Symbol:
Bach1
Name:
BTB domain and CNC homolog 1
RGD ID:
1306693
Description:
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and ligand-modulated transcription factor activity. Predicted to be involved in DNA repair; negative regulation of transcription by RNA polymerase II; and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within regulation of DNA-templated transcription. Predicted to be located in nucleus. Predicted to be part of RNA polymerase II transcription regulator complex. Orthologous to human BACH1 (BTB domain and CNC homolog 1); INTERACTS WITH 17beta-estradiol; 4-amino-2,6-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BTB and CNC homology 1; BTB and CNC homology 1 transcription factor; BTB and CNC homology 1, basic leucine zipper transcription factor 1; LOC100911490; LOC103690154; LOC304127; transcription regulator protein BACH1; transcription regulator protein BACH1-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BACH1 (BTB domain and CNC homolog 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bach1 (BTB domain and CNC homolog 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BACH1 (BTB domain and CNC homolog 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BACH1 (BTB domain and CNC homolog 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bach1 (BTB domain and CNC homolog 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BACH1 (BTB domain and CNC homolog 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BACH1 (BTB domain and CNC homolog 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bach1 (BTB domain and CNC homolog 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
BACH1 (BTB domain and CNC homolog 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bach1b (BTB and CNC homology 1, basic leucine zipper transcription factor 1 b)
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Danio rerio (zebrafish):
bach1a (BTB and CNC homology 1, basic leucine zipper transcription factor 1 a)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
CG15725
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
bach1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 40,425,721 - 40,461,118 (+) NCBI GRCr8 mRatBN7.2 11 26,939,429 - 26,974,876 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 26,939,480 - 26,972,447 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 35,637,561 - 35,670,105 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 28,337,824 - 28,370,368 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 27,526,892 - 27,559,119 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 27,364,913 - 27,398,713 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 27,364,916 - 27,398,842 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 27,598,719 - 27,611,811 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 31,133,137 - 31,153,652 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 11 31,219,581 - 31,228,721 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 27,467,207 - 27,500,173 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 11 26,683,083 - 26,716,048 (+) NCBI Celera Cytogenetic Map 11 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bach1 Rat (-)-selegiline multiple interactions ISO BACH1 (Homo sapiens) 6480464 Selegiline inhibits the reaction [Smoke analog affects the localization of BACH1 protein] CTD PMID:28108387 Bach1 Rat (E)-cinnamyl alcohol multiple interactions ISO BACH1 (Homo sapiens) 6480464 BACH1 mRNA promotes the reaction [cinnamyl alcohol results in increased expression of HMOX1 mRNA] CTD PMID:26244607 Bach1 Rat 1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane multiple interactions ISO BACH1 (Homo sapiens) 6480464 2 and 2'-(hydroxynitrosohydrazono)bis-ethanamine inhibits the reaction [alpha-pyrrolidinononanophenone analog results in increased expression of BACH1 protein] CTD PMID:38040126 Bach1 Rat 1,2-dimethylhydrazine multiple interactions ISO Bach1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of BACH1 mRNA] CTD PMID:22206623 Bach1 Rat 1,2-dimethylhydrazine decreases expression ISO Bach1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of BACH1 mRNA CTD PMID:22206623 Bach1 Rat 1,4-benzoquinone multiple interactions ISO BACH1 (Homo sapiens) 6480464 quinone promotes the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased ubiquitination of BACH1 protein] CTD PMID:28645578 Bach1 Rat 1,4-benzoquinone affects localization ISO BACH1 (Homo sapiens) 6480464 quinone affects the localization of BACH1 protein CTD PMID:28645578 Bach1 Rat 1,4-phenylenediamine multiple interactions ISO BACH1 (Homo sapiens) 6480464 BACH1 mRNA promotes the reaction [4-phenylenediamine results in increased expression of HMOX1 mRNA] CTD PMID:26244607 Bach1 Rat 1-chloro-2,4-dinitrobenzene multiple interactions ISO BACH1 (Homo sapiens) 6480464 BACH1 mRNA promotes the reaction [Dinitrochlorobenzene results in increased expression of HMOX1 mRNA] CTD PMID:26244607 Bach1 Rat 17beta-estradiol decreases expression ISO BACH1 (Homo sapiens) 6480464 Estradiol results in decreased expression of BACH1 mRNA CTD PMID:33047385 Bach1 Rat 17beta-estradiol decreases expression ISO Bach1 (Mus musculus) 6480464 Estradiol results in decreased expression of BACH1 mRNA CTD PMID:39298647 Bach1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of BACH1 mRNA CTD PMID:32145629 Bach1 Rat 17beta-estradiol multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Arsenic co-treated with Estradiol] results in decreased expression of BACH1 mRNA CTD PMID:33047385 