Advanced Search (OLGA)

Gene: Zup1 (zinc finger containing ubiquitin peptidase 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Zup1

Name:

zinc finger containing ubiquitin peptidase 1

RGD ID:

1307672

Description:

Predicted to enable cysteine-type deubiquitinase activity and zinc ion binding activity. Predicted to be located in cytosol and nucleoplasm. Orthologous to human ZUP1 (zinc finger containing ubiquitin peptidase 1); INTERACTS WITH 3H-1,2-dithiole-3-thione; bisphenol A; decabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DUB; hypothetical LOC294390; LOC294390; lys-63-specific deubiquitinase ZUFSP; MGC94667; RGD1307672; ubiquitin carboxyl-terminal hydrolase ZUFSP; zinc finger with UFM1-specific peptidase domain; zinc finger with UFM1-specific peptidase domain protein; zinc finger-containing ubiquitin peptidase 1; Zufsp

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	31,327,939 - 31,358,088 (-)	NCBI		GRCr8
mRatBN7.2	20	30,785,226 - 30,815,377 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	30,785,227 - 30,815,306 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	31,796,148 - 31,826,237 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	31,187,068 - 31,217,157 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	31,923,787 - 31,953,877 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	32,471,670 - 32,501,693 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	32,471,672 - 32,501,722 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	34,255,576 - 34,285,599 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	30,096,106 - 30,126,201 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	30,109,906 - 30,140,001 (-)	NCBI
Celera	20	32,202,226 - 32,232,242 (-)	NCBI		Celera
Cytogenetic Map	20	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zup1	Rat	body dysmorphic disorder		ISO	ZUP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dysmorphic features	ClinVar	PMID:24824130
Zup1	Rat	congenital disorder of glycosylation Iaa		ISO	ZUP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation and type IAA	ClinVar	PMID:28492532 more ...
Zup1	Rat	intellectual disability		ISO	ZUP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual functioning disability	ClinVar	PMID:24824130
Zup1	Rat	microcephaly		ISO	ZUP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Microcephaly	ClinVar	PMID:24824130
Zup1	Rat	primary ciliary dyskinesia		ISO	ZUP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary ciliary dyskinesia	ClinVar	PMID:28492532
Zup1	Rat	Tremor		ISO	ZUP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Tremor	ClinVar	PMID:24824130

