Symbol:
Usp32
Name:
ubiquitin specific peptidase 32
RGD ID:
1306657
Description:
Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in positive regulation of TORC1 signaling. Predicted to be located in cytosol. Predicted to be active in Golgi apparatus. Orthologous to several human genes including USP32 (ubiquitin specific peptidase 32); INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC303394; ubiquitin carboxyl-terminal hydrolase 32; ubiquitin specific protease 32
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
USP32 (ubiquitin specific peptidase 32) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Usp32 (ubiquitin specific peptidase 32) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Usp32 (ubiquitin specific peptidase 32) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
USP32 (ubiquitin specific peptidase 32) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
USP32 (ubiquitin specific peptidase 32) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp32 (ubiquitin specific peptidase 32) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
USP32 (ubiquitin specific peptidase 32) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
USP32 (ubiquitin specific peptidase 32) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Usp32 (ubiquitin specific peptidase 32) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
USP6 (ubiquitin specific peptidase 6) HGNC
EggNOG, Ensembl, Panther, Treefam
Alliance orthologs 3
Homo sapiens (human):
USP32 (ubiquitin specific peptidase 32)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Usp32 (ubiquitin specific peptidase 32)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp32 (ubiquitin specific peptidase 32)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
UBP12
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
cyk-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Usp32
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
usp32
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 70,353,310 - 70,538,008 (-) NCBI GRCr8 mRatBN7.2 10 69,855,895 - 70,029,075 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 69,855,885 - 70,029,137 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 74,475,881 - 74,624,609 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 73,980,650 - 74,129,386 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 69,445,325 - 69,594,054 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 72,300,173 - 72,474,574 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 72,300,173 - 72,472,675 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 72,206,629 - 72,379,784 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 73,256,761 - 73,374,747 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 73,272,578 - 73,421,610 (-) NCBI Celera 10 68,783,663 - 68,900,074 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp32 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO USP32 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of USP32 mRNA CTD PMID:22079256 Usp32 Rat 1,2-dimethylhydrazine multiple interactions ISO Usp32 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of USP32 mRNA] CTD PMID:22206623 Usp32 Rat 1,2-dimethylhydrazine decreases expression ISO Usp32 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP32 mRNA CTD PMID:22206623 Usp32 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of USP32 mRNA CTD PMID:24140754 Usp32 Rat 17beta-estradiol increases expression ISO USP32 (Homo sapiens) 6480464 Estradiol results in increased expression of USP32 mRNA CTD PMID:16514628 Usp32 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Usp32 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Usp32 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP32 mRNA CTD PMID:21215274 and PMID:33387578 Usp32 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP32 mRNA CTD PMID:34747641 Usp32 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of USP32 mRNA CTD PMID:21346803 Usp32 Rat 2-hydroxypropanoic acid decreases expression ISO USP32 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of USP32 mRNA CTD PMID:30851411 Usp32 Rat 4,4'-sulfonyldiphenol decreases expression ISO Usp32 (Mus musculus) 6480464 bisphenol S results in decreased expression of USP32 mRNA CTD PMID:39298647 Usp32 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of USP32 mRNA CTD PMID:28959563 Usp32 Rat afimoxifene decreases expression ISO USP32 (Homo sapiens) 6480464 afimoxifene results in decreased expression of USP32 mRNA CTD PMID:16514628 Usp32 Rat aflatoxin B1 increases expression ISO Usp32 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of USP32 mRNA CTD PMID:19770486 Usp32 Rat aflatoxin B1 increases methylation ISO USP32 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of USP32 gene and Aflatoxin B1 results in increased methylation of USP32 intron CTD PMID:27153756 and PMID:30157460 Usp32 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of USP32 mRNA CTD PMID:38685447 Usp32 Rat aristolochic acid A decreases expression ISO USP32 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP32 mRNA CTD PMID:33212167 Usp32 Rat arsane affects methylation ISO USP32 (Homo sapiens) 6480464 Arsenic affects the methylation of USP32 gene CTD PMID:25304211 Usp32 Rat arsenic atom affects methylation ISO USP32 (Homo sapiens) 6480464 Arsenic affects the methylation of USP32 gene CTD PMID:25304211 Usp32 Rat benzo[a]pyrene diol epoxide I decreases expression ISO USP32 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Usp32 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of USP32 mRNA CTD PMID:25181051 Usp32 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of USP32 mRNA CTD PMID:19167457 Usp32 Rat cadmium dichloride decreases expression ISO Usp32 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of USP32 mRNA CTD PMID:24982889 Usp32 Rat caffeine affects phosphorylation ISO USP32 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of USP32 protein CTD PMID:35688186 Usp32 Rat CGP 52608 multiple interactions ISO USP32 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP32 gene] CTD PMID:28238834 Usp32 Rat chlorpyrifos decreases expression ISO Usp32 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of USP32 mRNA CTD PMID:37019170 Usp32 Rat cisplatin decreases expression ISO USP32 (Homo sapiens) 6480464 Cisplatin results in decreased expression of USP32 mRNA CTD PMID:19561079 Usp32 Rat copper(II) sulfate decreases expression ISO USP32 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of USP32 mRNA CTD PMID:19549813 Usp32 Rat coumarin increases phosphorylation ISO USP32 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of USP32 protein CTD PMID:35688186 Usp32 Rat CU-O LINKAGE increases expression ISO USP32 (Homo sapiens) 6480464 cupric oxide results in increased expression of USP32 mRNA CTD PMID:22077320 Usp32 Rat cyclosporin A increases expression ISO USP32 (Homo sapiens) 6480464 Cyclosporine results in increased expression of USP32 mRNA CTD PMID:25562108 Usp32 Rat Dibutyl phosphate affects expression ISO USP32 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP32 mRNA CTD PMID:37042841 Usp32 Rat dibutyl phthalate increases expression ISO Usp32 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of USP32 mRNA CTD PMID:21266533 Usp32 Rat folic acid multiple interactions ISO Usp32 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of USP32 mRNA] CTD PMID:22206623 Usp32 Rat fulvestrant decreases expression ISO USP32 (Homo sapiens) 6480464 fulvestrant results in decreased expression of USP32 mRNA CTD PMID:16514628 Usp32 Rat furan increases methylation EXP 6480464 furan results in increased methylation of USP32 gene CTD PMID:22079235 Usp32 Rat gallic acid decreases expression ISO USP32 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of USP32 mRNA CTD PMID:34408198 Usp32 Rat lead(0) increases expression ISO USP32 (Homo sapiens) 6480464 Lead results in increased expression of USP32 mRNA CTD PMID:19921347 Usp32 Rat lead(0) affects splicing ISO USP32 (Homo sapiens) 6480464 Lead affects the splicing of USP32 mRNA CTD PMID:28903495 Usp32 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP32 mRNA CTD PMID:25729387 Usp32 Rat paracetamol decreases expression ISO USP32 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of USP32 mRNA CTD PMID:21420995 Usp32 Rat phenobarbital affects expression ISO USP32 (Homo sapiens) 6480464 Phenobarbital affects the expression of USP32 mRNA CTD PMID:19159669 Usp32 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of USP32 mRNA CTD PMID:26923065 Usp32 Rat potassium chromate decreases expression ISO USP32 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of USP32 mRNA CTD PMID:22079256 Usp32 Rat potassium chromate multiple interactions ISO USP32 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of USP32 mRNA CTD PMID:22079256 Usp32 Rat rac-lactic acid decreases expression ISO USP32 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of USP32 mRNA CTD PMID:30851411 Usp32 Rat raloxifene decreases expression ISO USP32 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of USP32 mRNA CTD PMID:16514628 Usp32 Rat resveratrol multiple interactions ISO USP32 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of USP32 mRNA CTD PMID:23557933 Usp32 Rat sodium arsenite increases expression ISO USP32 (Homo sapiens) 6480464 sodium arsenite results in increased expression of USP32 mRNA CTD PMID:38568856 Usp32 Rat titanium dioxide decreases methylation ISO Usp32 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP32 gene and titanium dioxide results in decreased methylation of USP32 promoter CTD PMID:35295148 Usp32 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP32 mRNA CTD PMID:25729387 Usp32 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of USP32 mRNA CTD PMID:25729387 Usp32 Rat triptonide increases expression ISO Usp32 (Mus musculus) 6480464 triptonide results in increased expression of USP32 mRNA CTD PMID:33045310 Usp32 Rat tungsten decreases expression ISO Usp32 (Mus musculus) 6480464 Tungsten results in decreased expression of USP32 mRNA CTD PMID:30912803 Usp32 Rat valproic acid decreases methylation ISO USP32 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of USP32 gene CTD PMID:29154799