Bach1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Bach1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Bach1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bach1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BACH1 mRNA CTD PMID:19465110 more ... Bach1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bach1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BACH1 mRNA CTD PMID:21570461 and PMID:26377647 Bach1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO BACH1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BACH1 mRNA CTD PMID:17101203 Bach1 Rat 2-butoxyethanol increases expression ISO Bach1 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of BACH1 mRNA CTD PMID:19812364 Bach1 Rat 2-tert-butylhydroquinone affects localization ISO BACH1 (Homo sapiens) 6480464 2-tert-butylhydroquinone affects the localization of BACH1 protein CTD PMID:28645578 Bach1 Rat 2-tert-butylhydroquinone multiple interactions ISO BACH1 (Homo sapiens) 6480464 2-tert-butylhydroquinone promotes the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased ubiquitination of BACH1 protein] and [ferric chloride results in increased oxidation of 2-tert-butylhydroquinone] promotes the reaction [2-tert-butylhydroquinone analog binds to BACH1 protein] CTD PMID:28645578 Bach1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Bach1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of BACH1 mRNA CTD PMID:26251327 Bach1 Rat 3-phenylprop-2-enal multiple interactions ISO BACH1 (Homo sapiens) 6480464 BACH1 mRNA promotes the reaction [cinnamaldehyde results in increased expression of HMOX1 mRNA] CTD PMID:26244607 Bach1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Bach1 (Mus musculus) 6480464 bisphenol S results in decreased expression of BACH1 mRNA CTD PMID:39298647 Bach1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of BACH1 mRNA CTD PMID:21346803 Bach1 Rat 4-hydroxyphenyl retinamide increases expression ISO Bach1 (Mus musculus) 6480464 Fenretinide results in increased expression of BACH1 mRNA CTD PMID:28973697 Bach1 Rat acrolein multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BACH1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of BACH1 mRNA CTD PMID:32699268 Bach1 Rat acrylamide increases expression ISO BACH1 (Homo sapiens) 6480464 Acrylamide results in increased expression of BACH1 mRNA CTD PMID:32763439 Bach1 Rat aflatoxin B1 increases expression ISO Bach1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of BACH1 mRNA CTD PMID:19770486 Bach1 Rat aflatoxin B1 decreases methylation ISO BACH1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of BACH1 gene CTD PMID:27153756 Bach1 Rat all-trans-retinoic acid multiple interactions ISO BACH1 (Homo sapiens) 6480464 [alpha-pyrrolidinononanophenone analog co-treated with Tretinoin] results in increased expression of BACH1 protein CTD PMID:38040126 Bach1 Rat all-trans-retinoic acid increases expression ISO BACH1 (Homo sapiens) 6480464 Tretinoin results in increased expression of BACH1 mRNA CTD PMID:33167477 Bach1 Rat alpha-pinene multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BACH1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of BACH1 mRNA CTD PMID:32699268 Bach1 Rat aristolochic acid A decreases expression ISO BACH1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of BACH1 mRNA CTD PMID:33212167 Bach1 Rat arsane affects methylation ISO BACH1 (Homo sapiens) 6480464 Arsenic affects the methylation of BACH1 gene CTD PMID:25304211 Bach1 Rat arsane multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Arsenic co-treated with Estradiol] results in decreased expression of BACH1 mRNA more ... CTD PMID:33047385 and PMID:33434570 Bach1 Rat arsenic atom affects methylation ISO BACH1 (Homo sapiens) 6480464 Arsenic affects the methylation of BACH1 gene CTD PMID:25304211 Bach1 Rat arsenic atom multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Arsenic co-treated with Estradiol] results in decreased expression of BACH1 mRNA more ... CTD PMID:33047385 and PMID:33434570 Bach1 Rat arsenite(3-) multiple interactions ISO BACH1 (Homo sapiens) 6480464 [arsenite results in decreased localization of and results in decreased activity of BACH1 protein] which results in increased expression of HMOX1 protein more ... CTD PMID:18550526 and PMID:32406909 Bach1 Rat arsenous acid affects localization ISO BACH1 (Homo sapiens) 6480464 Arsenic Trioxide affects the localization of BACH1 protein CTD PMID:19350554 Bach1 Rat arsenous acid increases expression ISO BACH1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of BACH1 protein CTD PMID:29260515 Bach1 Rat arsenous acid multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Arsenic Trioxide results in increased abundance of Arsenic] which results in increased expression of and affects the localization of BACH1 protein more ... CTD PMID:19350554 more ... Bach1 Rat benzene-1,2,4-triol increases expression ISO BACH1 (Homo sapiens) 6480464 hydroxyhydroquinone results in increased expression of BACH1 mRNA CTD PMID:17572062 Bach1 Rat benzo[a]pyrene increases expression ISO Bach1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BACH1 mRNA CTD PMID:19770486 more ... Bach1 Rat benzo[a]pyrene diol epoxide I increases expression ISO BACH1 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Bach1 Rat bis(2-chloroethyl) sulfide increases expression ISO Bach1 (Mus musculus) 6480464 Mustard Gas results in increased expression of BACH1 mRNA CTD PMID:15674843 Bach1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BACH1 mRNA CTD PMID:25181051 and PMID:30816183 Bach1 Rat bisphenol A increases expression ISO Bach1 (Mus musculus) 6480464 bisphenol A results in increased expression of BACH1 mRNA CTD PMID:33221593 Bach1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of BACH1 mRNA CTD PMID:32145629 Bach1 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of BACH1 mRNA CTD PMID:32479839 Bach1 Rat cadmium atom decreases activity ISO Bach1 (Mus musculus) 6480464 Cadmium results in decreased activity of BACH1 protein CTD PMID:14504288 Bach1 Rat cadmium atom multiple interactions ISO Bach1 (Mus musculus) 6480464 Cadmium inhibits the reaction [BACH1 protein results in decreased expression of HMOX1 mRNA] more ... CTD PMID:14504288 Bach1 Rat cadmium dichloride multiple interactions ISO Bach1 (Mus musculus) 6480464 BACH1 gene mutant form promotes the reaction [Cadmium Chloride results in increased expression of HMOX1 mRNA] more ... CTD PMID:14504288 and PMID:18271013 Bach1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of BACH1 promoter CTD PMID:22457795 Bach1 Rat cadmium dichloride affects localization ISO Bach1 (Mus musculus) 6480464 Cadmium Chloride affects the localization of BACH1 protein CTD PMID:14504288 Bach1 Rat caffeine decreases phosphorylation ISO BACH1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of BACH1 protein CTD PMID:35688186 Bach1 Rat cannabidiol multiple interactions ISO Bach1 (Mus musculus) 6480464 [lipopolysaccharide and E coli O55-B5 co-treated with Cannabidiol] results in increased expression of BACH1 mRNA CTD PMID:30742662 Bach1 Rat cannabidiol decreases expression ISO BACH1 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of BACH1 protein CTD PMID:31518892 Bach1 Rat cannabidiol multiple interactions ISO BACH1 (Homo sapiens) 6480464 BACH1 protein affects the reaction [Cannabidiol results in increased expression of HMOX1 mRNA] more ... CTD PMID:31518892 Bach1 Rat cannabidiol increases expression ISO Bach1 (Mus musculus) 6480464 Cannabidiol results in increased expression of BACH1 mRNA CTD PMID:30742662 Bach1 Rat carbamazepine affects expression ISO BACH1 (Homo sapiens) 6480464 Carbamazepine affects the expression of BACH1 mRNA CTD PMID:24752500 Bach1 Rat carbon monoxide decreases phosphorylation ISO Bach1 (Mus musculus) 6480464 Carbon Monoxide results in decreased phosphorylation of BACH1 protein CTD PMID:18845810 Bach1 Rat carbon nanotube decreases expression ISO Bach1 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of BACH1 mRNA CTD PMID:25620056 Bach1 Rat CGP 52608 multiple interactions ISO BACH1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BACH1 gene] CTD PMID:28238834 Bach1 Rat chenodeoxycholic acid multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of BACH1 mRNA CTD PMID:33819548 Bach1 Rat cinnamyl alcohol multiple interactions ISO BACH1 (Homo sapiens) 6480464 BACH1 mRNA promotes the reaction [cinnamyl alcohol results in increased expression of HMOX1 mRNA] CTD PMID:26244607 Bach1 Rat cisplatin affects response to substance ISO BACH1 (Homo sapiens) 6480464 BACH1 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Bach1 Rat citraconic acid affects localization ISO BACH1 (Homo sapiens) 6480464 citraconic acid affects the localization of BACH1 protein CTD PMID:27277809 Bach1 Rat clofibrate increases expression ISO Bach1 (Mus musculus) 6480464 Clofibrate results in increased expression of BACH1 mRNA CTD PMID:17585979 Bach1 Rat clofibrate multiple interactions ISO Bach1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of BACH1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of BACH1 mRNA] CTD PMID:17585979 Bach1 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of BACH1 mRNA CTD PMID:24386269 Bach1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of BACH1 mRNA CTD PMID:17898221 Bach1 Rat copper atom multiple interactions ISO BACH1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of BACH1 mRNA CTD PMID:20971185 Bach1 Rat copper(0) multiple interactions ISO BACH1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of BACH1 mRNA CTD PMID:20971185 Bach1 Rat copper(II) sulfate increases expression ISO BACH1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BACH1 mRNA CTD PMID:19549813 Bach1 Rat crocidolite asbestos increases expression ISO BACH1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of BACH1 mRNA CTD PMID:18687144 Bach1 Rat crocidolite asbestos increases expression ISO Bach1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of BACH1 mRNA CTD PMID:19446018 Bach1 Rat cycloheximide multiple interactions ISO BACH1 (Homo sapiens) 6480464 tetrachlorobenzoquinone promotes the reaction [Cycloheximide results in decreased expression of BACH1 protein] CTD PMID:27393035 Bach1 Rat cycloheximide decreases expression ISO BACH1 (Homo sapiens) 6480464 Cycloheximide results in decreased expression of BACH1 protein CTD PMID:27393035 Bach1 Rat cyclosporin A increases expression ISO BACH1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of BACH1 mRNA CTD PMID:20106945 and PMID:25562108 Bach1 Rat deoxycholic acid multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of BACH1 mRNA CTD PMID:33819548 Bach1 Rat diallyl trisulfide increases expression ISO BACH1 (Homo sapiens) 6480464 diallyl trisulfide results in increased expression of BACH1 mRNA CTD PMID:34995734 Bach1 Rat diarsenic trioxide increases expression ISO BACH1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of BACH1 protein CTD PMID:29260515 Bach1 Rat diarsenic trioxide affects localization ISO BACH1 (Homo sapiens) 6480464 Arsenic Trioxide affects the localization of BACH1 protein CTD PMID:19350554 Bach1 Rat diarsenic trioxide multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Arsenic Trioxide results in increased abundance of Arsenic] which results in increased expression of and affects the localization of BACH1 protein more ... CTD PMID:19350554 more ... Bach1 Rat Dibutyl phosphate affects expression ISO BACH1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BACH1 mRNA CTD PMID:37042841 Bach1 Rat diclofenac affects expression ISO BACH1 (Homo sapiens) 6480464 Diclofenac affects the expression of BACH1 mRNA CTD PMID:24752500 Bach1 Rat dicrotophos decreases expression ISO BACH1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of BACH1 mRNA CTD PMID:28302478 Bach1 Rat dimethyl fumarate affects localization ISO BACH1 (Homo sapiens) 6480464 Dimethyl Fumarate affects the localization of BACH1 protein CTD PMID:27277809 Bach1 Rat dioxygen increases expression ISO BACH1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of BACH1 mRNA CTD PMID:26516004 Bach1 Rat dioxygen multiple interactions EXP 6480464 [[Oxygen deficiency co-treated with Blood Glucose deficiency] co-treated with [Oxygen co-treated with Blood Glucose]] results in decreased expression of BACH1 mRNA more ... CTD PMID:34217758 Bach1 Rat doxorubicin decreases response to substance ISO BACH1 (Homo sapiens) 6480464 BACH1 mRNA results in decreased susceptibility to Doxorubicin CTD PMID:16322897 Bach1 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of BACH1 protein CTD PMID:18845130 Bach1 Rat echinacoside decreases expression ISO BACH1 (Homo sapiens) 6480464 echinacoside results in decreased expression of BACH1 protein CTD PMID:22735309 Bach1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of BACH1 mRNA CTD PMID:29391264 Bach1 Rat epoxiconazole decreases expression ISO Bach1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of BACH1 mRNA CTD PMID:35436446 Bach1 Rat ethyl methanesulfonate increases expression ISO BACH1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of BACH1 mRNA CTD PMID:23649840 Bach1 Rat ethylene glycol dimethacrylate multiple interactions ISO BACH1 (Homo sapiens) 6480464 BACH1 mRNA promotes the reaction [ethylene dimethacrylate results in increased expression of HMOX1 mRNA] CTD PMID:26244607 Bach1 Rat fenthion increases expression ISO Bach1 (Mus musculus) 6480464 Fenthion results in increased expression of BACH1 mRNA CTD PMID:34813904 Bach1 Rat folic acid multiple interactions ISO Bach1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of BACH1 mRNA] CTD PMID:22206623 Bach1 Rat folic acid decreases expression ISO Bach1 (Mus musculus) 6480464 Folic Acid results in decreased expression of BACH1 mRNA CTD PMID:25629700 Bach1 Rat FR900359 decreases phosphorylation ISO BACH1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of BACH1 protein CTD PMID:37730182 Bach1 Rat glycochenodeoxycholic acid multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of BACH1 mRNA CTD PMID:33819548 Bach1 Rat glycocholic acid multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of BACH1 mRNA CTD PMID:33819548 Bach1 Rat glycodeoxycholic acid multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of BACH1 mRNA CTD PMID:33819548 Bach1 Rat hemin multiple interactions ISO BACH1 (Homo sapiens) 6480464 [benzyloxycarbonylleucyl-leucyl-leucine aldehyde co-treated with Hemin] affects the localization of BACH1 protein more ... CTD PMID:18550526 more ... Bach1 Rat hemin increases expression ISO BACH1 (Homo sapiens) 6480464 Hemin results in increased expression of BACH1 mRNA and Hemin results in increased expression of BACH1 protein CTD PMID:31518892 Bach1 Rat hemin affects localization ISO BACH1 (Homo sapiens) 6480464 Hemin affects the localization of BACH1 protein CTD PMID:33434570 Bach1 Rat hydrogen cyanide increases expression ISO Bach1 (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of BACH1 mRNA CTD PMID:33914522 Bach1 Rat hydrogen peroxide multiple interactions ISO BACH1 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Hydrogen Peroxide results in decreased expression of BACH1 protein] CTD PMID:28285367 Bach1 Rat hydrogen peroxide decreases expression ISO BACH1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of BACH1 protein CTD PMID:28285367 Bach1 Rat hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of BACH1 protein CTD PMID:30660577 Bach1 Rat hydrogen peroxide multiple interactions EXP 6480464 BACH1 protein inhibits the reaction [SIRT6 protein inhibits the reaction [Hydrogen Peroxide results in increased activity of CASP3 protein]] and SIRT6 protein inhibits the reaction [Hydrogen Peroxide results in increased expression of BACH1 protein] CTD PMID:30660577 Bach1 Rat hydrogen peroxide increases expression ISO Bach1 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of BACH1 mRNA and Hydrogen Peroxide results in increased expression of BACH1 protein CTD PMID:31194955 Bach1 Rat hydrogen peroxide multiple interactions ISO Bach1 (Mus musculus) 6480464 BACH1 protein affects the reaction [Hydrogen Peroxide results in increased expression of NFE2L2 protein] more ... CTD PMID:31194955 Bach1 Rat hydroquinone multiple interactions ISO BACH1 (Homo sapiens) 6480464 [ferric chloride results in increased oxidation of hydroquinone] promotes the reaction [hydroquinone analog binds to BACH1 protein] and hydroquinone promotes the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased ubiquitination of BACH1 protein] CTD PMID:28645578 Bach1 Rat hydroquinone decreases expression ISO Bach1 (Mus musculus) 6480464 hydroquinone results in decreased expression of BACH1 protein CTD PMID:23290930 Bach1 Rat hydroquinone affects localization ISO BACH1 (Homo sapiens) 6480464 hydroquinone affects the localization of BACH1 protein CTD PMID:28645578 Bach1 Rat iron trichloride multiple interactions ISO BACH1 (Homo sapiens) 6480464 [ferric chloride results in