Symbol:
Usp24
Name:
ubiquitin specific peptidase 24
RGD ID:
1306799
Description:
Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in regulation of protein stability. Predicted to be active in cytosol and nucleus. Orthologous to human USP24 (ubiquitin specific peptidase 24); INTERACTS WITH 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC313427; ubiquitin carboxyl-terminal hydrolase 24; ubiquitin specific protease 24
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 126,309,396 - 126,439,147 (+) NCBI GRCr8 mRatBN7.2 5 121,080,687 - 121,210,321 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 121,080,470 - 121,210,311 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 123,693,608 - 123,823,365 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 125,416,655 - 125,546,416 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 125,467,907 - 125,597,674 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 125,896,725 - 126,030,411 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 125,896,725 - 126,030,401 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 129,744,154 - 129,877,840 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 127,371,225 - 127,500,521 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 127,359,508 - 127,503,472 (+) NCBI Celera 5 119,830,602 - 119,960,008 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp24 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO USP24 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of USP24 mRNA CTD PMID:22079256 Usp24 Rat (1->4)-beta-D-glucan multiple interactions ISO Usp24 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP24 mRNA CTD PMID:36331819 Usp24 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of USP24 mRNA CTD PMID:27840820 Usp24 Rat 1,2-dimethylhydrazine increases expression ISO Usp24 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of USP24 mRNA CTD PMID:22206623 Usp24 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of USP24 mRNA CTD PMID:30723492 Usp24 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO USP24 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Usp24 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of USP24 mRNA CTD PMID:34747641 Usp24 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP24 mRNA CTD PMID:33387578 Usp24 Rat 2,4,6-tribromophenol decreases expression ISO USP24 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Usp24 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of USP24 mRNA CTD PMID:21346803 Usp24 Rat 2-methylcholine affects expression ISO USP24 (Homo sapiens) 6480464 beta-methylcholine affects the expression of USP24 mRNA CTD PMID:21179406 Usp24 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO USP24 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of USP24 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of USP24 mRNA CTD PMID:28628672 Usp24 Rat 4,4'-sulfonyldiphenol decreases expression ISO Usp24 (Mus musculus) 6480464 bisphenol S results in decreased expression of USP24 mRNA CTD PMID:39298647 Usp24 Rat 4,4'-sulfonyldiphenol increases expression ISO USP24 (Homo sapiens) 6480464 bisphenol S results in increased expression of USP24 protein CTD PMID:34186270 Usp24 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of USP24 mRNA CTD PMID:31881176 Usp24 Rat aflatoxin B1 increases expression ISO Usp24 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of USP24 mRNA CTD PMID:19770486 Usp24 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of USP24 mRNA CTD PMID:30779732 Usp24 Rat aristolochic acid A decreases expression ISO USP24 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP24 mRNA CTD PMID:33212167 Usp24 Rat arsane increases ubiquitination ISO USP24 (Homo sapiens) 6480464 Arsenic results in increased ubiquitination of USP24 protein CTD PMID:35994080 Usp24 Rat arsane multiple interactions ISO USP24 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of USP24 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of USP24 mRNA CTD PMID:39836092 Usp24 Rat arsenic atom increases ubiquitination ISO USP24 (Homo sapiens) 6480464 Arsenic results in increased ubiquitination of USP24 protein CTD PMID:35994080 Usp24 Rat arsenic atom multiple interactions ISO USP24 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of USP24 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of USP24 mRNA CTD PMID:39836092 Usp24 Rat auramine O increases expression ISO USP24 (Homo sapiens) 6480464 Benzophenoneidum results in increased expression of USP24 protein CTD PMID:28722353 Usp24 Rat benzo[a]pyrene increases methylation ISO Usp24 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of USP24 intron CTD PMID:27901495 Usp24 Rat benzo[a]pyrene decreases methylation ISO USP24 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of USP24 promoter CTD PMID:27901495 Usp24 Rat benzo[a]pyrene diol epoxide I decreases expression ISO USP24 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:26238291 Usp24 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Usp24 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of USP24 mRNA CTD PMID:33754040 Usp24 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP24 mRNA CTD PMID:25181051 Usp24 Rat bisphenol A increases expression ISO USP24 (Homo sapiens) 6480464 bisphenol A results in increased expression of USP24 protein CTD PMID:34186270 Usp24 Rat bisphenol A increases expression ISO Usp24 (Mus musculus) 6480464 bisphenol A results in increased expression of USP24 mRNA CTD PMID:35598803 Usp24 Rat bisphenol A decreases methylation ISO USP24 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of USP24 gene CTD PMID:31601247 Usp24 Rat bisphenol A decreases expression ISO USP24 (Homo sapiens) 6480464 bisphenol A results in decreased expression of USP24 protein CTD PMID:31675489 Usp24 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of USP24 mRNA CTD PMID:32145629 Usp24 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP24 mRNA CTD PMID:30816183 and PMID:32528016 Usp24 Rat bisphenol A multiple interactions ISO USP24 (Homo sapiens) 6480464 [[ginger extract results in increased abundance of Oils more ... CTD PMID:28628672 and PMID:33376534 Usp24 Rat bisphenol AF increases expression ISO USP24 (Homo sapiens) 6480464 bisphenol AF results in increased expression of USP24 protein CTD PMID:34186270 Usp24 Rat Bisphenol B increases expression ISO USP24 (Homo sapiens) 6480464 bisphenol B results in increased expression of USP24 protein CTD PMID:34186270 Usp24 Rat bisphenol F multiple interactions ISO USP24 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of USP24 mRNA CTD PMID:28628672 Usp24 Rat bisphenol F increases expression ISO USP24 (Homo sapiens) 6480464 bisphenol F results in increased expression of USP24 protein CTD PMID:34186270 Usp24 Rat butanal decreases expression ISO USP24 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of USP24 mRNA CTD PMID:26079696 Usp24 Rat cadmium atom multiple interactions ISO USP24 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP24 mRNA CTD PMID:35301059 Usp24 Rat cadmium dichloride multiple interactions ISO USP24 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP24 mRNA CTD PMID:35301059 Usp24 Rat cadmium sulfate multiple interactions ISO Usp24 (Mus musculus) 6480464 cadmium sulfate affects the reaction [MTF1 affects the expression of USP24 mRNA] CTD PMID:16221973 Usp24 Rat caffeine affects phosphorylation ISO USP24 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of USP24 protein CTD PMID:35688186 Usp24 Rat cefaloridine decreases expression EXP 6480464 Cephaloridine results in decreased expression of USP24 mRNA CTD PMID:18500788 Usp24 Rat CGP 52608 multiple interactions ISO USP24 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP24 gene] CTD PMID:28238834 Usp24 Rat cisplatin decreases expression ISO USP24 (Homo sapiens) 6480464 Cisplatin results in decreased expression of USP24 mRNA CTD PMID:27392435 and PMID:27594783 Usp24 Rat cyclosporin A increases expression ISO USP24 (Homo sapiens) 6480464 Cyclosporine results in increased expression of USP24 mRNA CTD PMID:20106945 Usp24 Rat decabromodiphenyl ether decreases expression ISO USP24 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of USP24 protein CTD PMID:31675489 Usp24 Rat deoxynivalenol increases phosphorylation ISO Usp24 (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of USP24 protein CTD PMID:23811945 Usp24 Rat dexamethasone multiple interactions ISO USP24 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of USP24 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of USP24 mRNA CTD PMID:28628672 Usp24 Rat ethanol decreases expression ISO Usp24 (Mus musculus) 6480464 Ethanol results in decreased expression of USP24 mRNA CTD PMID:29018328 Usp24 Rat ethyl methanesulfonate decreases expression ISO USP24 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of USP24 mRNA CTD PMID:23649840 Usp24 Rat fenthion decreases expression ISO Usp24 (Mus musculus) 6480464 Fenthion results in decreased expression of USP24 mRNA CTD PMID:34813904 Usp24 Rat FR900359 affects phosphorylation ISO USP24 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of USP24 protein CTD PMID:37730182 Usp24 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP24 mRNA CTD PMID:22061828 Usp24 Rat indometacin multiple interactions ISO USP24 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of USP24 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of USP24 mRNA CTD PMID:28628672 Usp24 Rat irinotecan decreases expression ISO USP24 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of USP24 mRNA CTD PMID:18927307 Usp24 Rat ivermectin decreases expression ISO USP24 (Homo sapiens) 6480464 Ivermectin results in decreased expression of USP24 protein CTD PMID:32959892 Usp24 Rat manganese atom multiple interactions