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) acrylamide (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) copper(II) sulfate (ISO) coumarin (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) folic acid (ISO) fulvestrant (ISO) furan (EXP) gallic acid (ISO) lead(0) (ISO) oxaliplatin (EXP) paracetamol (ISO) phenobarbital (ISO) poly(I:C) (EXP) potassium chromate (ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (ISO) sodium arsenite (ISO) titanium dioxide (ISO) topotecan (EXP) triptonide (ISO) tungsten (ISO) valproic acid (ISO)
Usp32 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 70,353,310 - 70,538,008 (-) NCBI GRCr8 mRatBN7.2 10 69,855,895 - 70,029,075 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 69,855,885 - 70,029,137 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 74,475,881 - 74,624,609 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 73,980,650 - 74,129,386 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 69,445,325 - 69,594,054 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 72,300,173 - 72,474,574 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 72,300,173 - 72,472,675 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 72,206,629 - 72,379,784 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 73,256,761 - 73,374,747 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 73,272,578 - 73,421,610 (-) NCBI Celera 10 68,783,663 - 68,900,074 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
USP32 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 60,177,327 - 60,422,416 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 60,177,327 - 60,422,470 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 58,254,688 - 58,469,494 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 55,609,473 - 55,824,368 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 55,609,472 - 55,824,368 NCBI Celera 17 54,714,573 - 54,774,210 (-) NCBI Celera Cytogenetic Map 17 q23.1-q23.2 NCBI HuRef 17 53,625,587 - 53,839,800 (-) NCBI HuRef CHM1_1 17 58,318,576 - 58,533,515 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 61,046,275 - 61,291,441 (-) NCBI T2T-CHM13v2.0
Usp32 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 84,875,263 - 85,031,107 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 84,875,268 - 85,030,987 (-) Ensembl GRCm39 Ensembl GRCm38 11 84,984,437 - 85,140,281 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 84,984,442 - 85,140,161 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 84,797,990 - 84,953,457 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 84,797,990 - 84,953,457 (-) NCBI MGSCv36 mm8 Celera 11 94,606,417 - 94,763,620 (-) NCBI Celera Cytogenetic Map 11 C NCBI cM Map 11 51.34 NCBI
Usp32 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955451 1,511,687 - 1,678,546 (-) NCBI ChiLan1.0 ChiLan1.0
USP32 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 76,360,431 - 76,574,458 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 81,171,194 - 81,385,562 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 54,263,343 - 54,477,162 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 59,437,214 - 59,605,010 (-) NCBI panpan1.1 PanPan1.1 panPan2
USP32 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 36,092,232 - 36,310,231 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 36,102,641 - 36,308,278 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 35,319,683 - 35,537,460 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 36,904,940 - 37,123,214 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 36,915,518 - 37,123,157 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 35,683,725 - 35,901,946 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 35,970,620 - 36,189,098 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 36,059,190 - 36,277,106 (+) NCBI UU_Cfam_GSD_1.0
Usp32
USP32
USP32
Usp32
.
Predicted Target Of
Count of predictions: 422 Count of miRNA genes: 245 Interacting mature miRNAs: 301 Transcripts: ENSRNOT00000036814 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631565 Hcuc4 Hepatic copper content QTL 4 4.15 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 10 66941813 73452992 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 2289985 Bp305 Blood pressure QTL 305 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 67502108 73579767 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
D10Got94
