg	Rat	all-trans-retinoic acid	decreases expression	ISO	CTSG (Homo sapiens)	6480464	Tretinoin results in decreased expression of CTSG mRNA	CTD	PMID:15894607 and PMID:17218384
Ctsg	Rat	alpha-phellandrene	decreases expression	ISO	CTSG (Homo sapiens)	6480464	alpha phellandrene results in decreased expression of CTSG mRNA	CTD	PMID:25075043
Ctsg	Rat	anilines	increases hydrolysis	EXP		6480464	CTSG protein results in increased hydrolysis of Aniline Compounds analog	CTD	PMID:6566611
Ctsg	Rat	anilines	increases hydrolysis	ISO	CTSG (Homo sapiens)	6480464	CTSG protein results in increased hydrolysis of Aniline Compounds analog	CTD	PMID:6566611
Ctsg	Rat	arsane	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	[Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of CTSG mRNA	CTD	PMID:28793237
Ctsg	Rat	arsane	affects expression	ISO	CTSG (Homo sapiens)	6480464	Arsenic affects the expression of CTSG mRNA	CTD	PMID:28793237
Ctsg	Rat	arsenic atom	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	[Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of CTSG mRNA	CTD	PMID:28793237
Ctsg	Rat	arsenic atom	affects expression	ISO	CTSG (Homo sapiens)	6480464	Arsenic affects the expression of CTSG mRNA	CTD	PMID:28793237
Ctsg	Rat	arsenous acid	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	[Tretinoin co-treated with Arsenic Trioxide] results in decreased expression of CTSG mRNA	CTD	PMID:15894607
Ctsg	Rat	benzo[a]pyrene	increases methylation	ISO	CTSG (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of CTSG promoter	CTD	PMID:27901495
Ctsg	Rat	bisphenol A	increases expression	ISO	Ctsg (Mus musculus)	6480464	bisphenol A results in increased expression of CTSG mRNA	CTD	PMID:26063408
Ctsg	Rat	bisphenol A	decreases expression	ISO	CTSG (Homo sapiens)	6480464	bisphenol A results in decreased expression of CTSG protein	CTD	PMID:31675489
Ctsg	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CTSG mRNA	CTD	PMID:25181051
Ctsg	Rat	cannabidiol	increases expression	ISO	Ctsg (Mus musculus)	6480464	Cannabidiol results in increased expression of CTSG mRNA	CTD	PMID:21542829
Ctsg	Rat	chlorpyrifos	increases expression	ISO	Ctsg (Mus musculus)	6480464	Chlorpyrifos results in increased expression of CTSG mRNA	CTD	PMID:32715474
Ctsg	Rat	corn oil	increases expression	EXP		6480464	Corn Oil results in increased expression of CTSG mRNA	CTD	PMID:22760963
Ctsg	Rat	Cyclosporin H	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	cyclosporin H inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein]	CTD	PMID:34144024
Ctsg	Rat	decabromodiphenyl ether	decreases expression	ISO	CTSG (Homo sapiens)	6480464	decabromobiphenyl ether results in decreased expression of CTSG protein	CTD	PMID:31675489
Ctsg	Rat	diarsenic trioxide	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	[Tretinoin co-treated with Arsenic Trioxide] results in decreased expression of CTSG mRNA	CTD	PMID:15894607
Ctsg	Rat	dimethylarsinic acid	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	[Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of CTSG mRNA	CTD	PMID:28793237
Ctsg	Rat	doxorubicin	affects response to substance	ISO	CTSG (Homo sapiens)	6480464	CTSG affects the susceptibility to Doxorubicin	CTD	PMID:16458935
Ctsg	Rat	genistein	decreases expression	ISO	Ctsg (Mus musculus)	6480464	Genistein results in decreased expression of CTSG mRNA	CTD	PMID:32186404
Ctsg	Rat	Honokiol	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	honokiol inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein]	CTD	PMID:25980585
Ctsg	Rat	methotrexate	decreases expression	ISO	CTSG (Homo sapiens)	6480464	Methotrexate results in decreased expression of CTSG mRNA	CTD	PMID:17400583
Ctsg	Rat	methotrexate	increases expression	ISO	CTSG (Homo sapiens)	6480464	Methotrexate results in increased expression of CTSG mRNA	CTD	PMID:24449571
Ctsg	Rat	N-formyl-L-methionyl-L-leucyl-L-phenylalanine	multiple interactions	ISO	CTSG (Homo sapiens)	6480464	cyclosporin H inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein] more ...	CTD	PMID:25980585 and PMID:34144024
Ctsg	Rat	N-formyl-L-methionyl-L-leucyl-L-phenylalanine	increases secretion	ISO	CTSG (Homo sapiens)	6480464	N-Formylmethionine Leucyl-Phenylalanine results in increased secretion of CTSG protein	CTD	PMID:25980585 and PMID:34144024
Ctsg	Rat	paracetamol	affects expression	ISO	Ctsg (Mus musculus)	6480464	Acetaminophen affects the expression of CTSG mRNA	CTD	PMID:17562736
Ctsg	Rat	paracetamol	decreases expression	ISO	CTSG (Homo sapiens)	6480464	Acetaminophen results in decreased expression of CTSG mRNA	CTD	PMID:26690555
Ctsg	Rat	perfluorohexanesulfonic acid	increases expression	ISO	Ctsg (Mus musculus)	6480464	perfluorohexanesulfonic acid results in increased expression of CTSG mRNA	CTD	PMID:37995155
Ctsg	Rat	phorbol 13-acetate 12-myristate	affects localization	ISO	CTSG (Homo sapiens)	6480464	Tetradecanoylphorbol Acetate affects the localization of CTSG protein	CTD	PMID:25980585
Ctsg	Rat	phorbol 13-acetate 12-myristate	increases secretion	ISO	CTSG (Homo sapiens)	6480464	Tetradecanoylphorbol Acetate results in increased secretion of CTSG protein	CTD	PMID:25980585 and PMID:34144024
Ctsg	Rat	potassium dichromate	increases expression	ISO	Ctsg (Mus musculus)	6480464	Potassium Dichromate results in increased expression of CTSG mRNA	CTD	PMID:23608068
Ctsg	Rat	senecionine	increases expression	ISO	Ctsg (Mus musculus)	6480464	senecionine results in increased expression of CTSG protein	CTD	PMID:35357534
Ctsg	Rat	sulforaphane	decreases expression	ISO	CTSG (Homo sapiens)	6480464	sulforaphane results in decreased expression of CTSG mRNA	CTD	PMID:26833863
Ctsg	Rat	vanadyl sulfate	increases expression	ISO	CTSG (Homo sapiens)	6480464	vanadyl sulfate results in increased expression of CTSG mRNA	CTD	PMID:16330358

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ctsg	Rat	antibacterial humoral response	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	biofilm matrix disassembly	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	biofilm matrix disassembly	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	biofilm matrix disassembly	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:32995850	RGD	PMID:32995850
Ctsg	Rat	cellular response to lipopolysaccharide	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	chemotaxis	involved_in	IEA	UniProtKB-KW:KW-0145	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	defense response to bacterium	involved_in	IEA	UniProtKB-KW:KW-0044	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	defense response to fungus	acts_upstream_of_or_within	ISO	Ctsg (Mus musculus)	1624291	MGI:2182170 more ...	RGD	PMID:10714686
Ctsg	Rat	defense response to Gram-negative bacterium	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	defense response to Gram-negative bacterium	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:2116408	RGD	PMID:2116408
Ctsg	Rat	defense response to Gram-negative bacterium	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	defense response to Gram-positive bacterium	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	defense response to Gram-positive bacterium	acts_upstream_of_or_within	ISO	Ctsg (Mus musculus)	1624291	MGI:2182170 PMID:11907569	RGD	PMID:11907569
Ctsg	Rat	defense response to Gram-positive bacterium	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	defense response to Gram-positive bacterium	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:2116408 and PMID:2117044	RGD	PMID:2116408 and PMID:2117044
Ctsg	Rat	monocyte chemotaxis	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	monocyte chemotaxis	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	monocyte chemotaxis	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:15210802	RGD	PMID:15210802
Ctsg	Rat	negative regulation of T cell activation	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	negative regulation of T cell activation	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:15100291	RGD	PMID:15100291
Ctsg	Rat	negative regulation of T cell activation	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	neutrophil activation	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	neutrophil activation	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	neutrophil activation	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:22879591	RGD	PMID:22879591
Ctsg	Rat	neutrophil-mediated killing of gram-positive bacterium	acts_upstream_of_or_within	ISO	Ctsg (Mus musculus)	1624291	MGI:2182170 PMID:11907569	RGD	PMID:11907569
Ctsg	Rat	platelet activation	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	platelet activation	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:10702240	RGD	PMID:10702240
Ctsg	Rat	platelet activation	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	positive regulation of immune response	acts_upstream_of_or_within	ISO	Ctsg (Mus musculus)	1624291	MGI:2182170 more ...	RGD	PMID:10714686
Ctsg	Rat	positive regulation of platelet aggregation	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	positive regulation of platelet aggregation	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:3390156	RGD	PMID:3390156
Ctsg	Rat	positive regulation of platelet aggregation	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	protein maturation	involved_in	IBA	MGI:109267 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ctsg	Rat	protein phosphorylation	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:8573071	RGD	PMID:8573071
Ctsg	Rat	protein processing	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	protein processing	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:16963625 more ...	RGD	PMID:16963625 more ...
Ctsg	Rat	protein processing	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	proteolysis	acts_upstream_of_or_within	ISO	CTSG (Homo sapiens)	1624291	PMID:11907569	RGD	PMID:11907569
Ctsg	Rat	proteolysis	involved_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	proteolysis	involved_in	IEA	InterPro:IPR001254 and InterPro:IPR018114	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ctsg	Rat	proteolysis	involved_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	proteolysis	involved_in	ISO	CTSG (Homo sapiens)	1624291	PMID:11259672 more ...	RGD	PMID:11259672 more ...
Ctsg	Rat	response to lipopolysaccharide	acts_upstream_of_or_within	ISO	Ctsg (Mus musculus)	1624291	MGI:2182170 more ...	RGD	PMID:10714686
Ctsg	Rat	signal transduction	involved_in	IEA	GO:0048018	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ctsg	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	cytoplasmic stress granule	located_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	cytoplasmic stress granule	located_in	ISO	CTSG (Homo sapiens)	1624291	PMID:1937776	RGD	PMID:1937776