ISO USP24 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of USP24 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of USP24 mRNA CTD PMID:39836092 Usp24 Rat manganese(0) multiple interactions ISO USP24 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of USP24 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of USP24 mRNA CTD PMID:39836092 Usp24 Rat manganese(II) chloride multiple interactions ISO USP24 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of USP24 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of USP24 mRNA CTD PMID:39836092 Usp24 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of USP24 mRNA CTD PMID:30467583 Usp24 Rat methidathion decreases expression ISO Usp24 (Mus musculus) 6480464 methidathion results in decreased expression of USP24 mRNA CTD PMID:34813904 Usp24 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO USP24 (Homo sapiens) 6480464 N more ... CTD PMID:12756304 Usp24 Rat nickel atom increases expression ISO USP24 (Homo sapiens) 6480464 Nickel results in increased expression of USP24 mRNA CTD PMID:25583101 Usp24 Rat nitrates multiple interactions ISO Usp24 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of USP24 mRNA CTD PMID:35964746 Usp24 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP24 mRNA CTD PMID:25729387 Usp24 Rat paracetamol decreases expression ISO USP24 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of USP24 mRNA CTD PMID:21420995 Usp24 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of USP24 mRNA CTD PMID:33387578 Usp24 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp24 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP24 mRNA CTD PMID:36331819 Usp24 Rat phlorizin decreases expression ISO Usp24 (Mus musculus) 6480464 Phlorhizin results in decreased expression of USP24 mRNA CTD PMID:22538082 Usp24 Rat potassium chromate decreases expression ISO USP24 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of USP24 mRNA CTD PMID:22079256 Usp24 Rat potassium chromate multiple interactions ISO USP24 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of USP24 mRNA CTD PMID:22079256 Usp24 Rat resveratrol multiple interactions ISO USP24 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of USP24 mRNA CTD PMID:23557933 Usp24 Rat sodium arsenite decreases expression ISO USP24 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of USP24 mRNA CTD PMID:38568856 Usp24 Rat sodium arsenite multiple interactions ISO USP24 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of USP24 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of USP24 mRNA CTD PMID:39836092 Usp24 Rat sodium fluoride increases expression ISO Usp24 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of USP24 mRNA CTD PMID:27862939 Usp24 Rat sunitinib increases expression ISO USP24 (Homo sapiens) 6480464 Sunitinib results in increased expression of USP24 mRNA CTD PMID:31533062 Usp24 Rat titanium dioxide decreases methylation ISO Usp24 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP24 promoter CTD PMID:35295148 Usp24 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP24 mRNA CTD PMID:25729387 Usp24 Rat trichostatin A increases expression ISO USP24 (Homo sapiens) 6480464 trichostatin A results in increased expression of USP24 mRNA CTD PMID:24935251 Usp24 Rat trichostatin A affects expression ISO USP24 (Homo sapiens) 6480464 trichostatin A affects the expression of USP24 mRNA CTD PMID:28542535 Usp24 Rat triphenyl phosphate affects expression ISO USP24 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP24 mRNA CTD PMID:37042841 Usp24 Rat triptonide decreases expression ISO Usp24 (Mus musculus) 6480464 triptonide results in decreased expression of USP24 mRNA CTD PMID:33045310 Usp24 Rat troglitazone decreases expression ISO Usp24 (Mus musculus) 6480464 troglitazone results in decreased expression of USP24 mRNA CTD PMID:28973697 Usp24 Rat tungsten decreases expression ISO Usp24 (Mus musculus) 6480464 Tungsten results in decreased expression of USP24 mRNA CTD PMID:30912803 Usp24 Rat valproic acid decreases expression ISO USP24 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of USP24 mRNA CTD PMID:23179753 and PMID:28001369 Usp24 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of USP24 mRNA CTD PMID:29427782 Usp24 Rat valproic acid affects expression ISO USP24 (Homo sapiens) 6480464 Valproic Acid affects the expression of USP24 mRNA CTD PMID:25979313 Usp24 Rat zoledronic acid decreases expression ISO USP24 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of USP24 mRNA CTD PMID:20977926