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 69,965,697 - 69,965,890 (+) MAPPER mRatBN7.2 Rnor_6.0 10 72,410,855 - 72,411,047 NCBI Rnor6.0 Rnor_5.0 10 72,317,529 - 72,317,721 UniSTS Rnor5.0 RGSC_v3.4 10 73,367,783 - 73,367,976 RGD RGSC3.4 RGSC_v3.4 10 73,367,784 - 73,367,976 UniSTS RGSC3.4 RGSC_v3.1 10 73,382,153 - 73,382,346 RGD Celera 10 68,893,111 - 68,893,303 UniSTS RH 2.0 Map 10 724.0 RGD Cytogenetic Map 10 q26 UniSTS
RH127307
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 69,856,237 - 69,856,449 (+) MAPPER mRatBN7.2 Rnor_6.0 10 72,300,526 - 72,300,737 NCBI Rnor6.0 Rnor_5.0 10 72,206,982 - 72,207,193 UniSTS Rnor5.0 RGSC_v3.4 10 73,257,114 - 73,257,325 UniSTS RGSC3.4 Celera 10 68,784,016 - 68,784,227 UniSTS Cytogenetic Map 10 q26 UniSTS
BI297055
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 69,856,785 - 69,856,952 (+) MAPPER mRatBN7.2 Rnor_6.0 10 72,301,074 - 72,301,240 NCBI Rnor6.0 Rnor_5.0 10 72,207,530 - 72,207,696 UniSTS Rnor5.0 RGSC_v3.4 10 73,257,662 - 73,257,828 UniSTS RGSC3.4 Celera 10 68,784,564 - 68,784,730 UniSTS Cytogenetic Map 10 q26 UniSTS
RH135144
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 69,896,530 - 69,896,726 (+) MAPPER mRatBN7.2 Rnor_6.0 10 72,340,725 - 72,340,920 NCBI Rnor6.0 Rnor_5.0 10 72,247,521 - 72,247,716 UniSTS Rnor5.0 RGSC_v3.4 10 73,297,914 - 73,298,109 UniSTS RGSC3.4 Celera 10 68,824,019 - 68,824,214 UniSTS Cytogenetic Map 10 q26 UniSTS
AW045245
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 69,855,925 - 69,856,014 (+) MAPPER mRatBN7.2 Rnor_6.0 10 72,300,214 - 72,300,302 NCBI Rnor6.0 Rnor_5.0 10 72,206,670 - 72,206,758 UniSTS Rnor5.0 RGSC_v3.4 10 73,256,802 - 73,256,890 UniSTS RGSC3.4 Celera 10 68,783,704 - 68,783,792 UniSTS Cytogenetic Map 10 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000036814 ⟹ ENSRNOP00000031281
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 69,855,885 - 69,972,661 (-) Ensembl Rnor_6.0 Ensembl 10 72,300,173 - 72,417,070 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081649 ⟹ ENSRNOP00000074862
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 69,855,945 - 70,029,137 (-) Ensembl Rnor_6.0 Ensembl 10 72,300,209 - 72,472,675 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111648 ⟹ ENSRNOP00000088848
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 69,855,945 - 70,004,529 (-) Ensembl
RefSeq Acc Id:
NM_001401667 ⟹ NP_001388596
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,353,310 - 70,502,039 (-) NCBI mRatBN7.2 10 69,855,895 - 70,004,602 (-) NCBI
RefSeq Acc Id:
XM_017597308 ⟹ XP_017452797
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,353,356 - 70,538,008 (-) NCBI mRatBN7.2 10 69,855,896 - 70,029,075 (-) NCBI Rnor_6.0 10 72,300,229 - 72,474,574 (-) NCBI
Sequence:
GTCACCTGACAGAGAATGACAGAAGAGGTTGTCGGGGAGGATGTGCATGGCCCTGTGATGGAGATGAGGCATGGAACTGAGGCCGGTCCGTCTCCGGCATTCATGTGCCACAGGGTGTCCTGTGGCCA
hide sequence
RefSeq Acc Id:
XM_039086041 ⟹ XP_038941969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,353,356 - 70,538,008 (-) NCBI mRatBN7.2 10 69,855,896 - 70,029,075 (-) NCBI
RefSeq Acc Id:
XM_039086042 ⟹ XP_038941970
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,353,356 - 70,502,035 (-) NCBI mRatBN7.2 10 69,855,896 - 70,004,549 (-) NCBI
RefSeq Acc Id:
XM_063269090 ⟹ XP_063125160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,353,356 - 70,479,039 (-) NCBI
RefSeq Acc Id:
XM_063269091 ⟹ XP_063125161
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 70,353,356 - 70,502,255 (-) NCBI
RefSeq Acc Id:
XP_017452797 ⟸ XM_017597308
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A5X2 (UniProtKB/TrEMBL)
- Sequence:
MTEEVVGEDVHGPVMEMRHGTEAGPSPAFMCHRVSCGQKTAEEADSLPSPCEFWELNSGHQAEGVEARPLPAESSYQPFPWEFEVTDVELKRLKDAFKRTCGLSYYMSQHCFIREVLGDGVPPKVAEV
hide sequence
Ensembl Acc Id:
ENSRNOP00000074862 ⟸ ENSRNOT00000081649
Ensembl Acc Id:
ENSRNOP00000031281 ⟸ ENSRNOT00000036814
RefSeq Acc Id:
XP_038941969 ⟸ XM_039086041
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A5X2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038941970 ⟸ XM_039086042
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6A5X2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088848 ⟸ ENSRNOT00000111648
RefSeq Acc Id:
NP_001388596 ⟸ NM_001401667
- UniProtKB:
A0A8I6A5X2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125161 ⟸ XM_063269091
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6A5X2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125160 ⟸ XM_063269090
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6A5X2 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-05-07
Usp32
ubiquitin specific peptidase 32
Usp32
ubiquitin specific protease 32
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Usp32
ubiquitin specific protease 32
Usp32_predicted
ubiquitin specific protease 32 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Usp32_predicted
ubiquitin specific protease 32 (predicted)
Symbol and Name status set to approved
70820 APPROVED