increased oxidation of 2-tert-butylhydroquinone] promotes the reaction [2-tert-butylhydroquinone analog binds to BACH1 protein] and [ferric chloride results in increased oxidation of hydroquinone] promotes the reaction [hydroquinone analog binds to BACH1 protein] CTD PMID:28645578 Bach1 Rat L-ascorbic acid multiple interactions ISO BACH1 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Hydrogen Peroxide results in decreased expression of BACH1 protein] CTD PMID:28285367 Bach1 Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of BACH1 mRNA CTD PMID:39276841 Bach1 Rat lead diacetate multiple interactions ISO BACH1 (Homo sapiens) 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of BACH1 protein more ... CTD PMID:36096218 Bach1 Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of BACH1 mRNA CTD PMID:39276841 Bach1 Rat lead(0) multiple interactions ISO BACH1 (Homo sapiens) 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of BACH1 protein more ... CTD PMID:36096218 Bach1 Rat leflunomide increases expression ISO BACH1 (Homo sapiens) 6480464 leflunomide results in increased expression of BACH1 mRNA CTD PMID:28988120 Bach1 Rat leptomycin B affects localization ISO Bach1 (Mus musculus) 6480464 leptomycin B affects the localization of BACH1 protein CTD PMID:14504288 Bach1 Rat leptomycin B multiple interactions ISO BACH1 (Homo sapiens) 6480464 leptomycin B inhibits the reaction [Cannabidiol results in decreased expression of BACH1 protein] CTD PMID:31518892 Bach1 Rat leptomycin B multiple interactions ISO Bach1 (Mus musculus) 6480464 leptomycin B inhibits the reaction [Cadmium Chloride affects the localization of BACH1 protein] and leptomycin B inhibits the reaction [Cadmium results in decreased activity of BACH1 protein] CTD PMID:14504288 Bach1 Rat lycopene increases expression ISO BACH1 (Homo sapiens) 6480464 lycopene results in increased expression of BACH1 mRNA CTD PMID:16886892 Bach1 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of BACH1 mRNA CTD PMID:28801915 Bach1 Rat methidathion increases expression ISO Bach1 (Mus musculus) 6480464 methidathion results in increased expression of BACH1 mRNA CTD PMID:34813904 Bach1 Rat methyl methanesulfonate increases expression ISO BACH1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of BACH1 mRNA CTD PMID:23649840 Bach1 Rat methylseleninic acid increases expression ISO BACH1 (Homo sapiens) 6480464 methylselenic acid results in increased expression of BACH1 mRNA CTD PMID:12517777 Bach1 Rat motexafin gadolinium increases expression ISO BACH1 (Homo sapiens) 6480464 motexafin gadolinium results in increased expression of BACH1 mRNA CTD PMID:16357179 Bach1 Rat motexafin gadolinium multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of BACH1 mRNA CTD PMID:16357179 Bach1 Rat N-acetyl-L-cysteine multiple interactions ISO BACH1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [alpha-pyrrolidinononanophenone analog results in increased expression of BACH1 protein] and Acetylcysteine inhibits the reaction [Arsenic Trioxide affects the localization of BACH1 protein] CTD PMID:19350554 and PMID:38040126 Bach1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases ubiquitination ISO BACH1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased ubiquitination of BACH1 protein CTD PMID:28645578 Bach1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO BACH1 (Homo sapiens) 6480464 2-tert-butylhydroquinone promotes the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased ubiquitination of BACH1 protein] more ... CTD PMID:27393035 more ... Bach1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO BACH1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of BACH1 mRNA and benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of BACH1 protein CTD PMID:33434570 Bach1 Rat nickel dichloride increases expression ISO BACH1 (Homo sapiens) 6480464 nickel chloride results in increased expression of BACH1 mRNA CTD PMID:17312168 Bach1 Rat nickel sulfate increases expression ISO BACH1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of BACH1 mRNA CTD PMID:18651567 Bach1 Rat ozone multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BACH1 mRNA more ... CTD PMID:32699268 Bach1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of BACH1 mRNA CTD PMID:35737395 Bach1 Rat paracetamol affects expression ISO Bach1 (Mus musculus) 6480464 Acetaminophen affects the expression of BACH1 mRNA CTD PMID:17562736 Bach1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of BACH1 mRNA CTD PMID:32479839 and PMID:33387578 Bach1 Rat paracetamol multiple interactions ISO Bach1 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of BACH1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of BACH1 mRNA] CTD PMID:17585979 Bach1 Rat paraquat multiple interactions ISO Bach1 (Mus musculus) 6480464 [ATG7 protein affects the susceptibility to Paraquat] which affects the expression of BACH1 mRNA CTD PMID:28012437 Bach1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of BACH1 mRNA CTD PMID:32680482 Bach1 Rat phenobarbital decreases expression ISO Bach1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of BACH1 mRNA CTD PMID:19270015 and PMID:23091169 Bach1 Rat phenobarbital affects expression ISO BACH1 (Homo sapiens) 6480464 Phenobarbital affects the expression of BACH1 mRNA CTD PMID:19159669 Bach1 Rat phenobarbital increases expression ISO Bach1 (Mus musculus) 6480464 Phenobarbital results in increased expression of BACH1 mRNA CTD PMID:19270015 Bach1 Rat phorbol 13-acetate 12-myristate decreases expression ISO BACH1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of BACH1 mRNA CTD PMID:33268675 Bach1 Rat potassium cyanide increases expression ISO Bach1 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of BACH1 mRNA CTD PMID:33914522 Bach1 Rat progesterone affects expression ISO Bach1 (Mus musculus) 6480464 Progesterone affects the expression of BACH1 mRNA CTD PMID:17251523 Bach1 Rat SB 203580 multiple interactions ISO Bach1 (Mus musculus) 6480464 SB 203580 inhibits the reaction [Cadmium results in decreased activity of BACH1 protein] CTD PMID:14504288 Bach1 Rat sevoflurane decreases methylation ISO Bach1 (Mus musculus) 6480464 Sevoflurane results in decreased methylation of BACH1 mRNA CTD PMID:35249202 Bach1 Rat silver atom increases expression ISO BACH1 (Homo sapiens) 6480464 Silver results in increased expression of BACH1 mRNA CTD PMID:26014281 Bach1 Rat silver(0) increases expression ISO BACH1 (Homo sapiens) 6480464 Silver results in increased expression of BACH1 mRNA CTD PMID:26014281 Bach1 Rat sodium arsenate multiple interactions ISO BACH1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of and affects the localization of BACH1 protein and [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of BACH1 mRNA CTD PMID:33434570 Bach1 Rat sodium arsenate increases expression ISO Bach1 (Mus musculus) 6480464 sodium arsenate results in increased expression of BACH1 mRNA CTD PMID:21795629 Bach1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of BACH1 mRNA CTD PMID:25625412 Bach1 Rat sodium arsenite increases expression ISO BACH1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of BACH1 mRNA CTD PMID:38568856 Bach1 Rat sodium arsenite affects localization ISO BACH1 (Homo sapiens) 6480464 sodium arsenite affects the localization of BACH1 protein CTD PMID:23738048 Bach1 Rat sodium arsenite multiple interactions ISO BACH1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of BACH1 mRNA and sodium arsenite inhibits the reaction [BACH1 protein binds to HMOX1 enhancer] CTD PMID:20083128 and PMID:33434570 Bach1 Rat sodium dichromate decreases expression ISO Bach1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of BACH1 mRNA CTD PMID:22155349 Bach1 Rat sulforaphane increases expression ISO BACH1 (Homo sapiens) 6480464 sulforaphane results in increased expression of BACH1 mRNA and sulforaphane results in increased expression of BACH1 protein CTD PMID:31518892 Bach1 Rat tamoxifen affects expression ISO BACH1 (Homo sapiens) 6480464 Tamoxifen affects the expression of BACH1 mRNA CTD PMID:14699072 Bach1 Rat tartrazine multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of BACH1 mRNA CTD PMID:33819548 Bach1 Rat tetrachloroethene increases expression ISO Bach1 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of BACH1 mRNA CTD PMID:28973375 Bach1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of BACH1 mRNA CTD PMID:31150632 Bach1 Rat tetrachloromethane increases expression ISO Bach1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of BACH1 mRNA CTD PMID:31919559 Bach1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BACH1 mRNA CTD PMID:34492290 Bach1 Rat thiram increases expression ISO BACH1 (Homo sapiens) 6480464 Thiram results in increased expression of BACH1 mRNA CTD PMID:38568856 Bach1 Rat titanium dioxide increases expression ISO Bach1 (Mus musculus) 6480464 titanium dioxide results in increased expression of BACH1 mRNA CTD PMID:23557971 Bach1 Rat titanium dioxide increases expression ISO BACH1 (Homo sapiens) 6480464 titanium dioxide results in increased expression of BACH1 mRNA CTD PMID:34973136 Bach1 Rat titanium dioxide decreases methylation ISO Bach1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BACH1 gene CTD PMID:35295148 Bach1 Rat titanium dioxide decreases expression ISO Bach1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of BACH1 mRNA CTD PMID:29264374 Bach1 Rat toluene increases expression ISO BACH1 (Homo sapiens) 6480464 Toluene results in increased expression of BACH1 mRNA CTD PMID:28245982 Bach1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of BACH1 mRNA CTD PMID:33387578 Bach1 Rat triphenyl phosphate affects expression ISO BACH1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BACH1 mRNA CTD PMID:37042841 Bach1 Rat urethane increases expression ISO BACH1 (Homo sapiens) 6480464 Urethane results in increased expression of BACH1 mRNA CTD PMID:28818685 Bach1 Rat valproic acid decreases methylation ISO BACH1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of BACH1 gene CTD PMID:29154799 Bach1 Rat valproic acid decreases expression ISO BACH1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of BACH1 mRNA CTD PMID:23179753 Bach1 Rat zinc acetate multiple interactions ISO BACH1 (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of BACH1 mRNA CTD PMID:16357179 Bach1 Rat zinc acetate increases expression ISO BACH1 (Homo sapiens) 6480464 Zinc Acetate results in increased expression of BACH1 mRNA CTD PMID:16357179
(-)-selegiline (ISO) (E)-cinnamyl alcohol (ISO) 1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (ISO) 1,2-dimethylhydrazine (ISO) 1,4-benzoquinone (ISO) 1,4-phenylenediamine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-butoxyethanol (ISO) 2-tert-butylhydroquinone (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-phenylprop-2-enal (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) cannabidiol (ISO) carbamazepine (ISO) carbon monoxide (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) cinnamyl alcohol (ISO) cisplatin (ISO) citraconic acid (ISO) clofibrate (ISO) cobalt dichloride (EXP) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cycloheximide (ISO) cyclosporin A (ISO) deoxycholic acid (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) dicrotophos (ISO) dimethyl fumarate (ISO) dioxygen (EXP,ISO) doxorubicin (EXP,ISO) echinacoside (ISO) endosulfan (EXP) epoxiconazole (ISO) ethyl methanesulfonate (ISO) ethylene glycol dimethacrylate (ISO) fenthion (ISO) folic acid (ISO) FR900359 (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hemin (ISO) hydrogen cyanide (ISO) hydrogen peroxide (EXP,ISO) hydroquinone (ISO) iron trichloride (ISO) L-ascorbic acid (ISO) lead diacetate (EXP,ISO) lead(0) (EXP,ISO) leflunomide (ISO) leptomycin B (ISO) lycopene (ISO) manganese(II) chloride (EXP) methidathion (ISO) methyl methanesulfonate (ISO) methylseleninic acid (ISO) motexafin gadolinium (ISO) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel dichloride (ISO) nickel sulfate (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) phenobarbital (ISO) phorbol 13-acetate 12-myristate (ISO) potassium cyanide (ISO) progesterone (ISO) SB 203580 (ISO) sevoflurane (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sulforaphane (ISO) tamoxifen (ISO) tartrazine (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) toluene (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) zinc acetate (ISO)
Bach1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 40,425,721 - 40,461,118 (+) NCBI GRCr8 mRatBN7.2 11 26,939,429 - 26,974,876 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 26,939,480 - 26,972,447 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 35,637,561 - 35,670,105 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 28,337,824 - 28,370,368 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 27,526,892 - 27,559,119 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 27,364,913 - 27,398,713 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 27,364,916 - 27,398,842 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 27,598,719 - 27,611,811 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 31,133,137 - 31,153,652 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 11 31,219,581 - 31,228,721 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 27,467,207 - 27,500,173 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 11 26,683,083 - 26,716,048 (+) NCBI Celera Cytogenetic Map 11 q11 NCBI
BACH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 29,298,922 - 29,361,894 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 29,194,071 - 29,630,751 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 30,671,243 - 30,734,215 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 29,593,091 - 29,656,088 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 29,593,607 - 29,640,340 NCBI Celera 21 15,854,335 - 15,917,330 (+) NCBI Celera Cytogenetic Map 21 q21.3 NCBI HuRef 21 16,079,359 - 16,142,364 (+) NCBI HuRef CHM1_1 21 30,232,876 - 30,295,865 (+) NCBI CHM1_1 T2T-CHM13v2.0 21 27,664,831 - 27,727,787 (+) NCBI T2T-CHM13v2.0
Bach1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 87,495,842 - 87,530,234 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 87,495,833 - 87,530,234 (+) Ensembl GRCm39 Ensembl GRCm38 16 87,698,954 - 87,733,346 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 87,698,945 - 87,733,346 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 87,699,199 - 87,733,591 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 87,588,150 - 87,622,542 (+) NCBI MGSCv36 mm8 Celera 16 87,895,225 - 87,930,573 (+) NCBI Celera Cytogenetic Map 16 C3.3 NCBI cM Map 16 49.84 NCBI
Bach1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 28,678,181 - 28,701,399 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 28,678,181 - 28,701,115 (+) NCBI ChiLan1.0 ChiLan1.0
BACH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 25,488,712 - 25,945,192 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 20,347,222 - 20,460,967 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 15,738,343 - 16,036,760 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 29,126,108 - 29,173,835 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 29,126,107 - 29,173,835 (+) Ensembl panpan1.1 panPan2
BACH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 24,269,310 - 24,310,369 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 31 24,269,280 - 24,381,454 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 24,262,076 - 24,305,091 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 24,382,476 - 24,425,729 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 31 24,382,527 - 24,494,433 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 31 24,332,784 - 24,375,935 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 24,334,594 - 24,377,719 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 24,807,496 - 24,849,474 (+) NCBI UU_Cfam_GSD_1.0
Bach1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404971 24,726,917 - 24,750,160 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936500 12,717,516 - 12,740,656 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936500 12,720,027 - 12,740,717 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BACH1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 192,656,289 - 192,697,540 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 192,656,289 - 192,697,536 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 203,110,429 - 203,149,469 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BACH1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 62,674,834 - 63,028,825 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 62,877,986 - 62,925,465 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 5,462,068 - 5,510,099 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bach1
.
Predicted Target Of
Count of predictions: 347 Count of miRNA genes: 196 Interacting mature miRNAs: 226 Transcripts: ENSRNOT00000002151 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1598842 Glom10 Glomerulus QTL 10 3.4 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 1 35331169 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat 724517 Uae18 Urinary albumin excretion QTL 18 3.7 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 16472047 44285911 Rat
RH143670
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 11 40,426,102 - 40,426,301 (+) Marker Load Pipeline mRatBN7.2 11 26,939,861 - 26,940,060 (+) MAPPER mRatBN7.2 Rnor_6.0 11 27,513,399 - 27,513,597 NCBI Rnor6.0 Rnor_6.0 11 27,365,577 - 27,365,775 NCBI Rnor6.0 Rnor_5.0 11 30,990,078 - 30,990,276 UniSTS Rnor5.0 Rnor_5.0 11 31,133,519 - 31,133,717 UniSTS Rnor5.0 RGSC_v3.4 11 27,467,589 - 27,467,787 UniSTS RGSC3.4 Celera 11 26,683,465 - 26,683,663 UniSTS RH 3.4 Map 11 136.3 UniSTS Cytogenetic Map 11 q11 UniSTS
RH134801
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 26,957,085 - 26,957,265 (+) MAPPER mRatBN7.2 Rnor_6.0 11 27,530,622 - 27,530,801 NCBI Rnor6.0 Rnor_6.0 11 27,382,802 - 27,382,981 NCBI Rnor6.0 Rnor_5.0 11 31,150,742 - 31,150,921 UniSTS Rnor5.0 Rnor_5.0 11 31,007,303 - 31,007,482 UniSTS Rnor5.0 RGSC_v3.4 11 27,484,813 - 27,484,992 UniSTS RGSC3.4 Celera 11 26,700,688 - 26,700,867 UniSTS RH 3.4 Map 11 130.2 UniSTS Cytogenetic Map 11 q11 UniSTS
Bach1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 26,960,896 - 26,961,146 (+) MAPPER mRatBN7.2 Rnor_6.0 11 27,386,613 - 27,386,862 NCBI Rnor6.0 Rnor_5.0 11 31,011,114 - 31,011,363 UniSTS Rnor5.0 RGSC_v3.4 11 27,488,624 - 27,488,873 UniSTS RGSC3.4 Celera 11 26,704,499 - 26,704,748 UniSTS Cytogenetic Map 11 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002151 ⟹ ENSRNOP00000002151
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 26,939,480 - 26,972,447 (+) Ensembl Rnor_6.0 Ensembl 11 27,364,916 - 27,398,527 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083275 ⟹ ENSRNOP00000071976
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 27,382,049 - 27,398,842 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087021
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 11 27,598,719 - 27,611,811 (+) Ensembl
RefSeq Acc Id:
NM_001107113 ⟹ NP_001100583
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 40,425,721 - 40,458,689 (+) NCBI mRatBN7.2 11 26,939,480 - 26,972,447 (+) NCBI Rnor_6.0 11 27,365,195 - 27,398,527 (+) NCBI Rnor_5.0 11 31,133,137 - 31,153,652 (+) NCBI Rnor_5.0 11 31,219,581 - 31,228,721 (+) NCBI RGSC_v3.4 11 27,467,207 - 27,500,173 (+) RGD Celera 11 26,683,083 - 26,716,048 (+) RGD
Sequence:
GAGACGGGCGGCCGTCCGCGCGGAGGGAGTGAGTCACCTGACCGCCGCTTGCCGCCTGCAGTCGGGCCGTGCCGCGCCTCGGCTCCGGTCGATGACAGTGAGAAGCATGCTTTCCACTGCTCTCCCTG
hide sequence
RefSeq Acc Id:
XM_017598018 ⟹ XP_017453507
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 40,426,820 - 40,461,118 (+) NCBI mRatBN7.2 11 26,940,738 - 26,974,876 (+) NCBI Rnor_6.0 11 27,366,453 - 27,398,713 (+) NCBI
Sequence:
AGTAGGTGACGTGGGAGAGCATGCTTAGGACGTGGCCAAGTAGCATCTAGGTGGTGTTTAAACA
hide sequence
RefSeq Acc Id:
XM_039088437 ⟹ XP_038944365
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 40,426,820 - 40,461,118 (+) NCBI mRatBN7.2 11 26,940,518 - 26,974,876 (+) NCBI
RefSeq Acc Id:
XM_063270599 ⟹ XP_063126669
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 40,426,820 - 40,456,132 (+) NCBI
RefSeq Acc Id:
NP_001100583 ⟸ NM_001107113
- UniProtKB:
D4ACD2 (UniProtKB/TrEMBL), A6JL80 (UniProtKB/TrEMBL)
- Sequence:
MSVSESAVFAYESSVHSTNVLLSLNDQRKKDVLCDVTVLVEGQQFRAHRSVLAACSSYFHSRIVGQTDAELTITLPQEVTVKGFEPLIQFAYTAKLILSKDNVDEVCKCVEFLSVHNIEESCFQFLKF
hide sequence
RefSeq Acc Id:
XP_017453507 ⟸ XM_017598018
- Peptide Label:
isoform X1
- UniProtKB:
D4ACD2 (UniProtKB/TrEMBL), A6JL80 (UniProtKB/TrEMBL)
- Sequence:
MSVSESAVFAYESSVHSTNVLLSLNDQRKKDVLCDVTVLVEGQQFRAHRSVLAACSSYFHSRIVGQTDAELTITLPQEVTVKGFEPLIQFAYTAKLILSKDNVDEVCKCVEFLSVHNIEESCFQFLKF
hide sequence
Ensembl Acc Id:
ENSRNOP00000002151 ⟸ ENSRNOT00000002151
Ensembl Acc Id:
ENSRNOP00000071976 ⟸ ENSRNOT00000083275
RefSeq Acc Id:
XP_038944365 ⟸ XM_039088437
- Peptide Label:
isoform X1
- UniProtKB:
D4ACD2 (UniProtKB/TrEMBL), A6JL80 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126669 ⟸ XM_063270599
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Bach1
BTB domain and CNC homolog 1
LOC103690154
transcription regulator protein BACH1-like
Data merged from RGD:9077397
737654 PROVISIONAL
2016-05-11
Bach1
BTB domain and CNC homolog 1
Bach1
BTB and CNC homology 1, basic leucine zipper transcription factor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-06-22
Bach1
BTB and CNC homology 1, basic leucine zipper transcription factor 1
LOC100911490
transcription regulator protein BACH1-like
Data merged from RGD:6492873
737654 APPROVED
2014-08-25
LOC103690154
transcription regulator protein BACH1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2012-07-05
LOC100911490
transcription regulator protein BACH1-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-09-25
Bach1
BTB and CNC homology 1, basic leucine zipper transcription factor 1
Bach1
BTB and CNC homology 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Bach1
BTB and CNC homology 1
Bach1_predicted
BTB and CNC homology 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Bach1_predicted
BTB and CNC homology 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