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zup1	Rat	17alpha-ethynylestradiol	affects expression	ISO	Zup1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of ZUP1 mRNA	CTD	PMID:17555576
Zup1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of ZUP1 mRNA	CTD	PMID:28628672
Zup1	Rat	3H-1,2-dithiole-3-thione	decreases expression	EXP		6480464	1 and 2-dithiol-3-thione results in decreased expression of ZUP1 mRNA	CTD	PMID:19162173
Zup1	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of ZUP1 mRNA	CTD	PMID:28628672
Zup1	Rat	acrylamide	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	Acrylamide results in increased expression of ZUP1 mRNA	CTD	PMID:32763439
Zup1	Rat	aflatoxin B1	increases expression	ISO	Zup1 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of ZUP1 mRNA	CTD	PMID:19770486
Zup1	Rat	arsane	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZUP1 mRNA	CTD	PMID:39836092
Zup1	Rat	arsenic atom	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZUP1 mRNA	CTD	PMID:39836092
Zup1	Rat	benzene	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	Benzene results in increased expression of ZUP1 mRNA	CTD	PMID:19162166
Zup1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	ZUP1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20382639
Zup1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ZUP1 mRNA	CTD	PMID:25181051
Zup1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ZUP1 mRNA	CTD	PMID:34947998
Zup1	Rat	bisphenol F	decreases expression	ISO	Zup1 (Mus musculus)	6480464	bisphenol F results in decreased expression of ZUP1 mRNA	CTD	PMID:38685157
Zup1	Rat	cadmium dichloride	decreases expression	ISO	ZUP1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of ZUP1 mRNA	CTD	PMID:38568856
Zup1	Rat	carbon nanotube	affects expression	ISO	Zup1 (Mus musculus)	6480464	Nanotubes and Carbon affects the expression of ZUP1 mRNA	CTD	PMID:25554681
Zup1	Rat	chlorpyrifos	decreases expression	ISO	Zup1 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of ZUP1 mRNA	CTD	PMID:37019170
Zup1	Rat	chromium(6+)	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of ZUP1 mRNA	CTD	PMID:38479592
Zup1	Rat	cisplatin	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of ZUP1 mRNA	CTD	PMID:27392435
Zup1	Rat	copper(II) sulfate	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of ZUP1 mRNA	CTD	PMID:19549813
Zup1	Rat	crocidolite asbestos	decreases expression	ISO	Zup1 (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of ZUP1 mRNA	CTD	PMID:29279043
Zup1	Rat	cyclosporin A	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of ZUP1 mRNA	CTD	PMID:25562108
Zup1	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of ZUP1 mRNA	CTD	PMID:23640034
Zup1	Rat	dexamethasone	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of ZUP1 mRNA	CTD	PMID:28628672
Zup1	Rat	dicrotophos	decreases expression	ISO	ZUP1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of ZUP1 mRNA	CTD	PMID:28302478
Zup1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of ZUP1 mRNA	CTD	PMID:33387578
Zup1	Rat	glycidol	decreases expression	EXP		6480464	glycidol results in decreased expression of ZUP1 mRNA	CTD	PMID:24915197
Zup1	Rat	gold atom	decreases expression	ISO	ZUP1 (Homo sapiens)	6480464	Gold results in decreased expression of ZUP1 mRNA	CTD	PMID:25523186
Zup1	Rat	gold(0)	decreases expression	ISO	ZUP1 (Homo sapiens)	6480464	Gold results in decreased expression of ZUP1 mRNA	CTD	PMID:25523186
Zup1	Rat	indometacin	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of ZUP1 mRNA	CTD	PMID:28628672
Zup1	Rat	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of ZUP1 mRNA	CTD	PMID:22641619
Zup1	Rat	manganese atom	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZUP1 mRNA	CTD	PMID:39836092
Zup1	Rat	manganese(0)	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZUP1 mRNA	CTD	PMID:39836092
Zup1	Rat	manganese(II) chloride	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZUP1 mRNA	CTD	PMID:39836092
Zup1	Rat	methyl methanesulfonate	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of ZUP1 mRNA	CTD	PMID:23649840
Zup1	Rat	methylparaben	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	methylparaben results in increased expression of ZUP1 mRNA	CTD	PMID:31745603
Zup1	Rat	pentachlorophenol	increases expression	ISO	Zup1 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of ZUP1 mRNA	CTD	PMID:23892564
Zup1	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	ZUP1 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of ZUP1 mRNA	CTD	PMID:27153767
Zup1	Rat	resveratrol	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of ZUP1 mRNA	CTD	PMID:23557933
Zup1	Rat	sodium arsenite	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of ZUP1 mRNA	CTD	PMID:38568856
Zup1	Rat	sodium arsenite	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZUP1 mRNA	CTD	PMID:39836092
Zup1	Rat	succimer	multiple interactions	ISO	ZUP1 (Homo sapiens)	6480464	[Succimer co-treated with Magnetite Nanoparticles] results in increased expression of ZUP1 mRNA	CTD	PMID:26378955
Zup1	Rat	sunitinib	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	Sunitinib results in increased expression of ZUP1 mRNA	CTD	PMID:31533062
Zup1	Rat	tamoxifen	affects expression	ISO	Zup1 (Mus musculus)	6480464	Tamoxifen affects the expression of ZUP1 mRNA	CTD	PMID:17555576
Zup1	Rat	thiram	increases expression	ISO	ZUP1 (Homo sapiens)	6480464	Thiram results in increased expression of ZUP1 mRNA	CTD	PMID:38568856
Zup1	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of ZUP1 gene	CTD	PMID:27618143
Zup1	Rat	valproic acid	decreases expression	ISO	ZUP1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of ZUP1 mRNA	CTD	PMID:23179753 and PMID:28001369
Zup1	Rat	valproic acid	decreases methylation	ISO	ZUP1 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of ZUP1 gene	CTD	PMID:29154799
Zup1	Rat	valproic acid	affects expression	ISO	ZUP1 (Homo sapiens)	6480464	Valproic Acid affects the expression of ZUP1 mRNA	CTD	PMID:25979313
Zup1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of ZUP1 mRNA	CTD	PMID:23034163