Ctsg	Rat	cytosol	located_in	ISO	CTSG (Homo sapiens)	1624291	PMID:29077095	RGD	PMID:29077095
Ctsg	Rat	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ctsg	Rat	cytosol	located_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	cytosol	located_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ctsg	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	extracellular space	located_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	extracellular space	is_active_in	IBA	MGI:109266 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ctsg	Rat	extracellular space	located_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	extracellular space	located_in	ISO	CTSG (Homo sapiens)	1624291	PMID:29077095 more ...	RGD	PMID:29077095 more ...
Ctsg	Rat	lysosome	located_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	lysosome	located_in	IEA	UniProtKB-KW:KW-0458	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	lysosome	located_in	IEA	UniProtKB-SubCell:SL-0158	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ctsg	Rat	lysosome	located_in	ISO	CTSG (Homo sapiens)	1624291	PMID:15100291	RGD	PMID:15100291
Ctsg	Rat	lysosome	located_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	membrane	located_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	membrane	located_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	membrane	located_in	ISO	CTSG (Homo sapiens)	1624291	PMID:29077095	RGD	PMID:29077095
Ctsg	Rat	nucleus	located_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	nucleus	located_in	ISO	CTSG (Homo sapiens)	1624291	PMID:11259672	RGD	PMID:11259672
Ctsg	Rat	nucleus	located_in	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ctsg	Rat	plasma membrane	located_in	ISO	CTSG (Homo sapiens)	1624291	PMID:1861080	RGD	PMID:1861080
Ctsg	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ctsg	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	plasma membrane	located_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	secretory granule	located_in	ISO	CTSG (Homo sapiens)	1624291	PMID:11907569	RGD	PMID:11907569
Ctsg	Rat	secretory granule	located_in	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ctsg	Rat	caspase binding	enables	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	caspase binding	enables	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	caspase binding	enables	ISO	CTSG (Homo sapiens)	1624291	UniProtKB:P49662 and PMID:29077095	RGD	PMID:29077095
Ctsg	Rat	heparin binding	enables	ISO	CTSG (Homo sapiens)	1624291	PMID:11907569	RGD	PMID:11907569
Ctsg	Rat	heparin binding	enables	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	peptidase activity	enables	ISO	CTSG (Homo sapiens)	1624291	PMID:11907569	RGD	PMID:11907569
Ctsg	Rat	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ctsg	Rat	peptidase activity	enables	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	protein binding	enables	ISO	CTSG (Homo sapiens)	1624291	UniProtKB:A8MQ03 more ...	RGD	PMID:25416956 and PMID:32296183
Ctsg	Rat	protein binding	enables	ISO	Ctsg (Mus musculus)	1624291	PR:O88879 PMID:12189154	RGD	PMID:12189154
Ctsg	Rat	receptor ligand activity	enables	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	receptor ligand activity	enables	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	receptor ligand activity	enables	ISO	CTSG (Homo sapiens)	1624291	PMID:15210802	RGD	PMID:15210802
Ctsg	Rat	serine-type endopeptidase activity	enables	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	serine-type endopeptidase activity	enables	IEA	InterPro:IPR001254 and InterPro:IPR018114	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ctsg	Rat	serine-type endopeptidase activity	enables	IEA	EC:3.4.21.20	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Ctsg	Rat	serine-type endopeptidase activity	enables	IBA	MGI:109267 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ctsg	Rat	serine-type endopeptidase activity	enables	ISS	UniProtKB:P08311	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ctsg	Rat	serine-type endopeptidase activity	enables	ISO	CTSG (Homo sapiens)	1624291	PMID:10512690 more ...	RGD	PMID:10512690 more ...
Ctsg	Rat	serine-type peptidase activity	enables	ISO	CTSG (Homo sapiens)	1624291	PMID:1937776	RGD	PMID:1937776
Ctsg	Rat	serine-type peptidase activity	enables	IEA	UniProtKB:P08311 and ensembl:ENSP00000216336	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ctsg	Rat	serine-type peptidase activity	enables	IEA	UniProtKB-KW:KW-0720	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ctsg	Rat	Entamoebiasis pathway		IEA		6907045		KEGG	rno:05146
Ctsg	Rat	renin-angiotensin cascade pathway		IEA		6907045		KEGG	rno:04614
Ctsg	Rat	systemic lupus erythematosus pathway		IEA		6907045		KEGG	rno:05322

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Cathepsin g is required for sustained inflammation and tissue injury after reperfusion of ischemic kidneys.	Shimoda N, etal., Am J Pathol. 2007 Mar;170(3):930-40.

PMID:1861080	PMID:1937776	PMID:2222858	PMID:8194606	PMID:8573071	PMID:10512690	PMID:10714686	PMID:11907569	PMID:12504904	PMID:16690621	PMID:17975113	PMID:19056867
PMID:20551380	PMID:21630459	PMID:21904640	PMID:23376485	PMID:23533145	PMID:26270939	PMID:27068509	PMID:27559042

Ctsg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	33,901,230 - 33,907,596 (-)	NCBI		GRCr8
mRatBN7.2	15	29,930,988 - 29,937,353 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,931,003 - 29,937,353 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	31,780,745 - 31,783,332 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,927,946 - 32,930,533 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	31,186,079 - 31,188,666 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	35,107,333 - 35,113,678 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	35,111,091 - 35,113,678 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,994,558 - 39,000,903 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	34,622,211 - 34,624,798 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	34,637,918 - 34,648,441 (-)	NCBI
Celera	15	29,509,460 - 29,512,047 (-)	NCBI		Celera
Cytogenetic Map	15	p12	NCBI

CTSG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,573,518 - 24,576,250 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	24,573,518 - 24,576,250 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	25,042,724 - 25,045,456 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	24,112,564 - 24,115,306 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	24,112,563 - 24,115,306	NCBI
Celera	14	4,907,510 - 4,910,252 (-)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	5,157,531 - 5,160,273 (-)	NCBI		HuRef
CHM1_1	14	25,041,620 - 25,044,362 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,772,405 - 18,775,137 (-)	NCBI		T2T-CHM13v2.0

Ctsg
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	56,337,342 - 56,340,031 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	56,337,338 - 56,340,031 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	56,099,885 - 56,102,574 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	56,099,881 - 56,102,574 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	56,718,718 - 56,721,411 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	55,053,952 - 55,056,645 (-)	NCBI		MGSCv36	mm8
Celera	14	53,905,080 - 53,907,773 (-)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

CTSG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	25,921,107 - 25,923,838 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	25,137,599 - 25,140,330 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	5,342,517 - 5,345,218 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	23,466,259 - 23,468,960 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	23,466,265 - 23,468,960 (-)	Ensembl	panpan1.1		panPan2

CTSG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,483,327 - 4,485,933 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,470,577 - 4,512,628 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,404,974 - 4,407,573 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,594,740 - 4,597,337 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,582,079 - 4,597,280 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	4,284,216 - 4,286,825 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	4,346,800 - 4,349,397 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,609,195 - 4,611,806 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100154047
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	7	74,761,602 - 74,772,950 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	79,789,517 - 79,792,248 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CTSG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,518,004 - 1,521,980 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	1,518,119 - 1,520,709 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666036	13,210,626 - 13,213,332 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Ctsg
20 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	82
Interacting mature miRNAs:	86
Transcripts:	ENSRNOT00000059677
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	20248600	37896129	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	1	4	11	48	52	36	25	36	1	94	31	8	18	37	16


RefSeq Transcripts	NM_001106041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006252041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000059677 ⟹ ENSRNOP00000056429

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,931,003 - 29,937,353 (-)	Ensembl
Rnor_6.0 Ensembl	15	35,111,091 - 35,113,678 (-)	Ensembl

RefSeq Acc Id:

NM_001106041 ⟹ NP_001099511

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,905,009 - 33,907,596 (-)	NCBI
mRatBN7.2	15	29,934,766 - 29,937,353 (-)	NCBI
Rnor_6.0	15	35,111,091 - 35,113,678 (-)	NCBI
Rnor_5.0	15	38,994,558 - 39,000,903 (-)	NCBI
RGSC_v3.4	15	34,622,211 - 34,624,798 (-)	RGD
Celera	15	29,509,460 - 29,512,047 (-)	RGD

Sequence:

show sequence

ACGAAACCTATCACGGGAGCAGGGAAATGGACCTGTGGTCCCTCAGCACACCCTTCCTTCCTCTCCAGGGGAGGATAAAAGTCTGGCAGAGAAAAGTAAAAGCAGCAGCTGACTTAGCAACGGTTCTG
GAAAGATGCAGCCACTCCTGTTTCTGTTGATCTTTGTTCTATTCCAAGAAGATGAGGCAGGAAAGATCATTGGAGGCCGAGAAGCCAGGCCAAATTCCCACCCCTACATGGCATTTCTTCTGATCCAG
AGTCCAGAAGGGCTGAGTGCTTGTGGAGGGTTTCTGGTGCGAGAAGACTTTGTCCTCACAGCAGGTCACTGCTTTGGAAGCTCCATAAATGTTACCCTAGGGGCCCACAACATTCGAAGGCAAGAAGG
GACCCAGCAACACATCACTGTTCTCAGAGCCATCCGCCATCCTGATTACAATCCCCCGCCAGTCATCCAGAATGACATCATGCTACTGCAGCTGAGGAGTAGAGCCCGGAGGAGTCGAGCGGTGAAGC
CCGTGGCTCTGCCTCAAGCCACCAAGAGAGTACAACCAGGGGCTTTGTGCACAGTGGCTGGCTGGGGCCTGGTGAGCCAGCGCAGGGGGACAAATGTACTCCAGGAGGTGAAGCTAAGAGTGCAGACG
GACCAAACGTGCGCCAATCGTTTCCAATTCTACAACAGCCAGACTCAGATCTGTGTGGGAAACCCGAGAGAAAGGAAGTCTGCCTTCAAGGGTGATTCTGGTGGTCCTCTGGTATGTAATAATGTGGC
CCAGGGCATCGTCTCCTATGGAAGCAGCAGTGGTAACCCTCCAGCTGTGTTCACCAGAATCCAGAGCTTCATGCCCTGGATCAAAAGAACAATGAGACGTCTTTCCTCAAGGTATTAGGGACTTGCTG
ACTCCCTGTCTCAGACGTAGACCAGCTTTAGGGAATTTCCATAGCCCTTATTAATGTCTCCTGGACAGTGTAAATTTTCATTTATTAAATATCATTTGGCACTGTCTTAA

hide sequence

RefSeq Acc Id:

XM_006252041 ⟹ XP_006252103

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,901,230 - 33,907,546 (-)	NCBI
mRatBN7.2	15	29,930,988 - 29,937,303 (-)	NCBI
Rnor_6.0	15	35,107,333 - 35,113,590 (-)	NCBI
Rnor_5.0	15	38,994,558 - 39,000,903 (-)	NCBI

Sequence:

show sequence

GAGAAAAGTAAAAGCAGCAGCTGACTTAGCAACGGTTCTGGAAAGATGCAGCCACTCCTGTTTCTGTTGATCTTTGTTCTATTCCAAGAAGATGAGGCAGGAAAGATCATTGGAGGCCGAGAAGCCAG
GCCAAATTCCCACCCCTACATGGCATTTCTTCTGATCCAGAGTCCAGAAGGGCTGAGTGCTTGTGGAGGGTTTCTGGTGCGAGAAGACTTTGTCCTCACAGCAGGTCACTGCTTTGGAAGCTCCATAA
ATGTTACCCTAGGGGCCCACAACATTCGAAGGCAAGAAGGGACCCAGCAACACATCACTGTTCTCAGAGCCATCCGCCATCCTGATTACAATCCCCCGCCAGTCATCCAGAATGACATCATGCTACTG
CAGCTGAGGAGTAGAGCCCGGAGGAGTCGAGCGGTGAAGCCCGTGGCTCTGCCTCAAGCCACCAAGAGAGTACAACCAGGGGCTTTGTGCACAGTGGCTGGCTGGGGCCTGGTGAGCCAGCGCAGGGG
GACAAATGTACTCCAGGAGGTGAAGCTAAGAGTGCAGACGGACCAAACGTGCGCCAATCGTTTCCAATTCTACAACAGCCAGACTCAGATCTGTGTGGGAAACCCGAGAGAAAGGAAGTCTGCCTTCA
AGGGTGATTCTGGTGGTCCTCTGGTATGTAATAATGTGGCCCAGGGCATCGTCTCCTATGGAAGCAGCAGTGGTAACCCTCCAGCTGTGTTCACCAGAATCCAGAGCTTCATGCCCTGGATCAAAAGA
ACAATGAGACGTCTTTCCTCAAGCAAAGAGGATTCTAAGCTGGATTCTAAGCAAGGTCCTGGGCATCCATCCAAGTTCAAAAGCAATGAAACCCTAACAAGACAAAAACTATCACTTTTAAAAGAGGA
TAATTAAGGATACAGGGTTATACACAGATGTGAGTCCCAGACAATGGAGTGATCATCGTAGGCCTCAAGAACTCTACAGAACCAGGACTGCCTTGTCCACACTCCTCTACTAGAAAAATTTCCTTCTC
ACACTCATTTTTCTTCCAAATCTGTTTGTGTGGTCACCCAGGCCCCTCTGACATGGTCTGGGGAGGATATTGCACGTGAGACCATGTGGTCTCACATCCTGCCCCTGAACTGATTATCACCCGCACAT
CTCCAGCAAGCGGTAGAATTTGAACGGCCTGTTATCTTCAGGAATCTATTGCTGCAACTCTCCACATTTGAACTACTCAGTTCTGGAACCTAAGGAGGAAGAGAAAAAGAAGAATGTGGGGACTTATA
TTGGCGCTGCAGTCACTCATATTGTGGGTGGGAGTGAGGCCCAGGAGATACAGCAGAGGTGACCTCAAAAGTTCAAGGAAAGACCTCTGTCAAAAATAAAAGTTCAATAAATGTCTTACTGGCTAA

hide sequence

RefSeq Acc Id:

XM_039093138 ⟹ XP_038949066

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	33,901,230 - 33,907,546 (-)	NCBI
mRatBN7.2	15	29,930,988 - 29,937,303 (-)	NCBI


Protein RefSeqs	NP_001099511	(Get FASTA)	NCBI Sequence Viewer
	XP_006252103	(Get FASTA)	NCBI Sequence Viewer
	XP_038949066	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14312	(Get FASTA)	NCBI Sequence Viewer
	EDM14313	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000056429
	ENSRNOP00000098990
GenBank Protein	P17977	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001099511 ⟸ NM_001106041
- Peptide Label:	precursor
- UniProtKB:	P17977 (UniProtKB/Swiss-Prot), G3V9Q7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQPLLFLLIFVLFQEDEAGKIIGGREARPNSHPYMAFLLIQSPEGLSACGGFLVREDFVLTAGHCFGSSINVTLGAHNIRRQEGTQQHITVLRAIRHPDYNPPPVIQNDIMLLQLRSRARRSRAVKPV ALPQATKRVQPGALCTVAGWGLVSQRRGTNVLQEVKLRVQTDQTCANRFQFYNSQTQICVGNPRERKSAFKGDSGGPLVCNNVAQGIVSYGSSSGNPPAVFTRIQSFMPWIKRTMRRLSSRY hide sequence

RefSeq Acc Id:	XP_006252103 ⟸ XM_006252041
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5XFF7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQPLLFLLIFVLFQEDEAGKIIGGREARPNSHPYMAFLLIQSPEGLSACGGFLVREDFVLTAGHCFGSSINVTLGAHNIRRQEGTQQHITVLRAIRHPDYNPPPVIQNDIMLLQLRSRARRSRAVKPV ALPQATKRVQPGALCTVAGWGLVSQRRGTNVLQEVKLRVQTDQTCANRFQFYNSQTQICVGNPRERKSAFKGDSGGPLVCNNVAQGIVSYGSSSGNPPAVFTRIQSFMPWIKRTMRRLSSSKEDSKLD SKQGPGHPSKFKSNETLTRQKLSLLKEDN hide sequence

Ensembl Acc Id:

ENSRNOP00000056429 ⟸ ENSRNOT00000059677

RefSeq Acc Id:	XP_038949066 ⟸ XM_039093138
- Peptide Label:	isoform X2

Protein Domains

Peptidase S1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P17977-F1-model_v2	AlphaFold	P17977	1-250	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-13662	BioCyc
Ensembl Genes	ENSRNOG00000020647	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000059677	ENTREZGENE
	ENSRNOT00000150390	ENTREZGENE
Gene3D-CATH	2.40.10.10	UniProtKB/Swiss-Prot
InterPro	Peptidase_S1_PA	UniProtKB/Swiss-Prot
	Peptidase_S1_PA_chymotrypsin	UniProtKB/Swiss-Prot
	Peptidase_S1A	UniProtKB/Swiss-Prot
	Trypsin_dom	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
	TRYPSIN_SER	UniProtKB/Swiss-Prot
KEGG Report	rno:290257	UniProtKB/Swiss-Prot
NCBI Gene	290257	ENTREZGENE
PANTHER	CATHEPSIN G	UniProtKB/Swiss-Prot
	KALLIKREIN-RELATED	UniProtKB/Swiss-Prot
Pfam	Trypsin	UniProtKB/Swiss-Prot
PharmGKB	CTSG	RGD
PhenoGen	Ctsg	PhenoGen
PRINTS	CHYMOTRYPSIN	UniProtKB/Swiss-Prot
PROSITE	TRYPSIN_DOM	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
	TRYPSIN_SER	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020647	RatGTEx
SMART	Tryp_SPc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50494	UniProtKB/Swiss-Prot
UniProt	A0A8I5XFF7	ENTREZGENE, UniProtKB/TrEMBL
	CATG_RAT	UniProtKB/Swiss-Prot
	G3V9Q7	ENTREZGENE
	P17977	ENTREZGENE
UniProt Secondary	G3V9Q7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Ctsg	cathepsin G	Ctsg_predicted	cathepsin G (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ctsg_predicted	cathepsin G (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)