Symbol:
Map2k4
Name:
mitogen activated protein kinase kinase 4
RGD ID:
1307040
Description:
Enables JUN kinase kinase activity. Involved in several processes, including cellular response to sorbitol; positive regulation of JNK cascade; and positive regulation of macromolecule metabolic process. Located in axon; dendrite cytoplasm; and perikaryon. Used to study transient cerebral ischemia. Human ortholog(s) of this gene implicated in colorectal cancer; ovarian serous carcinoma; pancreatic cancer; respiratory system cancer (multiple); and urinary bladder cancer. Orthologous to human MAP2K4 (mitogen-activated protein kinase kinase 4); PARTICIPATES IN c-Jun N-terminal kinases MAPK signaling pathway; Rho/Rac/Cdc42 mediated signaling pathway; ceramide signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dual specificity mitogen-activated protein kinase kinase 4; LOC287398; MAP2K4delta; MKK4; SAPK/ERK kinase 1; Sek1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MAP2K4 (mitogen-activated protein kinase kinase 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Map2k4 (mitogen-activated protein kinase kinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Map2k4 (mitogen-activated protein kinase kinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MAP2K4 (mitogen-activated protein kinase kinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MAP2K4 (mitogen-activated protein kinase kinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Map2k4 (mitogen-activated protein kinase kinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MAP2K4 (mitogen-activated protein kinase kinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MAP2K4 (mitogen-activated protein kinase kinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Map2k4 (mitogen-activated protein kinase kinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KPNA1 (karyopherin subunit alpha 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
MAP2K4 (mitogen-activated protein kinase kinase 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Map2k4 (mitogen-activated protein kinase kinase 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
map2k4b (mitogen-activated protein kinase kinase 4b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
map2k4a (mitogen-activated protein kinase kinase 4a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PBS2
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Mkk4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
mkk-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sek-6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
map2k4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 50,842,348 - 50,947,063 (-) NCBI GRCr8 mRatBN7.2 10 50,343,227 - 50,447,956 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 50,344,915 - 50,447,993 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 55,014,269 - 55,116,147 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 54,504,259 - 54,606,140 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 50,012,148 - 50,114,010 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 52,196,121 - 52,301,887 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 52,196,124 - 52,290,657 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 51,951,707 - 52,054,098 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 52,009,149 - 52,041,599 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 52,020,408 - 52,055,249 (-) NCBI Celera 10 49,553,065 - 49,624,419 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map2k4 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1316001 6480464 1,2-Dimethylhydrazine results in decreased expression of MAP2K4 mRNA CTD PMID:22206623 Map2k4 Rat 17beta-estradiol increases expression ISO RGD:1316000 6480464 Estradiol results in increased expression of MAP2K4 mRNA CTD PMID:23094148 Map2k4 Rat 17beta-estradiol increases expression ISO RGD:1316001 6480464 Estradiol results in increased expression of MAP2K4 mRNA CTD PMID:39298647 Map2k4 Rat 17beta-estradiol multiple interactions ISO RGD:1316000 6480464 IGF1R mutant form inhibits the reaction [Estradiol results in increased expression of MAP2K4 mRNA] CTD PMID:23094148 Map2k4 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1316000 6480464 Dihydrotestosterone results in increased expression of MAP2K4 mRNA CTD PMID:29581250 Map2k4 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1316000 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of MAP2K4 protein CTD PMID:31675489 Map2k4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1316001 6480464 Tetrachlorodibenzodioxin affects the expression of MAP2K4 mRNA CTD PMID:21570461 Map2k4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAP2K4 mRNA CTD PMID:32109520 Map2k4 Rat 2,4,6-tribromophenol decreases expression ISO RGD:1316000 6480464 2,4,6-tribromophenol results in decreased expression of MAP2K4 mRNA CTD PMID:31675489 Map2k4 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1316000 6480464 tetrabromobisphenol A results in decreased expression of MAP2K4 protein CTD PMID:31675489 Map2k4 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1316001 6480464 bisphenol S results in increased expression of MAP2K4 mRNA CTD PMID:39298647 Map2k4 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1316000 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of MAP2K4 gene CTD PMID:31601247 Map2k4 Rat 4-hydroxyphenyl retinamide multiple interactions ISO RGD:1316000 6480464 Butylated Hydroxyanisole inhibits the reaction [Fenretinide results in increased phosphorylation of MAP2K4 protein] CTD PMID:16407847 Map2k4 Rat 4-hydroxyphenyl retinamide increases phosphorylation ISO RGD:1316000 6480464 Fenretinide results in increased phosphorylation of MAP2K4 protein CTD PMID:16407847 Map2k4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MAP2K4 mRNA CTD PMID:24780913 Map2k4 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MAP2K4 mRNA CTD PMID:31881176 Map2k4 Rat Aciculatin multiple interactions ISO RGD:1316001 6480464 aciculatin inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of MAP2K4 protein] CTD PMID:21548916 Map2k4 Rat acrylamide increases expression ISO RGD:1316000 6480464 Acrylamide results in increased expression of MAP2K4 mRNA CTD PMID:32763439 Map2k4 Rat actinomycin D decreases expression ISO RGD:1316000 6480464 Dactinomycin results in decreased expression of MAP2K4 mRNA CTD PMID:16001973 Map2k4 Rat afimoxifene decreases response to substance ISO RGD:1316000 6480464 MAP2K4 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Map2k4 Rat aflatoxin B1 decreases methylation ISO RGD:1316000 6480464 Aflatoxin B1 results in decreased methylation of MAP2K4 gene CTD PMID:27153756 Map2k4 Rat aflatoxin B1 increases expression ISO RGD:1316000 6480464 Aflatoxin B1 results in increased expression of MAP2K4 mRNA CTD PMID:27153756 Map2k4 Rat alpha-mangostin increases phosphorylation ISO RGD:1316000 6480464 mangostin analog results in increased phosphorylation of MAP2K4 protein CTD PMID:28722351 Map2k4 Rat alvocidib multiple interactions ISO RGD:1316000 6480464 alvocidib promotes the reaction [Bortezomib results in increased phosphorylation of and results in increased activity more ... CTD PMID:15039284 Map2k4 Rat andrographolide multiple interactions ISO RGD:1316000 6480464 andrographolide inhibits the reaction [VEGFA protein results in increased phosphorylation of MAP2K4 protein] CTD PMID:24814888 Map2k4 Rat Antimony trioxide multiple interactions ISO RGD:1316001 6480464 MAP2K4 protein affects the reaction [antimony trioxide results in increased activity of MAPK8 protein] CTD PMID:16112521 Map2k4 Rat antimycin A decreases expression ISO RGD:1316000 6480464 Antimycin A results in decreased expression of MAP2K4 mRNA CTD PMID:33512557 Map2k4 Rat antirheumatic drug increases expression ISO RGD:1316000 6480464 Antirheumatic Agents results in increased expression of MAP2K4 mRNA CTD PMID:24449571 Map2k4 Rat aristolochic acid A decreases expression ISO RGD:1316000 6480464 aristolochic acid I results in decreased expression of MAP2K4 mRNA CTD PMID:33212167 Map2k4 Rat arsenite(3-) multiple interactions ISO RGD:1316000 6480464 arsenite inhibits the reaction [G3BP1 protein binds to MAP2K4 mRNA] CTD PMID:32406909 Map2k4 Rat arsenous acid multiple interactions ISO RGD:1316000 6480464 MAP2K4 gene mutant form inhibits the reaction [Arsenic Trioxide results in increased activity of MAPK8 more ... CTD PMID:14701702|PMID:15978632 Map2k4 Rat arsenous acid increases response to substance ISO RGD:1316001 6480464 MAP2K4 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:16184197 Map2k4 Rat arsenous acid increases response to substance ISO RGD:1316000 6480464 MAP2K4 protein results in increased susceptibility to Arsenic Trioxide; MAP2K4 results in increased susceptibility to more ... CTD PMID:14701702|PMID:18633430 Map2k4 Rat auramine O increases expression ISO RGD:1316000 6480464 Benzophenoneidum results in increased expression of MAP2K4 protein CTD PMID:28722353 Map2k4 Rat benzo[a]pyrene increases phosphorylation ISO RGD:1316000 6480464 Benzo(a)pyrene analog results in increased phosphorylation of MAP2K4 protein CTD PMID:24910982 Map2k4 Rat benzo[a]pyrene increases methylation ISO RGD:1316000 6480464 Benzo(a)pyrene results in increased methylation of MAP2K4 promoter CTD PMID:27901495 Map2k4 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1316000 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of MAP2K4 mRNA CTD PMID:19150397 Map2k4 Rat benzo[a]pyrene diol epoxide I increases expression ISO RGD:1316000 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of MAP2K4 mRNA CTD PMID:26238291 Map2k4 Rat benzo[a]pyrene diol epoxide I multiple interactions ISO RGD:1316001 6480464 AG 1879 inhibits the reaction [7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased phosphorylation of MAP2K4 protein]; cyanidin-3-O-beta-glucopyranoside more ... CTD PMID:21501596 Map2k4 Rat benzo[a]pyrene diol epoxide I increases phosphorylation ISO RGD:1316001 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased phosphorylation of MAP2K4 protein CTD PMID:21501596 Map2k4 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO RGD:1316001 6480464 Mustard Gas results in increased phosphorylation of MAP2K4 protein CTD PMID:18200059 Map2k4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MAP2K4 mRNA CTD PMID:25181051 Map2k4 Rat bisphenol A increases methylation ISO RGD:1316000 6480464 bisphenol A results in increased methylation of MAP2K4 gene CTD PMID:31601247 Map2k4 Rat bisphenol A decreases expression ISO RGD:1316000 6480464 bisphenol A results in decreased expression of MAP2K4 protein CTD PMID:31675489 Map2k4 Rat bortezomib multiple interactions ISO RGD:1316000 6480464 alvocidib promotes the reaction [Bortezomib results in increased phosphorylation of and results in increased activity more ... CTD PMID:15039284 Map2k4 Rat butylated hydroxyanisole multiple interactions ISO RGD:1316000 6480464 Butylated Hydroxyanisole inhibits the reaction [Fenretinide results in increased phosphorylation of MAP2K4 protein] CTD PMID:16407847 Map2k4 Rat cadmium dichloride multiple interactions ISO RGD:1316000 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K4 protein] CTD PMID:18703135 Map2k4 Rat cadmium dichloride increases phosphorylation EXP 6480464 Cadmium Chloride results in increased phosphorylation of MAP2K4 protein CTD PMID:18021293|PMID:18703135 Map2k4 Rat cadmium dichloride multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K4 protein] CTD PMID:18703135 Map2k4 Rat cadmium dichloride multiple interactions ISO RGD:1316001 6480464 [MAP2K4 co-treated with MAP2K7] affects the reaction [Cadmium Chloride results in increased expression of HSPA1A more ... CTD PMID:18348256 Map2k4 Rat cadmium dichloride increases phosphorylation ISO RGD:1316000 6480464 Cadmium Chloride results in increased phosphorylation of MAP2K4 protein CTD PMID:18703135 Map2k4 Rat caffeine increases phosphorylation ISO RGD:1316000 6480464 Caffeine results in increased phosphorylation of MAP2K4 protein CTD PMID:35688186 Map2k4 Rat celecoxib multiple interactions ISO RGD:1316001 6480464 Celecoxib inhibits the reaction [deoxynivalenol results in increased phosphorylation of MAP2K4 protein] CTD PMID:32416088 Map2k4 Rat chlorogenic acid multiple interactions ISO RGD:1316001 6480464 Chlorogenic Acid inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of MAP2K4 protein] CTD PMID:15944151 Map2k4 Rat chromium(6+) multiple interactions ISO RGD:1316001 6480464 MAP2K4 protein promotes the reaction [chromium hexavalent ion results in increased phosphorylation of ATF2 protein]; more ... CTD PMID:19654923 Map2k4 Rat chromium(6+) increases response to substance ISO RGD:1316001 6480464 MAP2K4 protein results in increased susceptibility to chromium hexavalent ion CTD PMID:19654923 Map2k4 Rat cisplatin multiple interactions ISO RGD:1316000 6480464 [Cisplatin co-treated with Quercetin] results in increased expression of MAP2K4 mRNA CTD PMID:27514524 Map2k4 Rat cobalt dichloride increases expression ISO RGD:1316000 6480464 cobaltous chloride results in increased expression of MAP2K4 mRNA CTD PMID:19376846 Map2k4 Rat cocaine increases expression ISO RGD:1316001 6480464 Cocaine results in increased expression of MAP2K4 mRNA CTD PMID:18355967 Map2k4 Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with pyrrolidine dithiocarbamic acid] results in increased phosphorylation of MAP2K4 protein; Acetylcysteine inhibits more ... CTD PMID:22085843 Map2k4 Rat copper atom multiple interactions ISO RGD:1316000 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAP2K4 mRNA CTD PMID:30911355 Map2k4 Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with pyrrolidine dithiocarbamic acid] results in increased phosphorylation of MAP2K4 protein; Acetylcysteine inhibits more ... CTD PMID:22085843 Map2k4 Rat copper(0) multiple interactions ISO RGD:1316000 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAP2K4 mRNA CTD PMID:30911355 Map2k4 Rat crocidolite asbestos decreases phosphorylation ISO RGD:1316000 6480464 Asbestos, Crocidolite results in decreased phosphorylation of MAP2K4 protein CTD PMID:17191120 Map2k4 Rat curcumin decreases expression ISO RGD:1316000 6480464 Curcumin results in decreased expression of MAP2K4 mRNA CTD PMID:15713895 Map2k4 Rat curcumin increases phosphorylation ISO RGD:1316000 150429751 Curcumin increases phosphorylation of MAP2K4 protein in uterine cervix RGD Map2k4 Rat cyclosporin A increases expression ISO RGD:1316001 6480464 Cyclosporine results in increased expression of MAP2K4 mRNA CTD PMID:19770486 Map2k4 Rat cypermethrin multiple interactions ISO RGD:1316001 6480464 [[[cypermethrin results in decreased expression of MIR155 mRNA] which results in increased expression of BCL6 more ... CTD PMID:29471534 Map2k4 Rat decabromodiphenyl ether decreases expression ISO RGD:1316000 6480464 decabromobiphenyl ether results in decreased expression of MAP2K4 protein CTD PMID:31675489 Map2k4 Rat deoxynivalenol multiple interactions ISO RGD:1316001 6480464 Celecoxib inhibits the reaction [deoxynivalenol results in increased phosphorylation of MAP2K4 protein] CTD PMID:32416088 Map2k4 Rat deoxynivalenol increases phosphorylation ISO RGD:1316001 6480464 deoxynivalenol results in increased phosphorylation of MAP2K4 protein CTD PMID:32416088 Map2k4 Rat diallyl trisulfide multiple interactions ISO RGD:1316000 6480464 MAP2K4 protein affects the reaction [diallyl trisulfide results in increased abundance of Reactive Oxygen Species]; more ... CTD PMID:16707465 Map2k4 Rat diarsenic trioxide multiple interactions ISO RGD:1316000 6480464 MAP2K4 gene mutant form inhibits the reaction [Arsenic Trioxide results in increased activity of MAPK8 more ... CTD PMID:14701702|PMID:15978632 Map2k4 Rat diarsenic trioxide increases response to substance ISO RGD:1316001 6480464 MAP2K4 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:16184197 Map2k4 Rat diarsenic trioxide increases response to substance ISO RGD:1316000 6480464 MAP2K4 protein results in increased susceptibility to Arsenic Trioxide; MAP2K4 results in increased susceptibility to more ... CTD PMID:14701702|PMID:18633430 Map2k4 Rat dicrotophos decreases expression ISO RGD:1316000 6480464 dicrotophos results in decreased expression of MAP2K4 mRNA CTD PMID:28302478 Map2k4 Rat disodium selenite multiple interactions ISO RGD:1316001 6480464 Sodium Selenite promotes the reaction [[Streptozocin co-treated with Dietary Fats] results in increased phosphorylation of more ... CTD PMID:26522834 Map2k4 Rat doxorubicin affects activity ISO RGD:1316000 6480464 Doxorubicin affects the activity of MAP2K4 protein CTD PMID:15870702 Map2k4 Rat doxorubicin decreases response to substance ISO RGD:1316000 6480464 MAP2K4 protein results in decreased susceptibility to Doxorubicin CTD PMID:14701702 Map2k4 Rat doxorubicin increases expression ISO RGD:1316000 6480464 Doxorubicin results in increased expression of MAP2K4 mRNA CTD PMID:16001973 Map2k4 Rat endosulfan decreases expression ISO RGD:1316000 6480464 Endosulfan results in decreased expression of MAP2K4 mRNA CTD PMID:28108160 Map2k4 Rat ethanol affects splicing ISO RGD:1316001 6480464 Ethanol affects the splicing of MAP2K4 mRNA CTD PMID:30319688 Map2k4 Rat folic acid decreases expression ISO RGD:1316001 6480464 Folic Acid results in decreased expression of MAP2K4 mRNA CTD PMID:25629700 Map2k4 Rat fulvestrant multiple interactions ISO RGD:1316000 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of MAP2K4 gene CTD PMID:31601247 Map2k4 Rat gallic acid increases expression ISO RGD:1316000 6480464 Gallic Acid results in increased expression of MAP2K4 mRNA CTD PMID:34408198 Map2k4 Rat gingerol multiple interactions ISO RGD:1316001 6480464 gingerol inhibits the reaction [TNF protein results in increased phosphorylation of MAP2K4 protein] CTD PMID:18577375 Map2k4 Rat glyphosate affects methylation ISO RGD:1316000 6480464 Glyphosate affects the methylation of MAP2K4 gene CTD PMID:35377194 Map2k4 Rat glyphosate decreases expression ISO RGD:1316000 6480464 Glyphosate results in decreased expression of MAP2K4 mRNA CTD PMID:31295307 Map2k4 Rat hydrogen cyanide decreases expression ISO RGD:1316001 6480464 Hydrogen Cyanide results in decreased expression of MKK4 mRNA CTD PMID:33914522 Map2k4 Rat hydrogen peroxide multiple interactions ISO RGD:1316000 6480464 MAP2K4 protein affects the reaction [Hydrogen Peroxide results in increased degradation of FTL protein] CTD PMID:16707465 Map2k4 Rat indometacin increases expression ISO RGD:1316000 6480464 Indomethacin results in increased expression of MAP2K4 protein CTD PMID:15804060 Map2k4 Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of MAP2K4 mRNA CTD PMID:30303030 Map2k4 Rat ivermectin decreases expression ISO RGD:1316000 6480464 Ivermectin results in decreased expression of MAP2K4 protein CTD PMID:32959892 Map2k4 Rat Licochalcone A decreases phosphorylation ISO RGD:1316000 6480464 licochalcone A results in decreased phosphorylation of MAP2K4 protein CTD PMID:30187994 Map2k4 Rat Licochalcone A multiple interactions ISO RGD:1316000 6480464 licochalcone A promotes the reaction [Sorafenib results in decreased phosphorylation of MAP2K4 protein]; Sorafenib promotes more ... CTD PMID:30187994 Map2k4 Rat lipopolysaccharide increases phosphorylation ISO RGD:1316000 150429951 lipopolysaccharide increases phosphorylation of MAP2K4 protein in the pulmonary alveolus epithelium RGD Map2k4 Rat lipopolysaccharide increases phosphorylation ISO RGD:1316001 6480464 Lipopolysaccharides results in increased phosphorylation of MAP2K4 protein CTD PMID:21548916 Map2k4 Rat lipopolysaccharide increases activity ISO RGD:1316001 6480464 Lipopolysaccharides results in increased activity of MAP2K4 protein CTD PMID:20589745 Map2k4 Rat lipopolysaccharide multiple interactions ISO RGD:1316001 6480464 [Manganese co-treated with Lipopolysaccharides] results in increased activity of and results in increased phosphorylation of more ... CTD PMID:20589745|PMID:21548916 Map2k4 Rat lipopolysaccharide multiple interactions ISO RGD:1316000 6480464 MYD88 protein promotes the reaction [Lipopolysaccharides results in increased phosphorylation of MAP2K4 protein]; TLR2 protein more ... CTD PMID:21112663 Map2k4 Rat lipopolysaccharide increases phosphorylation ISO RGD:1316000 6480464 Lipopolysaccharides results in increased phosphorylation of MAP2K4 protein CTD PMID:21112663 Map2k4 Rat lycopene decreases expression ISO RGD:1316000 6480464 lycopene results in decreased expression of MAP2K4 protein CTD PMID:17337101 Map2k4 Rat maneb multiple interactions ISO RGD:1316001 6480464 [Maneb co-treated with Paraquat] results in decreased expression of MAP2K4 mRNA CTD PMID:36117858 Map2k4 Rat manganese atom multiple interactions ISO RGD:1316001 6480464 [Manganese co-treated with Lipopolysaccharides] results in increased activity of and results in increased phosphorylation of more ... CTD PMID:20589745 Map2k4 Rat manganese atom decreases phosphorylation ISO RGD:1316001 6480464 Manganese results in decreased phosphorylation of MAP2K4 protein CTD PMID:20589745 Map2k4 Rat manganese(0) multiple interactions ISO RGD:1316001 6480464 [Manganese co-treated with Lipopolysaccharides] results in increased activity of and results in increased phosphorylation of more ... CTD PMID:20589745 Map2k4 Rat manganese(0) decreases phosphorylation ISO RGD:1316001 6480464 Manganese results in decreased phosphorylation of MAP2K4 protein CTD PMID:20589745 Map2k4 Rat manganese(II) chloride increases phosphorylation EXP 6480464 manganese chloride results in increased phosphorylation of MAP2K4 protein CTD PMID:15342272|PMID:9751194 Map2k4 Rat methidathion affects expression ISO RGD:1316001 6480464 methidathion affects the expression of MAP2K4 mRNA CTD PMID:34813904 Map2k4 Rat methotrexate increases expression ISO RGD:1316000 6480464 Methotrexate results in increased expression of MAP2K4 mRNA CTD PMID:21678067 Map2k4 Rat mevinphos increases phosphorylation EXP 6480464 Mevinphos results in increased phosphorylation of MAP2K4 protein CTD PMID:23157661 Map2k4 Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of MAP2K4 mRNA CTD PMID:28954212 Map2k4 Rat N-acetyl-L-cysteine multiple interactions ISO RGD:1316000 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased phosphorylation of MAP2K4 protein] CTD PMID:18703135 Map2k4 Rat N-acetyl-L-cysteine multiple interactions ISO RGD:1316000 150429751 N-acetyl-L-cysteine inhibits the reaction [Curcumin increases phosphorylation of MAP2K4 protein in uterine cervix] RGD Map2k4 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [[Copper co-treated with pyrrolidine dithiocarbamic acid] results in increased phosphorylation of more ... CTD PMID:18703135|PMID:22085843 Map2k4 Rat N-nitrosodiethylamine multiple interactions ISO RGD:1316001 6480464 Diethylnitrosamine results in increased phosphorylation of and results in increased activity of MAP2K4 protein; MAPK14 more ... CTD PMID:18691550 Map2k4 Rat N-nitrosodimethylamine multiple interactions EXP 6480464 [GJB1 protein affects the susceptibility to [Dietary Fats co-treated with Dimethylnitrosamine]] which affects the phosphorylation more ... CTD PMID:32833043 Map2k4 Rat nickel dichloride multiple interactions ISO RGD:1316001 6480464 GADD45A protein inhibits the reaction [nickel chloride results in increased activity of MAP2K4 protein] CTD PMID:23536762 Map2k4 Rat okadaic acid increases expression ISO RGD:1316000 6480464 Okadaic Acid results in increased expression of MAP2K4 mRNA CTD PMID:38832940 Map2k4 Rat p-menthan-3-ol increases expression ISO RGD:1316000 6480464 Menthol results in increased expression of MAP2K4 mRNA CTD PMID:26760959 Map2k4 Rat paclitaxel multiple interactions ISO RGD:1316000 6480464 MAP2K4 protein affects the reaction [Paclitaxel results in increased activity of CASP3 protein]; MAP2K4 protein more ... CTD PMID:10075725 Map2k4 Rat paracetamol affects expression ISO RGD:1316001 6480464 Acetaminophen affects the expression of MAP2K4 mRNA CTD PMID:17562736 Map2k4 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MAP2K4 mRNA CTD PMID:33387578 Map2k4 Rat paracetamol multiple interactions ISO RGD:1316001 6480464 [RIPK1 protein affects the susceptibility to Acetaminophen] which affects the phosphorylation of MAP2K4 protein; [TNFAIP3 more ... CTD PMID:22687999|PMID:29943110|PMID:33460648 Map2k4 Rat paracetamol increases phosphorylation ISO RGD:1316001 6480464 Acetaminophen results in increased phosphorylation of MAP2K4 protein CTD PMID:22687999|PMID:29943110|PMID:34890640 Map2k4 Rat paracetamol increases response to substance EXP 6480464 MAP2K4 results in increased susceptibility to Acetaminophen CTD PMID:11562448 Map2k4 Rat paracetamol multiple interactions EXP 6480464 Acetaminophen results in increased phosphorylation of and results in increased activity of MAP2K4 protein; MAP2K4 more ... CTD PMID:11562448 Map2k4 Rat paraquat multiple interactions ISO RGD:1316001 6480464 [Maneb co-treated with Paraquat] results in decreased expression of MAP2K4 mRNA CTD PMID:36117858 Map2k4 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1316001 6480464 perfluorooctane sulfonic acid results in decreased expression of MAP2K4 protein CTD PMID:26178269 Map2k4 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:1316001 6480464 Chlorogenic Acid inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of MAP2K4 protein] CTD PMID:15944151 Map2k4 Rat picoxystrobin decreases expression ISO RGD:1316000 6480464 picoxystrobin results in decreased expression of MAP2K4 mRNA CTD PMID:33512557 Map2k4 Rat pyrrolidine dithiocarbamate multiple interactions EXP 6480464 [Copper co-treated with pyrrolidine dithiocarbamic acid] results in increased phosphorylation of MAP2K4 protein; Acetylcysteine inhibits more ... CTD PMID:22085843 Map2k4 Rat quercetin increases expression ISO RGD:1316000 6480464 Quercetin results in increased expression of MAP2K4 mRNA CTD PMID:23727915 Map2k4 Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of MAP2K4 mRNA CTD PMID:17103110 Map2k4 Rat quercetin decreases expression ISO RGD:1316000 6480464 Quercetin results in decreased expression of MAP2K4 mRNA CTD PMID:15309432 Map2k4 Rat quercetin multiple interactions ISO RGD:1316000 6480464 [Cisplatin co-treated with Quercetin] results in increased expression of MAP2K4 mRNA; Quercetin inhibits the reaction more ... CTD PMID:16963249|PMID:27514524 Map2k4 Rat reactive oxygen species multiple interactions ISO RGD:1316000 6480464 MAP2K4 protein affects the reaction [diallyl trisulfide results in increased abundance of Reactive Oxygen Species] CTD PMID:16707465 Map2k4 Rat scutellarin multiple interactions ISO RGD:1316001 6480464 scutellarin inhibits the reaction [Zearalenone results in increased expression of MAP2K4 protein] CTD PMID:36252740 Map2k4 Rat sodium arsenite increases expression ISO RGD:1316000 6480464 sodium arsenite results in increased expression of MAP2K4 mRNA CTD PMID:12760830 Map2k4 Rat sodium arsenite decreases expression ISO RGD:1316001 6480464 sodium arsenite results in decreased expression of MAP2K4 mRNA CTD PMID:31233874 Map2k4 Rat sodium arsenite multiple interactions ISO RGD:1316000 6480464 MAP2K4 mutant form affects the reaction [sodium arsenite results in increased expression of TP53 protein]; more ... CTD PMID:15734884 Map2k4 Rat sodium arsenite multiple interactions ISO RGD:1316001 6480464 CDKN1B protein inhibits the reaction [sodium arsenite results in increased activity of MAP2K4 protein] CTD PMID:20566634 Map2k4 Rat sorafenib multiple interactions ISO RGD:1316000 6480464 licochalcone A promotes the reaction [Sorafenib results in decreased phosphorylation of MAP2K4 protein]; Sorafenib promotes more ... CTD PMID:30187994 Map2k4 Rat sorafenib decreases phosphorylation ISO RGD:1316000 6480464 Sorafenib results in decreased phosphorylation of MAP2K4 protein CTD PMID:30187994 Map2k4 Rat streptozocin multiple interactions ISO RGD:1316001 6480464 [Streptozocin co-treated with Dietary Fats] results in increased phosphorylation of MAP2K4 protein; Sodium Selenite promotes more ... CTD PMID:26522834 Map2k4 Rat sulforaphane increases expression ISO RGD:1316000 6480464 sulforaphane results in increased expression of MAP2K4 mRNA CTD PMID:31838189 Map2k4 Rat sulindac sulfone multiple interactions ISO RGD:1316000 6480464 sulindac sulfone results in increased phosphorylation of and results in increased activity of MAP2K4 protein CTD PMID:11051267 Map2k4 Rat tamoxifen increases expression ISO RGD:1316000 6480464 Tamoxifen results in increased expression of MAP2K4 mRNA CTD PMID:15590111 Map2k4 Rat tebufenpyrad decreases expression ISO RGD:1316000 6480464 4-chloro-N-((4-(1,1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of MAP2K4 mRNA CTD PMID:33512557 Map2k4 Rat tert-butyl hydroperoxide increases phosphorylation ISO RGD:1316000 6480464 tert-Butylhydroperoxide results in increased phosphorylation of MAP2K4 protein CTD PMID:17003459 Map2k4 Rat testosterone decreases expression ISO RGD:1316000 6480464 Testosterone results in decreased expression of MAP2K4 mRNA CTD PMID:33359661 Map2k4 Rat thapsigargin decreases expression ISO RGD:1316001 6480464 Thapsigargin results in decreased expression of MAP2K4 protein CTD PMID:24648495 Map2k4 Rat thiram increases expression ISO RGD:1316000 6480464 Thiram results in increased expression of MAP2K4 mRNA CTD PMID:38568856 Map2k4 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of MAP2K4 mRNA CTD PMID:25729387 Map2k4 Rat triphenyl phosphate affects expression ISO RGD:1316000 6480464 triphenyl phosphate affects the expression of MAP2K4 mRNA CTD PMID:37042841 Map2k4 Rat valproic acid decreases expression ISO RGD:1316000 6480464 Valproic Acid results in decreased expression of MAP2K4 mRNA CTD PMID:23179753 Map2k4 Rat valproic acid affects expression ISO RGD:1316000 6480464 Valproic Acid affects the expression of MAP2K4 mRNA CTD PMID:25979313 Map2k4 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of MAP2K4 mRNA CTD PMID:23555832 Map2k4 Rat zearalenone decreases expression ISO RGD:1316001 6480464 Zearalenone results in decreased expression of MAP2K4 protein CTD PMID:36252740 Map2k4 Rat zearalenone multiple interactions ISO RGD:1316001 6480464 scutellarin inhibits the reaction [Zearalenone results in increased expression of MAP2K4 protein] CTD PMID:36252740 Map2k4 Rat zearalenone increases expression ISO RGD:1316001 6480464 Zearalenone results in increased expression of MAP2K4 protein CTD PMID:36252740 Map2k4 Rat zinc dichloride increases activity ISO RGD:1316001 6480464 zinc chloride results in increased activity of MAP2K4 protein CTD PMID:11306679
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) Aciculatin (ISO) acrylamide (ISO) actinomycin D (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) alpha-mangostin (ISO) alvocidib (ISO) andrographolide (ISO) Antimony trioxide (ISO) antimycin A (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) auramine O (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bortezomib (ISO) butylated hydroxyanisole (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) celecoxib (ISO) chlorogenic acid (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) cocaine (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) cypermethrin (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) dicrotophos (ISO) disodium selenite (ISO) doxorubicin (ISO) endosulfan (ISO) ethanol (ISO) folic acid (ISO) fulvestrant (ISO) gallic acid (ISO) gingerol (ISO) glyphosate (ISO) hydrogen cyanide (ISO) hydrogen peroxide (ISO) indometacin (ISO) isoprenaline (EXP) ivermectin (ISO) Licochalcone A (ISO) lipopolysaccharide (ISO) lycopene (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (EXP) methidathion (ISO) methotrexate (ISO) mevinphos (EXP) monosodium L-glutamate (EXP) N-acetyl-L-cysteine (EXP,ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (EXP) nickel dichloride (ISO) okadaic acid (ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) pyrrolidine dithiocarbamate (EXP) quercetin (EXP,ISO) reactive oxygen species (ISO) scutellarin (ISO) sodium arsenite (ISO) sorafenib (ISO) streptozocin (ISO) sulforaphane (ISO) sulindac sulfone (ISO) tamoxifen (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) thapsigargin (ISO) thiram (ISO) topotecan (EXP) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) zearalenone (ISO) zinc dichloride (ISO)
1.
Map2k4 functions as a tumor suppressor in lung adenocarcinoma and inhibits tumor cell invasion by decreasing peroxisome proliferator-activated receptor γ2 expression.
Ahn YH, etal., Mol Cell Biol. 2011 Nov;31(21):4270-85. doi: 10.1128/MCB.05562-11. Epub 2011 Sep 6.
2.
The Ras/Rac1/Cdc42/SEK/JNK/c-Jun cascade is a key pathway by which agonists stimulate DNA synthesis in primary cultures of rat hepatocytes.
Auer KL, etal., Mol Biol Cell. 1998 Mar;9(3):561-73.
3.
Stress- and cell type-dependent regulation of transfected c-Jun N-terminal kinase and mitogen-activated protein kinase kinase isoforms.
Butterfield L, etal., Biochem J. 1999 Mar 15;338 ( Pt 3):681-6.
4.
Pro-life role for c-Jun N-terminal kinase and p38 mitogen-activated protein kinase at rostral ventrolateral medulla in experimental brain stem death.
Chang AY J Biomed Sci. 2012 Nov 17;19:96. doi: 10.1186/1423-0127-19-96.
5.
Influence of sleep deprivation on expression of MKK4 and c-fos in the mandibular condylar cartilage of rats.
Chen J, etal., Br J Oral Maxillofac Surg. 2013 Dec;51(8):e250-5. doi: 10.1016/j.bjoms.2013.06.010. Epub 2013 Jul 13.
6.
Role of the stress-activated protein kinases in endothelin-induced cardiomyocyte hypertrophy.
Choukroun G, etal., J Clin Invest. 1998 Oct 1;102(7):1311-20.
7.
Toll-like receptor 2-mediated sequential activation of MyD88 and MAPKs contributes to lipopolysaccharide-induced sp-a gene expression in human alveolar epithelial cells.
Chuang CY, etal., Immunobiology. 2011 Jun;216(6):707-14. doi: 10.1016/j.imbio.2010.10.009. Epub 2010 Nov 4.
8.
The mitogen-activated protein kinase kinase 4 has a pro-oncogenic role in skin cancer.
Finegan KG and Tournier C, Cancer Res. 2010 Jul 15;70(14):5797-806. doi: 10.1158/0008-5472.CAN-09-3669. Epub 2010 Jul 7.
9.
Immunolocalization of the mitogen-activated protein kinases p42MAPK and JNK1, and their regulatory kinases MEK1 and MEK4, in adult rat central nervous system.
Flood DG, etal., J Comp Neurol. 1998 Aug 31;398(3):373-92.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Both p38alpha(MAPK) and JNK/SAPK pathways are important for induction of nitric-oxide synthase by interleukin-1beta in rat glomerular mesangial cells.
Guan Z, etal., J Biol Chem. 1999 Dec 17;274(51):36200-6.
13.
Activation of ASK1, downstream MAPKK and MAPK isoforms during cardiac ischaemia.
Harding SJ, etal., Biochim Biophys Acta. 2010 Sep;1802(9):733-40. doi: 10.1016/j.bbadis.2010.06.005. Epub 2010 Jun 13.
14.
Increased expression of IRE1alpha and stress-related signal transduction proteins in ischemia-reperfusion injured retina.
Hata N, etal., Clin Ophthalmol. 2008 Dec;2(4):743-52.
15.
The p38 kinases MKK4 and MKK6 suppress metastatic colonization in human ovarian carcinoma.
Hickson JA, etal., Cancer Res. 2006 Feb 15;66(4):2264-70.
16.
Genetic variation in the TNF/TRAF2/ASK1/p38 kinase signaling pathway as markers for postoperative pulmonary complications in lung cancer patients.
Hildebrandt MA, etal., Sci Rep. 2015 Jul 13;5:12068. doi: 10.1038/srep12068.
17.
Overexpression of mitogen-activated protein kinase kinase 4 and nuclear factor-kappaB in laryngeal squamous cell carcinoma: a potential indicator for poor prognosis.
Huang C, etal., Oncol Rep. 2009 Jul;22(1):89-95.
18.
[The relationship between expression of mitogen-activated protein kinase kinase 4 and metastasis in oral squamous cell carcinoma].
Jiang N, etal., Hua Xi Kou Qiang Yi Xue Za Zhi. 2011 Oct;29(5):555-8.
19.
The c-jun kinase/stress-activated pathway: regulation, function and role in human disease.
Johnson GL and Nakamura K, Biochim Biophys Acta. 2007 Aug;1773(8):1341-8. Epub 2007 Jan 4.
20.
Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
Jones S, etal., Science. 2008 Sep 26;321(5897):1801-6. Epub 2008 Sep 4.
21.
Mitogen-activated protein kinase kinase 4 metastasis suppressor gene expression is inversely related to histological pattern in advancing human prostatic cancers.
Kim HL, etal., Cancer Res. 2001 Apr 1;61(7):2833-7.
22.
High-density single nucleotide polymorphism array defines novel stage and location-dependent allelic imbalances in human bladder tumors.
Koed K, etal., Cancer Res. 2005 Jan 1;65(1):34-45.
23.
7,3',4'-Trihydroxyisoflavone, a metabolite of the soy isoflavone daidzein, suppresses ultraviolet B-induced skin cancer by targeting Cot and MKK4.
Lee DE, etal., J Biol Chem. 2011 Apr 22;286(16):14246-56. doi: 10.1074/jbc.M110.147348. Epub 2011 Mar 4.
24.
Inhibition of oncogenic K-ras signaling by aerosolized gene delivery in a mouse model of human lung cancer.
Lee HY, etal., Clin Cancer Res. 2002 Sep;8(9):2970-5.
25.
Curcumin induced human gastric cancer BGC-823 cells apoptosis by ROS-mediated ASK1-MKK4-JNK stress signaling pathway.
Liang T, etal., Int J Mol Sci. 2014 Sep 5;15(9):15754-65. doi: 10.3390/ijms150915754.
26.
A functional variant (-1304T>G) in the MKK4 promoter contributes to a decreased risk of lung cancer by increasing the promoter activity.
Liu B, etal., Carcinogenesis. 2010 Aug;31(8):1405-11. doi: 10.1093/carcin/bgq126. Epub 2010 Jun 16.
27.
Up-regulation of MKK4, MKK6 and MKK7 during prostate cancer progression: an important role for SAPK signalling in prostatic neoplasia.
Lotan TL, etal., J Pathol. 2007 Aug;212(4):386-94.
28.
[Association between MKK4 promoter-1304T/G polymorphism and genetic susceptibility in sporadic nasopharyngeal carcinoma].
Lu M, etal., Lin Chung Er Bi Yan Hou Tou Jing Wai Ke Za Zhi. 2016 Feb;30(4):287-90.
29.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
30.
A novel mechanism of JNK1 activation. Nuclear translocation and activation of JNK1 during ischemia and reperfusion.
Mizukami Y, etal., J Biol Chem. 1997 Jun 27;272(26):16657-62.
31.
Evidence for multiple activators for stress-activated protein kinase/c-Jun amino-terminal kinases. Existence of novel activators.
Moriguchi T, etal., J Biol Chem. 1995 Jun 2;270(22):12969-72.
32.
Homozygous deletion of MKK4 in ovarian serous carcinoma.
Nakayama K, etal., Cancer Biol Ther. 2006 Jun;5(6):630-4. Epub 2006 Jun 9.
33.
Role of MAP kinases and their cross-talk in TGF-beta1-induced apoptosis in FaO rat hepatoma cell line.
Park HJ, etal., Hepatology. 2002 Jun;35(6):1360-71.
34.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
35.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
36.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
37.
GOA pipeline
RGD automated data pipeline
38.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
39.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
40.
The Similar Effects of miR-512-3p and miR-519a-2-5p on the Promotion of Hepatocellular Carcinoma: Different Tunes Sung With Equal Skill.
Rui T, etal., Front Oncol. 2020 Aug 7;10:1244. doi: 10.3389/fonc.2020.01244. eCollection 2020.
41.
Reduced metastasis-suppressor gene mRNA-expression in breast cancer brain metastases.
Stark AM, etal., J Cancer Res Clin Oncol. 2005 Mar;131(3):191-8. Epub 2004 Dec 8.
42.
Increased adipose tissue expression of proinflammatory CD40, MKK4 and JNK in patients with very severe chronic obstructive pulmonary disease.
Tkacova R, etal., Respiration. 2011;81(5):386-93. Epub 2010 Aug 12.
43.
Suppression of metastatic colonization by the context-dependent activation of the c-Jun NH2-terminal kinase kinases JNKK1/MKK4 and MKK7.
Vander Griend DJ, etal., Cancer Res. 2005 Dec 1;65(23):10984-91.
44.
Inhibition of MLK3-MKK4/7-JNK1/2 pathway by Akt1 in exogenous estrogen-induced neuroprotection against transient global cerebral ischemia by a non-genomic mechanism in male rats.
Wang R, etal., J Neurochem. 2006 Dec;99(6):1543-54. Epub 2006 Oct 25.
45.
Association of genetic variation in mitotic kinases with breast cancer risk.
Wang X, etal., Breast Cancer Res Treat. 2010 Jan;119(2):453-62. doi: 10.1007/s10549-009-0404-3. Epub 2009 Apr 30.
46.
The association between -1304T>G polymorphism in the promoter of MKK4 gene and the risk of sporadic colorectal cancer in southern Chinese population.
Wei Y, etal., Int J Cancer. 2009 Oct 15;125(8):1876-83. doi: 10.1002/ijc.24575.
47.
Human gastric cancer kinase profile and prognostic significance of MKK4 kinase.
Wu CW, etal., Am J Pathol. 2000 Jun;156(6):2007-15. doi: 10.1016/s0002-9440(10)65073-0.
48.
MicroRNA-802 plays a tumour suppressive role in tongue squamous cell carcinoma through directly targeting MAP2K4.
Wu X, etal., Cell Prolif. 2017 Jun;50(3). doi: 10.1111/cpr.12336. Epub 2017 Mar 20.
49.
POSH acts as a scaffold for a multiprotein complex that mediates JNK activation in apoptosis.
Xu Z, etal., EMBO J. 2003 Jan 15;22(2):252-61.
50.
Biphasic activation of apoptosis signal-regulating kinase 1-stress-activated protein kinase 1-c-Jun N-terminal protein kinase pathway is selectively mediated by Ca2+-permeable alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionate receptors involving oxidative stress following brain ischemia in rat hippocampus.
Zhang Q, etal., Neurosci Lett. 2003 Jan 30;337(1):51-5.
51.
Blockade of the translocation and activation of mitogen-activated protein kinase kinase 4 (MKK4) signaling attenuates neuronal damage during later ischemia-reperfusion.
Zhang QX, etal., J Neurochem. 2006 Jul;98(1):170-9.
52.
The protective role of polymorphism MKK4-1304 T>G in nasopharyngeal carcinoma is modulated by Epstein-Barr virus' infection status.
Zheng J, etal., Int J Cancer. 2012 May 1;130(9):1981-90. doi: 10.1002/ijc.26253. Epub 2011 Aug 25.
53.
Mitogen-activated protein kinase kinase 4 deficiency in cardiomyocytes causes connexin 43 reduction and couples hypertrophic signals to ventricular arrhythmogenesis.
Zi M, etal., J Biol Chem. 2011 May 20;286(20):17821-30. doi: 10.1074/jbc.M111.228791. Epub 2011 Mar 28.
Map2k4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 50,842,348 - 50,947,063 (-) NCBI GRCr8 mRatBN7.2 10 50,343,227 - 50,447,956 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 50,344,915 - 50,447,993 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 55,014,269 - 55,116,147 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 54,504,259 - 54,606,140 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 50,012,148 - 50,114,010 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 52,196,121 - 52,301,887 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 52,196,124 - 52,290,657 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 51,951,707 - 52,054,098 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 52,009,149 - 52,041,599 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 52,020,408 - 52,055,249 (-) NCBI Celera 10 49,553,065 - 49,624,419 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
MAP2K4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 12,020,877 - 12,143,828 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 12,020,829 - 12,143,830 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 11,924,194 - 12,047,145 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 11,864,860 - 11,987,776 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 11,864,859 - 11,987,775 NCBI Celera 17 11,954,698 - 12,077,624 (+) NCBI Celera Cytogenetic Map 17 p12 ENTREZGENE HuRef 17 11,825,033 - 11,947,931 (+) NCBI HuRef CHM1_1 17 11,933,251 - 12,056,267 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 11,928,859 - 12,051,837 (+) NCBI T2T-CHM13v2.0
Map2k4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 65,579,070 - 65,679,185 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 65,579,069 - 65,679,123 (-) Ensembl GRCm39 Ensembl GRCm38 11 65,688,244 - 65,788,359 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 65,688,243 - 65,788,297 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 65,501,746 - 65,601,799 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 65,504,439 - 65,604,492 (-) NCBI MGSCv36 mm8 Celera 11 72,623,125 - 72,726,188 (-) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 40.53 NCBI
Map2k4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 5,187,356 - 5,307,692 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 5,188,036 - 5,295,570 (-) NCBI ChiLan1.0 ChiLan1.0
MAP2K4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 61,596,659 - 61,721,974 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 66,403,318 - 66,528,369 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 39,497,105 - 39,622,331 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 44,246,301 - 44,359,906 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 44,248,857 - 44,359,909 (-) Ensembl panpan1.1 panPan2
MAP2K4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 36,142,610 - 36,243,673 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 36,118,388 - 36,241,296 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 36,246,628 - 36,382,182 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 36,216,260 - 36,351,866 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 36,216,250 - 36,351,818 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 36,183,407 - 36,318,935 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 36,137,113 - 36,272,679 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 36,321,228 - 36,456,796 (+) NCBI UU_Cfam_GSD_1.0
Map2k4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 51,288,135 - 51,356,168 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936595 4,727,108 - 4,830,662 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936595 4,762,327 - 4,828,433 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAP2K4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 56,402,075 - 56,516,238 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 56,402,029 - 56,516,217 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 59,330,511 - 59,409,571 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP2K4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 11,366,610 - 11,485,411 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 11,366,751 - 11,486,125 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 9,768,762 - 9,889,281 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map2k4
.
Predicted Target Of
Count of predictions: 37 Count of miRNA genes: 34 Interacting mature miRNAs: 37 Transcripts: ENSRNOT00000005293 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
U18310
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 50,844,455 - 50,844,632 (+) Marker Load Pipeline mRatBN7.2 10 50,345,335 - 50,345,513 (+) MAPPER mRatBN7.2 Rnor_6.0 10 52,195,865 - 52,196,042 NCBI Rnor6.0 Rnor_5.0 10 51,951,451 - 51,951,628 UniSTS Rnor5.0 RGSC_v3.4 10 52,008,893 - 52,009,070 UniSTS RGSC3.4 Celera 10 49,552,809 - 49,552,986 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005293 ⟹ ENSRNOP00000005293
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 50,344,915 - 50,417,289 (-) Ensembl Rnor_6.0 Ensembl 10 52,196,124 - 52,290,657 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109134 ⟹ ENSRNOP00000081371
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 50,344,915 - 50,447,932 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112493 ⟹ ENSRNOP00000095727
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 50,344,915 - 50,447,993 (-) Ensembl
RefSeq Acc Id:
NM_001030023 ⟹ NP_001025194
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 50,844,034 - 50,947,039 (-) NCBI mRatBN7.2 10 50,344,915 - 50,447,932 (-) NCBI Rnor_6.0 10 52,196,121 - 52,301,887 (-) NCBI Rnor_5.0 10 51,951,707 - 52,054,098 (-) NCBI RGSC_v3.4 10 52,009,149 - 52,041,599 (-) RGD Celera 10 49,553,065 - 49,624,419 (-) RGD
Sequence:
ATGGCGGCTCCGAGCCCGAGCGGCGGCGGCGGCTCCGGGGGCGGTGGCGGCACCCCGGGGCCCATCGGGCCTCCAGCTTCTGGCCACCCGGCGGTCAGCAGCATGCAGGGTAAACGCAAAGCCCTGAA
hide sequence
RefSeq Acc Id:
XM_039085426 ⟹ XP_038941354
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 50,842,348 - 50,947,063 (-) NCBI mRatBN7.2 10 50,343,227 - 50,447,956 (-) NCBI
RefSeq Acc Id:
XM_063268626 ⟹ XP_063124696
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 50,842,348 - 50,947,061 (-) NCBI
RefSeq Acc Id:
XM_063268627 ⟹ XP_063124697
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 50,842,348 - 50,947,060 (-) NCBI
RefSeq Acc Id:
XM_063268628 ⟹ XP_063124698
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 50,842,348 - 50,916,010 (-) NCBI
RefSeq Acc Id:
XM_063268629 ⟹ XP_063124699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 50,842,348 - 50,916,174 (-) NCBI
RefSeq Acc Id:
NP_001025194 ⟸ NM_001030023
- UniProtKB:
Q4KSH6 (UniProtKB/TrEMBL), F1LP57 (UniProtKB/TrEMBL)
- Sequence:
MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLNFANPPVKSTARFTLNPNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000005293 ⟸ ENSRNOT00000005293
RefSeq Acc Id:
XP_038941354 ⟸ XM_039085426
- Peptide Label:
isoform X3
- UniProtKB:
S4VP54 (UniProtKB/TrEMBL), F1LP57 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000081371 ⟸ ENSRNOT00000109134
Ensembl Acc Id:
ENSRNOP00000095727 ⟸ ENSRNOT00000112493
RefSeq Acc Id:
XP_063124696 ⟸ XM_063268626
- Peptide Label:
isoform X1
- UniProtKB:
F1LP57 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124697 ⟸ XM_063268627
- Peptide Label:
isoform X2
- UniProtKB:
F1LP57 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124699 ⟸ XM_063268629
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063124698 ⟸ XM_063268628
- Peptide Label:
isoform X4
- UniProtKB:
F1LP57 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Map2k4
mitogen activated protein kinase kinase 4
Map2k4_predicted
mitogen activated protein kinase kinase 4 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Map2k4_predicted
mitogen activated protein kinase kinase 4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