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-naphthyl isothiocyanate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) auramine O (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) caffeine (ISO) cefaloridine (EXP) CGP 52608 (ISO) cisplatin (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) dexamethasone (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenthion (ISO) FR900359 (ISO) gentamycin (EXP) indometacin (ISO) irinotecan (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (EXP) methidathion (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) nickel atom (ISO) nitrates (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phlorizin (ISO) potassium chromate (ISO) resveratrol (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sunitinib (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) valproic acid (EXP,ISO) zoledronic acid (ISO)
Usp24 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 126,309,396 - 126,439,147 (+) NCBI GRCr8 mRatBN7.2 5 121,080,687 - 121,210,321 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 121,080,470 - 121,210,311 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 123,693,608 - 123,823,365 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 125,416,655 - 125,546,416 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 125,467,907 - 125,597,674 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 125,896,725 - 126,030,411 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 125,896,725 - 126,030,401 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 129,744,154 - 129,877,840 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 127,371,225 - 127,500,521 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 127,359,508 - 127,503,472 (+) NCBI Celera 5 119,830,602 - 119,960,008 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
USP24 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 55,066,359 - 55,215,364 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 55,066,359 - 55,215,378 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 55,532,032 - 55,681,037 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 55,304,620 - 55,453,350 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 55,244,055 - 55,281,666 NCBI Celera 1 53,819,636 - 53,968,611 (-) NCBI Celera Cytogenetic Map 1 p32.3 NCBI HuRef 1 53,645,063 - 53,793,924 (-) NCBI HuRef CHM1_1 1 55,648,191 - 55,797,181 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 54,947,243 - 55,096,207 (-) NCBI T2T-CHM13v2.0
Usp24 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 106,173,179 - 106,303,798 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 106,173,417 - 106,298,519 (+) Ensembl GRCm39 Ensembl GRCm38 4 106,315,980 - 106,446,613 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 106,316,213 - 106,441,322 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 105,988,818 - 106,113,932 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 105,857,397 - 105,939,259 (+) NCBI MGSCv36 mm8 Celera 4 104,677,381 - 104,802,002 (+) NCBI Celera Cytogenetic Map 4 C7 NCBI cM Map 4 49.44 NCBI
Usp24 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 4,283,670 - 4,423,609 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 4,273,068 - 4,423,609 (+) NCBI ChiLan1.0 ChiLan1.0
USP24 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 171,611,601 - 171,760,384 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 170,752,451 - 170,901,077 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 54,349,948 - 54,498,131 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 55,937,971 - 56,085,535 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 55,940,657 - 56,050,660 (-) Ensembl panpan1.1 panPan2
USP24 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 54,086,685 - 54,192,761 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 54,086,685 - 54,190,164 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 54,123,557 - 54,260,293 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 54,242,138 - 54,378,967 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 54,242,153 - 54,376,683 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 54,188,016 - 54,376,151 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 54,129,031 - 54,266,109 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 54,517,506 - 54,654,531 (+) NCBI UU_Cfam_GSD_1.0
Usp24 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 69,145,867 - 69,280,464 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 6,160,680 - 6,267,804 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 6,135,830 - 6,270,414 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP24 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 157,220,403 - 157,385,055 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 157,220,521 - 157,385,329 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 145,317,981 - 145,450,656 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP24 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 77,745,214 - 77,892,109 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 77,782,527 - 77,892,203 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 39,403,052 - 39,551,237 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp24
.
Predicted Target Of
Count of predictions: 120 Count of miRNA genes: 85 Interacting mature miRNAs: 106 Transcripts: ENSRNOT00000029228 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 7794739 Bp372 Blood pressure QTL 372 0.0058 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 117913688 125222967 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1582230 Bw78 Body weight QTL 78 3.2 0.0016 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 119085612 128034027 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH126753
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 121,208,167 - 121,208,390 (+) MAPPER mRatBN7.2 Rnor_6.0 5 126,028,258 - 126,028,480 NCBI Rnor6.0 Rnor_5.0 5 129,875,687 - 129,875,909 UniSTS Rnor5.0 RGSC_v3.4 5 127,498,366 - 127,498,588 UniSTS RGSC3.4 Celera 5 119,957,855 - 119,958,077 UniSTS Cytogenetic Map 5 q34 UniSTS
RH130429
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 121,208,347 - 121,208,527 (+) MAPPER mRatBN7.2 Rnor_6.0 5 126,028,438 - 126,028,617 NCBI Rnor6.0 Rnor_5.0 5 129,875,867 - 129,876,046 UniSTS Rnor5.0 RGSC_v3.4 5 127,498,546 - 127,498,725 UniSTS RGSC3.4 Celera 5 119,958,035 - 119,958,214 UniSTS RH 3.4 Map 5 805.3 UniSTS Cytogenetic Map 5 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000029228 ⟹ ENSRNOP00000030696
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 121,080,470 - 121,210,311 (+) Ensembl Rnor_6.0 Ensembl 5 125,896,725 - 126,030,401 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105187 ⟹ ENSRNOP00000084967
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 121,106,912 - 121,210,311 (+) Ensembl
RefSeq Acc Id:
NM_001271206 ⟹ NP_001258135
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,309,597 - 126,439,145 (+) NCBI mRatBN7.2 5 121,080,762 - 121,210,321 (+) NCBI Rnor_6.0 5 125,896,725 - 126,030,411 (+) NCBI Rnor_5.0 5 129,744,154 - 129,877,840 (+) NCBI Celera 5 119,830,602 - 119,960,008 (+) NCBI
Sequence:
GAAGAGGAGGAGCAGGCCAACATGGCGGCGCGCAGGGCTGGGCCGGCCGGCCGCGCCTGAGCGCCCCACCACCCCAGCTCGGCTCGCGGCGCCCACGCGTGCACCTAACCCTGGCCCGGCGGCCGCCG
hide sequence
RefSeq Acc Id:
XM_006238511 ⟹ XP_006238573
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,309,396 - 126,439,147 (+) NCBI mRatBN7.2 5 121,080,687 - 121,210,320 (+) NCBI Rnor_6.0 5 125,896,925 - 126,030,410 (+) NCBI Rnor_5.0 5 129,744,154 - 129,877,840 (+) NCBI
Sequence:
CCAGGCCCGGGAGCCGCAGGTTCCCGGCACCCGGCCGGCCGGCTCCGAGGCCCGAGCCATGGAATCGGAGGAGGAGCAGCACATGACCACGCTGCTGTGCATGGGTTTCTCGGACCCGGCCACCATCC
hide sequence
RefSeq Acc Id:
XM_039109959 ⟹ XP_038965887
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,360,846 - 126,439,147 (+) NCBI mRatBN7.2 5 121,132,017 - 121,210,320 (+) NCBI
RefSeq Acc Id:
NP_001258135 ⟸ NM_001271206
- UniProtKB:
A0A8I6A2B7 (UniProtKB/TrEMBL)
- Sequence:
MESEEEQHMTTLLCMGFSDPATIRKALRLAKNDINEAVALLTNERPGLDYGGYEPMDSGGPSPGLGGGPRGDGGGEGSGPSRGGSTGGGGGFDPPPAYHEVVDAEKNDENGNCSGEGVEFPTTNLYEL
hide sequence
RefSeq Acc Id:
XP_006238573 ⟸ XM_006238511
- Peptide Label:
isoform X1
- UniProtKB:
F1LSM0 (UniProtKB/TrEMBL), A0A8I6A2B7 (UniProtKB/TrEMBL)
- Sequence:
MESEEEQHMTTLLCMGFSDPATIRKALRLAKNDINEAVALLTNERPGLDYGGYEPMDSGGPSPG
hide sequence
Ensembl Acc Id:
ENSRNOP00000030696 ⟸ ENSRNOT00000029228
RefSeq Acc Id:
XP_038965887 ⟸ XM_039109959
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000084967 ⟸ ENSRNOT00000105187
RGD ID: 13693876 Promoter ID: EPDNEW_R4401 Type: multiple initiation site Name: Usp24_1 Description: ubiquitin specific peptidase 24 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 125,896,732 - 125,896,792 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-26
Usp24
ubiquitin specific peptidase 24
Usp24
ubiquitin specific protease 24
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Usp24
ubiquitin specific protease 24
Usp24_predicted
ubiquitin specific protease 24 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Usp24_predicted
ubiquitin specific protease 24 (predicted)
Symbol and Name status set to approved
70820 APPROVED