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zup1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Zup1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Zup1	Rat	cytosol	located_in	ISO	ZUP1 (Homo sapiens) and UniProtKB:Q96AP4-1	1624291		RGD	GO_REF:0000052
Zup1	Rat	nucleoplasm	located_in	ISO	ZUP1 (Homo sapiens) and UniProtKB:Q96AP4-1	1624291		RGD	GO_REF:0000052
Zup1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Zup1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zup1	Rat	cysteine-type deubiquitinase activity	enables	IEA	EC:3.4.19.12	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Zup1	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Zup1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Zup1	Rat	protein binding	enables	ISO	ZUP1 (Homo sapiens)	1624291	UniProtKB:P50281 more ...	RGD	PMID:25416956 and PMID:32296183
Zup1	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334

Zup1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	31,327,939 - 31,358,088 (-)	NCBI		GRCr8
mRatBN7.2	20	30,785,226 - 30,815,377 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	30,785,227 - 30,815,306 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	31,796,148 - 31,826,237 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	31,187,068 - 31,217,157 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	31,923,787 - 31,953,877 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	32,471,670 - 32,501,693 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	32,471,672 - 32,501,722 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	34,255,576 - 34,285,599 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	30,096,106 - 30,126,201 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	30,109,906 - 30,140,001 (-)	NCBI
Celera	20	32,202,226 - 32,232,242 (-)	NCBI		Celera
Cytogenetic Map	20	q11	NCBI

ZUP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	116,635,618 - 116,668,766 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	116,635,618 - 116,668,794 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	116,956,781 - 116,989,929 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	117,063,474 - 117,096,652 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	117,063,473 - 117,096,650	NCBI
Celera	6	117,699,849 - 117,733,039 (-)	NCBI		Celera
Cytogenetic Map	6	q22.1	NCBI
HuRef	6	114,536,357 - 114,569,549 (-)	NCBI		HuRef
CHM1_1	6	117,220,405 - 117,253,587 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	117,819,329 - 117,852,469 (-)	NCBI		T2T-CHM13v2.0

Zup1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	33,795,138 - 33,827,316 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	33,795,138 - 33,827,265 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	33,919,142 - 33,951,294 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	33,919,142 - 33,951,269 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	33,646,742 - 33,671,018 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	33,616,352 - 33,648,207 (-)	NCBI		MGSCv36	mm8
Celera	10	34,837,312 - 34,861,586 (-)	NCBI		Celera
Cytogenetic Map	10	B1	NCBI
cM Map	10	18.85	NCBI

Zup1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	2,057 - 33,251 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	1,001 - 28,469 (+)	NCBI	ChiLan1.0	ChiLan1.0

ZUP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	136,649,403 - 136,682,936 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	134,542,421 - 134,575,953 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	114,443,844 - 114,477,220 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	118,588,455 - 118,621,123 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	118,598,031 - 118,621,081 (-)	Ensembl	panpan1.1		panPan2

ZUP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	57,076,730 - 57,108,527 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	57,067,005 - 57,106,837 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	57,875,202 - 57,903,637 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	57,261,956 - 57,290,387 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	57,261,962 - 57,290,365 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	57,156,332 - 57,184,769 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	57,004,493 - 57,032,925 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	57,633,012 - 57,661,676 (-)	NCBI		UU_Cfam_GSD_1.0

Zup1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	107,802,407 - 107,823,359 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937068	21,276 - 42,264 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004937068	21,312 - 42,266 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZUP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	44,939,951 - 44,961,145 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	44,939,914 - 45,013,764 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	50,212,885 - 50,235,181 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ZUP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	57,146,150 - 57,172,473 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	57,146,172 - 57,177,127 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	29,480,575 - 29,506,919 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zup1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624798	12,991,865 - 13,021,268 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624798	12,992,315 - 13,021,450 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Zup1
281 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	16
Count of miRNA genes:	16
Interacting mature miRNAs:	16
Transcripts:	ENSRNOT00000000448
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	17617832	47606836	Rat
2303587	Bw93	Body weight QTL 93	13		body mass (VT:0001259)	body weight (CMO:0000012)	20	25106722	54435887	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
2303626	Vencon10	Ventilatory control QTL 10		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	20	19190721	54435887	Rat
1598869	Memor6	Memory QTL 6	3.1		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	20	29244388	54435887	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
1331747	Hrtrt16	Heart rate QTL 16	3.163		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	20	25209734	54435887	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2303578	Gluco50	Glucose level QTL 50	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	20	25106722	54435887	Rat
2317880	Alcrsp25	Alcohol response QTL 25	2.3		response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	17697550	54435887	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat
2300188	Bmd68	Bone mineral density QTL 68	6.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	20	25106722	54435887	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001008308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098590	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098591	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010060650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000448 ⟹ ENSRNOP00000000448

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	30,785,227 - 30,815,306 (-)	Ensembl
Rnor_6.0 Ensembl	20	32,471,672 - 32,501,722 (-)	Ensembl

RefSeq Acc Id:

NM_001008308 ⟹ NP_001008309

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	31,327,939 - 31,358,023 (-)	NCBI
mRatBN7.2	20	30,785,226 - 30,815,306 (-)	NCBI
Rnor_6.0	20	32,471,670 - 32,501,693 (-)	NCBI
Rnor_5.0	20	34,255,576 - 34,285,599 (-)	NCBI
RGSC_v3.4	20	30,096,106 - 30,126,201 (-)	RGD
Celera	20	32,202,226 - 32,232,242 (-)	RGD

Sequence:

show sequence

GTGAGGAAGAGCTGTTGTGACTGCGGTACTGCGGAGGGCTCTCGGCGGCCCGCGACAAGGCTGAGTCCCGGGAGGTCCATGCCCCACCATGCTTTCCTGTGACATCTGTGGTGAAACTGTAACCTCAG
AACCAGATAGGAAGGCTCACCTAATTGTTCACATGGAAAATGAAATTATCTGTCCGTTTTGCAAGCTGTCGGGTATAAATTACAATGAAATGTGTTTTCATATTGAAACCGCTCATTTTGAACAGACT
ACGCCAGAAAAAAGCTTCGAGACGCTAGCCGCAGTGCAATATGAAAATTCAGACCTCGGTAATACCAAGCTGCACAGTACAGTGGAAGTTACCTCAGGCATCCATTCAGCTTGTGCATCGAACTTTCC
AAAGGAGTCGTCCGAAAGCCTTTCTAAAGATAGGACTTTAAAACAAGAAGCTTTTTATACAGAGAGCGTAGCTGAATCTAGAAAGTACCAGAAAAGCAGAGAAAAGCAGTCCGGATTGTCTGAGGCCC
AAGGATCAATTTATGAAACAACATACAGTCCCCCCGAATGTCCGTTCTGTGGGAGAATTGAGAGGTACAGTCAAGATATGGAAATTCATGTGAAAACAAAGCATGCCAGCCTTCTAGAAAGTCCGTTA
GAAGACTGTCATCAACCACTCTATGACTGTCCCATGTGTGGGCTTGTCTGTACAAATTATCACATTCTCCAAGAACATGTGGACTTGCATTTAGAAGAAAGCAGCTTTCAACAAGGCATGGACAGAGT
CCAGTGTTCTAGTGACAGAGAATTAGCTCACCAGCTTCAGCAAGAAGAAGAGAGAAAGAGGAAATCTGAAGAATCAAGACAAGAAAGGGAAGAGTTTCAGAAATTGCAGCGGCAGTACGGCTTAGATA
ATTCTGGAGGATACAAACAACAGCAGCTGCGACACATGGAGCTAGAAGTAACGAGGGGACGAATGCATCCATCTGAGTTCCACAGCAGAAAAGCTGACATGTTGGAATCAATCGCTGTTGGTATTGAT
GATGGAAAAACAAAAACTTCTGGAATTATTGAAGCCCTCCACAGGTATTATCAGAACATTGCCACAGATGTAAGGTGTGTGTGGCTGTCTACAGTGGTGGATCACTTTCATTCATCTTTTGGGGACAA
AGGTTGGGGTTGCGGTTATAGAAATTTCCAGATGCTGCTTTCATCATTACTGCAGAATGAAGTGTACAGTGACTGCTTGAAAGGTATGTCAGTTCCTTGTATTCCAAAAATTCAGTCCATGATTGAAG
ATGCGTGGAATGAAGGTTTTGATCCTCAGGGGGCCTCTCAACTTAATAACAAGTTGCAGGGGACCAAGGCCTGGATTGGAGCATGTGAGATCTATACACTTCTGACCTCACTGAAAGTCAAGTGCCGC
ATTATTGATTTTCACAAGTCAACTGGTCCTTCAGGCACACACCCTCGCTTATTCGAGTGGATACTGAACTATTATTCCTCAGAGACGGAAGGGGCGCCAAAGGTCGTGTGTACATCCAAACCTCCTGT
CTATCTCCAGCATCAGGGTCACAGTCGAACAGTTGTTGGGATTGAAGAGAGAAAAAACCGAACATTATGTTTGCTAATATTTGATCCTGGATGTCCTTCTCGAGAAATGCAGAAGCTGTTAAAGCAAG
ACATGGAGGCTGGTAGTCTCAGGCAGCTCCGGAAATGTGTGGGAAATCTGAAGCATAAGCAGTACCAGATAGTAGCAGTGGAGGGTATCCTGTCCCCAGAGGAGAGAGCTGCCAGGAAACAAGCTTCT
CAAGTGTTTACAGCGGAGAAGATTCCTTGACCCAGATATTTTGTAATTATCCTTTTTGTTTCCGATATTGAACTCTGATACAGTTGAAGAATTTGACTTCACTGAAGTCGGTGATAAATTATTTAAGT
TATAAATGCCTGTTGTACTCCTTAGCATTTCGTTGTCTGGTAATCAGTTGAATAAATTCCTTGTTTACATTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039098589 ⟹ XP_038954517

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	31,327,939 - 31,356,017 (-)	NCBI
mRatBN7.2	20	30,785,226 - 30,813,297 (-)	NCBI

RefSeq Acc Id:

XM_039098590 ⟹ XP_038954518

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	31,327,939 - 31,353,063 (-)	NCBI
mRatBN7.2	20	30,785,226 - 30,813,177 (-)	NCBI

RefSeq Acc Id:

XM_039098591 ⟹ XP_038954519

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	31,339,658 - 31,358,086 (-)	NCBI
mRatBN7.2	20	30,796,983 - 30,815,377 (-)	NCBI

RefSeq Acc Id:

XM_039098592 ⟹ XP_038954520

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	31,327,939 - 31,345,738 (-)	NCBI
mRatBN7.2	20	30,785,226 - 30,803,384 (-)	NCBI

RefSeq Acc Id:

XM_063279066 ⟹ XP_063135136

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	31,345,771 - 31,358,088 (-)	NCBI

RefSeq Acc Id:

XR_010060650

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	31,336,618 - 31,358,085 (-)	NCBI


Protein RefSeqs	NP_001008309	(Get FASTA)	NCBI Sequence Viewer
	XP_038954517	(Get FASTA)	NCBI Sequence Viewer
	XP_038954518	(Get FASTA)	NCBI Sequence Viewer
	XP_038954519	(Get FASTA)	NCBI Sequence Viewer
	XP_038954520	(Get FASTA)	NCBI Sequence Viewer
	XP_063135136	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85885	(Get FASTA)	NCBI Sequence Viewer
	EDL92952	(Get FASTA)	NCBI Sequence Viewer
	EDL92953	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000448
	ENSRNOP00000000448.3
GenBank Protein	Q5U2S3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008309 ⟸ NM_001008308

- UniProtKB:

Q5U2S3 (UniProtKB/Swiss-Prot), A6K470 (UniProtKB/TrEMBL), A6K469 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLSCDICGETVTSEPDRKAHLIVHMENEIICPFCKLSGINYNEMCFHIETAHFEQTTPEKSFETLAAVQYENSDLGNTKLHSTVEVTSGIHSACASNFPKESSESLSKDRTLKQEAFYTESVAESRKY
QKSREKQSGLSEAQGSIYETTYSPPECPFCGRIERYSQDMEIHVKTKHASLLESPLEDCHQPLYDCPMCGLVCTNYHILQEHVDLHLEESSFQQGMDRVQCSSDRELAHQLQQEEERKRKSEESRQER
EEFQKLQRQYGLDNSGGYKQQQLRHMELEVTRGRMHPSEFHSRKADMLESIAVGIDDGKTKTSGIIEALHRYYQNIATDVRCVWLSTVVDHFHSSFGDKGWGCGYRNFQMLLSSLLQNEVYSDCLKGM
SVPCIPKIQSMIEDAWNEGFDPQGASQLNNKLQGTKAWIGACEIYTLLTSLKVKCRIIDFHKSTGPSGTHPRLFEWILNYYSSETEGAPKVVCTSKPPVYLQHQGHSRTVVGIEERKNRTLCLLIFDP
GCPSREMQKLLKQDMEAGSLRQLRKCVGNLKHKQYQIVAVEGILSPEERAARKQASQVFTAEKIP

hide sequence

Ensembl Acc Id:

ENSRNOP00000000448 ⟸ ENSRNOT00000000448

RefSeq Acc Id:	XP_038954517 ⟸ XM_039098589
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038954518 ⟸ XM_039098590
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038954520 ⟸ XM_039098592
- Peptide Label:	isoform X5

Protein Domains

C2H2-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U2S3-F1-model_v2	AlphaFold	Q5U2S3	1-577	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701619

Promoter ID:

EPDNEW_R12143

Type:

multiple initiation site

Name:

Zufsp_1

Description:

zinc finger with UFM1-specific peptidase domain

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	32,501,694 - 32,501,754	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-3667	BioCyc
Ensembl Genes	ENSRNOG00000000398	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000448	ENTREZGENE
	ENSRNOT00000000448.6	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.70.130	UniProtKB/Swiss-Prot
	Classic Zinc Finger	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7192192	IMAGE-MGC_LOAD
InterPro	Papain-like_cys_pep_sf	UniProtKB/Swiss-Prot
	Peptidase_C78_UfSP1/2	UniProtKB/Swiss-Prot
	Zinc_finger/UBP_domain	UniProtKB/Swiss-Prot
	Znf_C2H2_type	UniProtKB/Swiss-Prot
KEGG Report	rno:294390	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94667	IMAGE-MGC_LOAD
NCBI Gene	294390	ENTREZGENE
PANTHER	ZINC FINGER PROTEIN	UniProtKB/Swiss-Prot
	ZINC FINGER-CONTAINING UBIQUITIN PEPTIDASE 1	UniProtKB/Swiss-Prot
Pfam	Peptidase_C78	UniProtKB/Swiss-Prot
PhenoGen	Zup1	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot
	ZINC_FINGER_C2H2_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000000398	RatGTEx
SMART	ZnF_C2H2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54001	UniProtKB/Swiss-Prot
UniProt	A6K469	ENTREZGENE, UniProtKB/TrEMBL
	A6K470	ENTREZGENE, UniProtKB/TrEMBL
	Q5U2S3	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-02-28	Zup1	zinc finger containing ubiquitin peptidase 1	Zufsp	zinc finger with UFM1-specific peptidase domain	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-31	Zufsp	zinc finger with UFM1-specific peptidase domain	RGD1307672	hypothetical LOC294390	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1307672	hypothetical LOC294390	RGD1307672_predicted	hypothetical LOC294390 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1307672_predicted	hypothetical LOC294390 (predicted)	LOC294390_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC294390_predicted	hypothetical LOC294390 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar