Advanced Search (OLGA)

Gene: Pgls (6-phosphogluconolactonase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pgls

Name:

6-phosphogluconolactonase

RGD ID:

1307001

Description:

Enables 6-phosphogluconolactonase activity and monosaccharide binding activity. Involved in pentose-phosphate shunt, oxidative branch. Predicted to be active in cytosol. Orthologous to human PGLS (6-phosphogluconolactonase); PARTICIPATES IN pentose phosphate pathway - oxidative phase; pentose phosphate pathway; ribose 5-phosphate isomerase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

6PGL; LOC290636

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PGLS (6-phosphogluconolactonase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PGLS (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PGLS (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PGLS (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PGLS (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pgls (6-phosphogluconolactonase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PGLS (6-phosphogluconolactonase)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pgls (6-phosphogluconolactonase)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pgls (6-phosphogluconolactonase)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17333	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SOL1	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SOL2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SOL3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SOL4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y57G11C.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pgls	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	18,334,299 - 18,339,785 (+)	NCBI		GRCr8
mRatBN7.2	16	18,300,317 - 18,305,803 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,300,317 - 18,305,803 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	18,351,215 - 18,356,701 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	19,483,253 - 19,488,771 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,404,153 - 18,409,639 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,020,444 - 20,025,930 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,020,444 - 20,025,930 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	19,880,872 - 19,886,358 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	18,791,241 - 18,796,727 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	18,792,185 - 18,796,720 (+)	NCBI
Celera	16	18,504,223 - 18,509,709 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgls	Rat	osteoporosis		ISO	PGLS (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18924182

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgls	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PGLS mRNA]	CTD	PMID:31150632
Pgls	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Pgls (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGLS mRNA	CTD	PMID:36331819
Pgls	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Pgls (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PGLS mRNA	CTD	PMID:22206623
Pgls	Rat	17beta-estradiol	affects expression	EXP		6480464	Estradiol affects the expression of PGLS mRNA	CTD	PMID:32145629
Pgls	Rat	17beta-estradiol	increases expression	ISO	Pgls (Mus musculus)	6480464	Estradiol results in increased expression of PGLS mRNA	CTD	PMID:39298647
Pgls	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Pgls (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of PGLS mRNA	CTD	PMID:19465110
Pgls	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PGLS mRNA	CTD	PMID:33387578
Pgls	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PGLS mRNA	CTD	PMID:32109520
Pgls	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of PGLS protein	CTD	PMID:38598786
Pgls	Rat	2-bromohexadecanoic acid	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PGLS protein]	CTD	PMID:38195004
Pgls	Rat	2-butoxyethanol	decreases expression	ISO	Pgls (Mus musculus)	6480464	n-butoxyethanol results in decreased expression of PGLS mRNA	CTD	PMID:19812364
Pgls	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	PGLS (Homo sapiens)	6480464	bisphenol S results in increased expression of PGLS mRNA and bisphenol S results in increased expression of PGLS protein	CTD	PMID:31121516 and PMID:34186270
Pgls	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PGLS mRNA	CTD	PMID:36041667
Pgls	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Pgls (Mus musculus)	6480464	bisphenol S results in increased expression of PGLS mRNA	CTD	PMID:39298647
Pgls	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of PGLS mRNA	CTD	PMID:31881176
Pgls	Rat	actinomycin D	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of PGLS protein	CTD	PMID:38460933
Pgls	Rat	aflatoxin B1	decreases methylation	ISO	PGLS (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of PGLS intron	CTD	PMID:30157460
Pgls	Rat	aflatoxin B1	increases expression	ISO	Pgls (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of PGLS mRNA	CTD	PMID:19770486
Pgls	Rat	arsane	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PGLS mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PGLS mRNA	CTD	PMID:39836092
Pgls	Rat	arsenic atom	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PGLS mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PGLS mRNA	CTD	PMID:39836092
Pgls	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Pgls (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of PGLS mRNA	CTD	PMID:19850644
Pgls	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Pgls (Mus musculus)	6480464	PPARA protein inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PGLS mRNA]	CTD	PMID:19850644
Pgls	Rat	bisphenol A	increases expression	ISO	PGLS (Homo sapiens)	6480464	bisphenol A results in increased expression of PGLS mRNA and bisphenol A results in increased expression of PGLS protein	CTD	PMID:25047013 more ...
Pgls	Rat	bisphenol A	decreases expression	ISO	Pgls (Mus musculus)	6480464	bisphenol A results in decreased expression of PGLS protein	CTD	PMID:35999755
Pgls	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PGLS mRNA	CTD	PMID:36041667
Pgls	Rat	bisphenol A	increases expression	ISO	Pgls (Mus musculus)	6480464	bisphenol A results in increased expression of PGLS mRNA	CTD	PMID:33221593
Pgls	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of PGLS mRNA	CTD	PMID:32145629
Pgls	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PGLS mRNA	CTD	PMID:25181051
Pgls	Rat	bisphenol AF	increases expression	ISO	PGLS (Homo sapiens)	6480464	bisphenol AF results in increased expression of PGLS protein	CTD	PMID:34186270
Pgls	Rat	bisphenol F	increases expression	ISO	PGLS (Homo sapiens)	6480464	bisphenol F results in increased expression of PGLS mRNA and bisphenol F results in increased expression of PGLS protein	CTD	PMID:31121516 and PMID:34186270
Pgls	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PGLS mRNA	CTD	PMID:36041667
Pgls	Rat	butan-1-ol	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PGLS mRNA	CTD	PMID:29432896
Pgls	Rat	cadmium atom	increases expression	ISO	PGLS (Homo sapiens)	6480464	Cadmium results in increased expression of PGLS mRNA	CTD	PMID:24376830
Pgls	Rat	cadmium atom	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PGLS protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PGLS protein	CTD	PMID:38195004
Pgls	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of PGLS promoter	CTD	PMID:22457795
Pgls	Rat	cadmium dichloride	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PGLS protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PGLS protein	CTD	PMID:38195004
Pgls	Rat	cadmium dichloride	increases expression	ISO	PGLS (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of PGLS protein	CTD	PMID:24527689
Pgls	Rat	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of PGLS mRNA	CTD	PMID:18668222
Pgls	Rat	chlorpyrifos	increases expression	ISO	Pgls (Mus musculus)	6480464	Chlorpyrifos results in increased expression of PGLS mRNA	CTD	PMID:37019170
Pgls	Rat	choline	multiple interactions	ISO	Pgls (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PGLS gene	CTD	PMID:20938992
Pgls	Rat	cisplatin	increases expression	ISO	PGLS (Homo sapiens)	6480464	Cisplatin results in increased expression of PGLS mRNA	CTD	PMID:27594783
Pgls	Rat	clofibrate	decreases expression	ISO	Pgls (Mus musculus)	6480464	Clofibrate results in decreased expression of PGLS mRNA	CTD	PMID:17585979
Pgls	Rat	crocidolite asbestos	increases expression	ISO	PGLS (Homo sapiens)	6480464	Asbestos and Crocidolite results in increased expression of PGLS mRNA	CTD	PMID:29523930
Pgls	Rat	crocidolite asbestos	increases expression	ISO	Pgls (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of PGLS mRNA	CTD	PMID:29279043
Pgls	Rat	cyclosporin A	increases expression	ISO	PGLS (Homo sapiens)	6480464	Cyclosporine results in increased expression of PGLS mRNA	CTD	PMID:20106945 and PMID:22147139
Pgls	Rat	DDE	decreases expression	ISO	PGLS (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of PGLS mRNA	CTD	PMID:38568856
Pgls	Rat	dextran sulfate	decreases expression	ISO	Pgls (Mus musculus)	6480464	Dextran Sulfate results in decreased expression of PGLS protein	CTD	PMID:35999755
Pgls	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of PGLS mRNA	CTD	PMID:21266533
Pgls	Rat	dioxygen	increases expression	ISO	Pgls (Mus musculus)	6480464	Oxygen deficiency results in increased expression of PGLS mRNA	CTD	PMID:24205000
Pgls	Rat	diquat	increases expression	ISO	Pgls (Mus musculus)	6480464	Diquat results in increased expression of PGLS mRNA	CTD	PMID:36851058
Pgls	Rat	doxorubicin	decreases expression	ISO	PGLS (Homo sapiens)	6480464	Doxorubicin results in decreased expression of PGLS mRNA	CTD	PMID:29803840
Pgls	Rat	enzyme inhibitor	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PGLS protein	CTD	PMID:23301498
Pgls	Rat	ethanol	increases expression	ISO	PGLS (Homo sapiens)	6480464	Ethanol results in increased expression of PGLS protein	CTD	PMID:20621659
Pgls	Rat	ethanol	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PGLS mRNA	CTD	PMID:29432896
Pgls	Rat	fenthion	decreases expression	ISO	Pgls (Mus musculus)	6480464	Fenthion results in decreased expression of PGLS mRNA	CTD	PMID:34813904
Pgls	Rat	folic acid	multiple interactions	ISO	Pgls (Mus musculus)	6480464	[1 more ...	CTD	PMID:20938992 and PMID:22206623
Pgls	Rat	folic acid	decreases expression	ISO	Pgls (Mus musculus)	6480464	Folic Acid results in decreased expression of PGLS mRNA	CTD	PMID:25629700
Pgls	Rat	furfural	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PGLS protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of PGLS protein	CTD	PMID:38598786
Pgls	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of PGLS mRNA	CTD	PMID:33387578
Pgls	Rat	hyaluronic acid	multiple interactions	EXP		6480464	Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of PGLS protein]	CTD	PMID:23178681
Pgls	Rat	hydrogen peroxide	affects expression	ISO	PGLS (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of PGLS mRNA	CTD	PMID:20044591
Pgls	Rat	hydrogen peroxide	multiple interactions	EXP		6480464	Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of PGLS protein]	CTD	PMID:23178681
Pgls	Rat	hydrogen peroxide	decreases expression	EXP		6480464	Hydrogen Peroxide results in decreased expression of PGLS protein	CTD	PMID:23178681
Pgls	Rat	hydroquinone	affects expression	ISO	PGLS (Homo sapiens)	6480464	hydroquinone affects the expression of PGLS protein	CTD	PMID:17181942
Pgls	Rat	inulin	multiple interactions	ISO	Pgls (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PGLS mRNA	CTD	PMID:36331819
Pgls	Rat	ivermectin	decreases expression	ISO	PGLS (Homo sapiens)	6480464	Ivermectin results in decreased expression of PGLS protein	CTD	PMID:32959892
Pgls	Rat	L-methionine	multiple interactions	ISO	Pgls (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PGLS gene	CTD	PMID:20938992
Pgls	Rat	manganese atom	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PGLS mRNA	CTD	PMID:39836092
Pgls	Rat	manganese(0)	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PGLS mRNA	CTD	PMID:39836092
Pgls	Rat	manganese(II) chloride	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PGLS mRNA	CTD	PMID:39836092
Pgls	Rat	methidathion	decreases expression	ISO	Pgls (Mus musculus)	6480464	methidathion results in decreased expression of PGLS mRNA	CTD	PMID:34813904
Pgls	Rat	methylmercury chloride	decreases expression	ISO	PGLS (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of PGLS mRNA	CTD	PMID:28001369
Pgls	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	PGLS (Homo sapiens)	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of PGLS mRNA	CTD	PMID:38685446
Pgls	Rat	N-nitrosomorpholine	increases expression	EXP		6480464	N-nitrosomorpholine results in increased expression of PGLS protein	CTD	PMID:19716841
Pgls	Rat	Nutlin-3	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of PGLS protein	CTD	PMID:38460933
Pgls	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Pgls (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGLS mRNA more ...	CTD	PMID:36331819
Pgls	Rat	pirinixic acid	increases expression	ISO	Pgls (Mus musculus)	6480464	pirinixic acid results in increased expression of PGLS mRNA	CTD	PMID:23811191
Pgls	Rat	piroxicam	increases expression	ISO	PGLS (Homo sapiens)	6480464	Piroxicam results in increased expression of PGLS mRNA	CTD	PMID:21858171
Pgls	Rat	SB 431542	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of PGLS protein	CTD	PMID:37664457
Pgls	Rat	sevoflurane	decreases expression	ISO	Pgls (Mus musculus)	6480464	Sevoflurane results in decreased expression of PGLS protein	CTD	PMID:35249202
Pgls	Rat	sodium arsenite	decreases expression	ISO	PGLS (Homo sapiens)	6480464	sodium arsenite results in decreased expression of PGLS mRNA	CTD	PMID:38568856
Pgls	Rat	sodium arsenite	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PGLS mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PGLS mRNA	CTD	PMID:39836092
Pgls	Rat	sodium chloride	multiple interactions	ISO	PGLS (Homo sapiens)	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PGLS protein more ...	CTD	PMID:38598786
Pgls	Rat	sodium fluoride	decreases expression	ISO	Pgls (Mus musculus)	6480464	Sodium Fluoride results in decreased expression of PGLS protein	CTD	PMID:28918527
Pgls	Rat	T-2 toxin	affects expression	EXP		6480464	T-2 Toxin affects the expression of PGLS protein	CTD	PMID:26141394
Pgls	Rat	T-2 toxin	increases expression	ISO	PGLS (Homo sapiens)	6480464	T-2 Toxin results in increased expression of PGLS protein	CTD	PMID:34581912
Pgls	Rat	temozolomide	increases expression	ISO	PGLS (Homo sapiens)	6480464	Temozolomide results in increased expression of PGLS mRNA	CTD	PMID:31758290
Pgls	Rat	tert-butyl hydroperoxide	decreases expression	ISO	PGLS (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of PGLS mRNA	CTD	PMID:15336504
Pgls	Rat	tetrachloromethane	affects expression	ISO	Pgls (Mus musculus)	6480464	Carbon Tetrachloride affects the expression of PGLS mRNA	CTD	PMID:17484886
Pgls	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of PGLS mRNA	CTD	PMID:31150632
Pgls	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PGLS mRNA]	CTD	PMID:31150632
Pgls	Rat	thapsigargin	decreases expression	ISO	Pgls (Mus musculus)	6480464	Thapsigargin results in decreased expression of PGLS protein	CTD	PMID:24648495
Pgls	Rat	thimerosal	decreases expression	ISO	PGLS (Homo sapiens)	6480464	Thimerosal results in decreased expression of PGLS mRNA	CTD	PMID:27188386
Pgls	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of PGLS mRNA	CTD	PMID:23411599
Pgls	Rat	titanium dioxide	decreases methylation	ISO	Pgls (Mus musculus)	6480464	titanium dioxide results in decreased methylation of PGLS gene and titanium dioxide results in decreased methylation of PGLS promoter	CTD	PMID:35295148
Pgls	Rat	trichloroethene	increases expression	ISO	Pgls (Mus musculus)	6480464	Trichloroethylene results in increased expression of PGLS mRNA	CTD	PMID:19448997
Pgls	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of PGLS mRNA	CTD	PMID:33387578
Pgls	Rat	triphenyl phosphate	affects expression	ISO	PGLS (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PGLS mRNA	CTD	PMID:37042841
Pgls	Rat	triptonide	decreases expression	ISO	Pgls (Mus musculus)	6480464	triptonide results in decreased expression of PGLS mRNA	CTD	PMID:33045310
Pgls	Rat	tungsten	increases expression	ISO	Pgls (Mus musculus)	6480464	Tungsten results in increased expression of PGLS mRNA	CTD	PMID:30912803
Pgls	Rat	tunicamycin	increases expression	ISO	PGLS (Homo sapiens)	6480464	Tunicamycin results in increased expression of PGLS mRNA	CTD	PMID:29453283
Pgls	Rat	valproic acid	increases methylation	ISO	PGLS (Homo sapiens)	6480464	Valproic Acid results in increased methylation of PGLS gene	CTD	PMID:29154799
Pgls	Rat	valproic acid	decreases expression	ISO	PGLS (Homo sapiens)	6480464	Valproic Acid results in decreased expression of PGLS mRNA	CTD	PMID:28001369 and PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgls	Rat	carbohydrate metabolic process	involved_in	IEA	InterPro:IPR005900 and InterPro:IPR006148	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgls	Rat	carbohydrate metabolic process	involved_in	IEA	UniRule:UR000101108	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Pgls	Rat	pentose-phosphate shunt	involved_in	IEA	UniPathway:UPA00115	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Pgls	Rat	pentose-phosphate shunt	involved_in	IEA	InterPro:IPR005900	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgls	Rat	pentose-phosphate shunt	involved_in	IEA	UniProtKB:O95336 and ensembl:ENSP00000252603	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pgls	Rat	pentose-phosphate shunt	involved_in	ISO	PGLS (Homo sapiens)	1624291	PMID:10518023	RGD	PMID:10518023
Pgls	Rat	pentose-phosphate shunt, oxidative branch	involved_in	IBA	FB:FBgn0030239 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgls	Rat	pentose-phosphate shunt, oxidative branch		IDA		2311501		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgls	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgls	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pgls	Rat	cytosol	is_active_in	IBA	PANTHER:PTN000114545 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgls	Rat	6-phosphogluconolactonase activity	enables	ISO	PGLS (Homo sapiens)	1624291	PMID:10518023 and PMID:11457850	RGD	PMID:10518023 and PMID:11457850
Pgls	Rat	6-phosphogluconolactonase activity		IDA		2311501		RGD
Pgls	Rat	6-phosphogluconolactonase activity	enables	IEA	RHEA:12556	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Pgls	Rat	6-phosphogluconolactonase activity	enables	IEA	UniProtKB:O95336 and ensembl:ENSP00000252603	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pgls	Rat	6-phosphogluconolactonase activity	enables	IEA	InterPro:IPR005900	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgls	Rat	6-phosphogluconolactonase activity	enables	IBA	FB:FBgn0030239 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgls	Rat	6-phosphogluconolactonase activity	enables	IEA	EC:3.1.1.31	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Pgls	Rat	6-phosphogluconolactonase activity	enables	IEA	UniRule:UR000101108	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Pgls	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgls	Rat	monosaccharide binding		IDA		2311501		RGD
Pgls	Rat	protein binding	enables	ISO	PGLS (Homo sapiens)	1624291	UniProtKB:Q13867 more ...	RGD	PMID:21044950 and PMID:32296183

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgls	Rat	pentose phosphate pathway - oxidative phase		IDA		2311501		RGD

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgls	Rat	pentose phosphate pathway		ISO	PGLS (Homo sapiens)	10402751		SMPDB	SMP:00031
Pgls	Rat	ribose 5-phosphate isomerase deficiency pathway		ISO	PGLS (Homo sapiens)	10402751		SMPDB	SMP:00519
Pgls	Rat	transaldolase deficiency pathway		ISO	PGLS (Homo sapiens)	10402751		SMPDB	SMP:00520

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgls	Rat	pentose phosphate pathway		IEA		6907045		KEGG	rno:00030

BioCyc Pathways

pentose phosphate pathway (oxidative branch) I

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Rat liver 6-phosphogluconolactonase: a low Km enzyme.	Schofield PJ and Sols A, Biochem Biophys Res Commun. 1976 Aug 23;71(4):1313-8.

PMID:10518023	PMID:19056867	PMID:23376485	PMID:23533145

Pgls
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	18,334,299 - 18,339,785 (+)	NCBI		GRCr8
mRatBN7.2	16	18,300,317 - 18,305,803 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,300,317 - 18,305,803 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	18,351,215 - 18,356,701 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	19,483,253 - 19,488,771 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,404,153 - 18,409,639 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,020,444 - 20,025,930 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,020,444 - 20,025,930 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	19,880,872 - 19,886,358 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	18,791,241 - 18,796,727 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	18,792,185 - 18,796,720 (+)	NCBI
Celera	16	18,504,223 - 18,509,709 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

PGLS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	17,511,649 - 17,521,288 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	17,511,636 - 17,521,288 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	17,622,458 - 17,632,097 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	17,483,432 - 17,493,097 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	17,483,431 - 17,493,095	NCBI
Celera	19	17,524,049 - 17,533,713 (+)	NCBI		Celera
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	17,187,513 - 17,197,177 (+)	NCBI		HuRef
CHM1_1	19	17,621,814 - 17,631,479 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	17,646,286 - 17,655,924 (+)	NCBI		T2T-CHM13v2.0

Pgls
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	72,044,828 - 72,048,911 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	72,044,820 - 72,053,736 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	71,592,184 - 71,596,267 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	71,592,176 - 71,601,092 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	74,116,083 - 74,120,166 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	74,521,173 - 74,525,256 (+)	NCBI		MGSCv36	mm8
Celera	8	74,106,490 - 74,110,576 (+)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.43	NCBI

Pgls
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955524	793,239 - 801,107 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955524	797,439 - 801,070 (-)	NCBI	ChiLan1.0	ChiLan1.0

PGLS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	22,377,115 - 22,391,692 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	21,388,521 - 21,398,262 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	16,998,851 - 17,008,558 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	17,971,544 - 17,980,431 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	17,971,544 - 17,980,431 (+)	Ensembl	panpan1.1		panPan2

PGLS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	45,293,970 - 45,301,074 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	45,294,008 - 45,301,038 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	45,207,544 - 45,214,627 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	45,780,537 - 45,787,620 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	45,780,575 - 45,787,605 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	45,017,038 - 45,024,121 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	45,427,118 - 45,434,200 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	45,703,163 - 45,710,245 (-)	NCBI		UU_Cfam_GSD_1.0

Pgls
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	203,864,866 - 203,873,259 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936596	3,413,890 - 3,422,484 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936596	3,414,003 - 3,422,467 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PGLS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	60,187,747 - 60,197,648 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	60,186,690 - 60,198,037 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	59,778,632 - 59,787,018 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PGLS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	15,997,865 - 16,006,137 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	15,997,806 - 16,006,805 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	3,417,737 - 3,426,225 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pgls
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624908	519,127 - 529,686 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624908	522,698 - 526,526 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pgls
31 total Variants

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
16	18795175	18795176	G	T	snv	SS/JrHsdMcwi (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	108
Count of miRNA genes:	95
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000024827
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15726433	21034895	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

BE099440

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	16	18,334,862 - 18,335,020 (+)	Marker Load Pipeline
mRatBN7.2	16	18,300,880 - 18,301,038 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,021,008 - 20,021,165	NCBI	Rnor6.0
Rnor_5.0	16	19,881,436 - 19,881,593	UniSTS	Rnor5.0
RGSC_v3.4	16	18,791,805 - 18,791,962	UniSTS	RGSC3.4
Celera	16	18,504,787 - 18,504,944	UniSTS
RH 3.4 Map	16	191.3	UniSTS
Cytogenetic Map	16	p14	UniSTS

RH131434

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	16	18,338,157 - 18,338,694 (+)	Marker Load Pipeline
mRatBN7.2	16	18,304,175 - 18,304,712 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,024,303 - 20,024,839	NCBI	Rnor6.0
Rnor_5.0	16	19,884,731 - 19,885,267	UniSTS	Rnor5.0
RGSC_v3.4	16	18,795,100 - 18,795,636	UniSTS	RGSC3.4
Celera	16	18,508,082 - 18,508,618	UniSTS
RH 3.4 Map	16	194.2	UniSTS
Cytogenetic Map	16	p14	UniSTS

RH132813

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	18,302,838 - 18,303,042 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,022,966 - 20,023,169	NCBI	Rnor6.0
Rnor_5.0	16	19,883,394 - 19,883,597	UniSTS	Rnor5.0
RGSC_v3.4	16	18,793,763 - 18,793,966	UniSTS	RGSC3.4
Celera	16	18,506,745 - 18,506,948	UniSTS
Cytogenetic Map	16	p14	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC122603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024827 ⟹ ENSRNOP00000024827

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,300,317 - 18,305,803 (+)	Ensembl
Rnor_6.0 Ensembl	16	20,020,444 - 20,025,930 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097675 ⟹ ENSRNOP00000080138

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,302,324 - 18,305,803 (+)	Ensembl

RefSeq Acc Id:

NM_001106066 ⟹ NP_001099536

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,334,299 - 18,339,785 (+)	NCBI
mRatBN7.2	16	18,300,317 - 18,305,803 (+)	NCBI
Rnor_6.0	16	20,020,444 - 20,025,930 (+)	NCBI
Rnor_5.0	16	19,880,872 - 19,886,358 (+)	NCBI
RGSC_v3.4	16	18,791,241 - 18,796,727 (+)	RGD
Celera	16	18,504,223 - 18,509,709 (+)	RGD

Sequence:

show sequence

GGCCTGAATGGGGGCACAAGCCTTTAATCCCAGCATTTGGGAAGCAGAAGCAGGCAGGTCTTTGTTTGAGGCCAGCCTACTCTACAGAGTGACTTCCAGAACAACCAGGGCCACAACAACAACAGTCA
CTCTTAAACAACAACAAAGTTCTTGCAGTGTTTCACAGTGTATAACTTGCTACTTGAAGCCATCCATGGGCACTCAAGGCTGTAGGTTTGGGATTAGGGTGCAGCCAATGATCCAGCCTGGACTTAGC
ATTCAGCAGGCCCTGGATTTAGTCCCAGCACAGTGACCGACTGCATTTTGGAGCTCTCCTGAGTTCGGGAGGGTGACACATTATCAGTCGTCTTTTGGGTGCAATGGCTCAGTGGTTAAGAGTACTCG
TTGGGCTTGCTTCCTTCCTTCCTTCCATGCAACGATCTAACTCAGACCCAGGGTCTCCTGGACTCTGCACACACTTGGCACAGAGATACTCATGCGGGAGAAACAGCCATGCTCATTGAAAAAAAATA
AATTAAGCAAAAATAAAGGAGTAAATTAAGAGAGAGGAACCAGAGGGGGTTTATTTGGGTCTTCATGGTGGAAGCAGCTGTCTGTCACCTTCTCACTGATCTACTTGGGTCAAGGCTCTTAACAGTCC
CAAAGTTTCCGTATGTGGGCCACTGGGAGCCACCTGTTGAAGCACATGAATGGGGGCAGTTTCACACCCAAATGCAGATGTTTTCAACTGTTGGGCAGCAGTTGTCCCGGGGAGTCCTCTTTCTGCTG
TGGGCAGCTGTGAGCGGAAGGCAGCGGAGTGTCACTGCATCCGCTTTCGTAACACAAAAAAAGGGGTGTCGGGGGGTTGGGGATTTGGCTCAGTGGTAGAGTGCTTGCCTAGCATGCGCAAGGCCCTG
GGTTCGGTCCCCAGCTCCGAAAAAAAAAAAAAAAGGGGTGTCGGGATAGGCGAATGTGGGGAGGGCCGTGCAGGCACAGGGACATCATAAGTGTGTGTGTATGACAAGAGTCCCACTGCTTAGCCCAA
TCTGGCCTCTAACTCGGGCTAGCCGCCTGCCTTTGCCACCTGAGGGCTAGCATGAGTGTAGGTCATCACGCCTGGCTTATTGACCTTATCACACTGCAGCTGGCGCACTCTGTGTGTCCAACCGCACC
CCGGAAACCCGCTACACCCTCAAGAGTGCAGGTGCATTCAGGTCACCTCAGCCCTCAAGTCGAGGAAGGACGATCAGGAGCGTGAAGCCAGCCGGAGCTACATGACTCCGTCTTAAAAAACTAAATAA
AATGCGAGAAATCGGTCCAGGAAGGCGTCCCCAGTTCAGGGAAGCACTGTGGATTGCCCGCCCACCACCCACCCCAAAACCCTGAGGCGCACTGTGGCTTCGCTTCATCTGCGCAACTGCACATGCGC
CTATGGCCTTGGCTCAAAGTGCTCGGACCCATGGCAGCTCGGCCGTCGCGCAGGCGCACTGGCGTACTGGCCTCTGCCCGGAGCGCTGTCGCCTCCCCGCCGCCATGGCCGCACCCGCGCCCGGTCTC
ATCTCGGTCTTCTCCAGCCCACAGGAGCTGGGCGCATCGCTGGCGCAGCTGGTGGCGCAGCGGGCCGCTAGCTGCTTGGAAGGGAACCGTGGCCGCTTCGCTCTTGGCCTGTCAGGCGGCAGCCTGGT
CTCCATGCTGGCCCGAGACCTACCCGCCGCCACTGCTCCCGCGGGGCCCGCCAGCTTTGCACGCTGGACGCTCGGCTTCTGTGACGAGCGCCTCGTGCCCTTCGACCACGCCGAAAGCACGTACGGCC
TCTACCGGACACACCTGCTCTCAAAGCTGCCCATCCCAGACAGCCAGGTCCTCACCATCGATCCCGCCCTACCTGTGGAGGACGCTGCAGAGGACTATGCCAGGAAACTGAGGCAGGCCTTCCAAGGA
GACACTGTCCCTGTGTTTGACCTGCTGATCCTGGGAGTGGGCCCTGACGGCCACACCTGTTCGCTCTTCCCTGGGCATCCCCTCCTCCAGGAGCGGGAGAAGATCGTGGCTCCCATTGGTGACTCCCC
AAAGCCACCACCGCAGAGGGTGACCCTTACACTCCCTGTGCTGAACGCAGCCCAAAGTGTCATATTCGTGGCCACAGGGGAAGGCAAGGCAGCTGTGCTGAAGCGCATCCTGGAGGACCAGGAGAGCG
CGCTGCCCGCCGCCATGGTGCAGCCGCGCACGGGCGCCCTCTGCTGGTTCCTGGACGAGGCAGCTGCACGGCTGCTGTCTGTGCCCTTCGAGAAGCATTCCACGTTATAGGGGCCGCACCACGCACGC
TGTGGGCACTTCGGGCCGCAGAGACTACGGGAGAGGACTACCTGCAGATTAAACAGCTTTGCTGGAACTCTG

hide sequence


Protein RefSeqs	NP_001099536	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL90770	(Get FASTA)	NCBI Sequence Viewer
	EDL90771	(Get FASTA)	NCBI Sequence Viewer
	EDL90772	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024827
GenBank Protein	P85971	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001099536 ⟸ NM_001106066

- UniProtKB:

P85971 (UniProtKB/Swiss-Prot), G3V8D5 (UniProtKB/TrEMBL), A6K9W6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALAQSARTHGSSAVAQAHWRTGLCPERCRLPAAMAAPAPGLISVFSSPQELGASLAQLVAQRAASCLEGNRGRFALGLSGGSLVSMLARDLPAATAPAGPASFARWTLGFCDERLVPFDHAESTYGL
YRTHLLSKLPIPDSQVLTIDPALPVEDAAEDYARKLRQAFQGDTVPVFDLLILGVGPDGHTCSLFPGHPLLQEREKIVAPIGDSPKPPPQRVTLTLPVLNAAQSVIFVATGEGKAAVLKRILEDQESA
LPAAMVQPRTGALCWFLDEAAARLLSVPFEKHSTL

hide sequence

Ensembl Acc Id:

ENSRNOP00000024827 ⟸ ENSRNOT00000024827

Ensembl Acc Id:

ENSRNOP00000080138 ⟸ ENSRNOT00000097675

Protein Domains

Glucosamine/galactosamine-6-phosphate isomerase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P85971-F1-model_v2	AlphaFold	P85971	1-257	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-11837	BioCyc
BioCyc Pathway	OXIDATIVEPENT-PWY [pentose phosphate pathway (oxidative branch) I]	BioCyc
BioCyc Pathway Image	OXIDATIVEPENT-PWY	BioCyc
Ensembl Genes	ENSRNOG00000018326	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000024827	ENTREZGENE
Gene3D-CATH	3.40.50.1360	UniProtKB/Swiss-Prot
InterPro	6-phosphogluconolactonase_DevB	UniProtKB/Swiss-Prot
	Glc/Gal-6P_isomerase	UniProtKB/Swiss-Prot
	NagB/RpiA_transferase-like	UniProtKB/Swiss-Prot
	PGLS	UniProtKB/Swiss-Prot
NCBI Gene	290636	ENTREZGENE
PANTHER	6-PHOSPHOGLUCONOLACTONASE	UniProtKB/Swiss-Prot
	PTHR11054	UniProtKB/Swiss-Prot
Pfam	Glucosamine_iso	UniProtKB/Swiss-Prot
PhenoGen	Pgls	PhenoGen
RatGTEx	ENSRNOG00000018326	RatGTEx
Superfamily-SCOP	SSF100950	UniProtKB/Swiss-Prot
UniProt	6PGL_RAT	UniProtKB/Swiss-Prot
	A0A8I5ZPY3_RAT	UniProtKB/TrEMBL
	A6K9W6	ENTREZGENE, UniProtKB/TrEMBL
	G3V8D5	ENTREZGENE, UniProtKB/TrEMBL
	P85971	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Pgls	6-phosphogluconolactonase	Pgls_predicted	6-phosphogluconolactonase (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Pgls_predicted	6-phosphogluconolactonase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways