Advanced Search (OLGA)

Gene: Pgk2 (phosphoglycerate kinase 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pgk2

Name:

phosphoglycerate kinase 2

RGD ID:

1306627

Description:

Predicted to enable ADP binding activity; ATP binding activity; and phosphoglycerate kinase activity. Predicted to be involved in gluconeogenesis and glycolytic process. Predicted to act upstream of or within flagellated sperm motility. Predicted to be located in cilium. Predicted to be active in cytosol and sperm fibrous sheath. Orthologous to human PGK2 (phosphoglycerate kinase 2); PARTICIPATES IN gluconeogenesis pathway; glycolysis pathway; glycolysis/gluconeogenesis pathway; INTERACTS WITH bisphenol A; fenvalerate; (-)-epigallocatechin 3-gallate (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC316265

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PGK2 (phosphoglycerate kinase 2)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pgk2 (phosphoglycerate kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pgk2 (phosphoglycerate kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PGK2 (phosphoglycerate kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PGK2 (phosphoglycerate kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PGK2 (phosphoglycerate kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PGK2 (phosphoglycerate kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pgk2 (phosphoglycerate kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PGK1 (phosphoglycerate kinase 1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	PGK2 (phosphoglycerate kinase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Pgk2 (phosphoglycerate kinase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pgk1 (phosphoglycerate kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	PGK1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pgk	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pgk-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pgk1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	27,976,913 - 27,978,479 (+)	NCBI		GRCr8
mRatBN7.2	9	20,480,367 - 20,481,933 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	20,480,203 - 20,571,481 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	29,010,916 - 29,012,482 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	34,114,730 - 34,116,296 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	32,425,549 - 32,427,115 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	24,095,774 - 24,097,340 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	24,095,751 - 24,097,337 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	22,956,349 - 22,957,915 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	16,705,747 - 16,707,313 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	16,703,068 - 16,704,633 (+)	NCBI
Celera	9	18,123,078 - 18,124,644 (+)	NCBI		Celera
Cytogenetic Map	9	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgk2	Rat	(-)-epigallocatechin 3-gallate	decreases expression	ISO	PGK2 (Homo sapiens)	6480464	epigallocatechin gallate results in decreased expression of PGK2 protein	CTD	PMID:31195006
Pgk2	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Pgk2 (Mus musculus)	6480464	[Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of PGK2 mRNA	CTD	PMID:37844793
Pgk2	Rat	17beta-estradiol	decreases expression	ISO	Pgk2 (Mus musculus)	6480464	Estradiol results in decreased expression of PGK2 mRNA	CTD	PMID:19484750
Pgk2	Rat	1H-pyrazole	increases expression	ISO	Pgk2 (Mus musculus)	6480464	pyrazole results in increased expression of PGK2 mRNA	CTD	PMID:17945193
Pgk2	Rat	3-methylcholanthrene	decreases expression	ISO	Pgk2 (Mus musculus)	6480464	Methylcholanthrene results in decreased expression of PGK2 mRNA	CTD	PMID:35487396
Pgk2	Rat	amiodarone	increases expression	ISO	PGK2 (Homo sapiens)	6480464	Amiodarone results in increased expression of PGK2 mRNA	CTD	PMID:19774075
Pgk2	Rat	benzo[a]pyrene	affects methylation	ISO	PGK2 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of PGK2 promoter	CTD	PMID:27901495
Pgk2	Rat	benzo[a]pyrene	increases methylation	ISO	PGK2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of PGK2 3' UTR	CTD	PMID:27901495
Pgk2	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Pgk2 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of PGK2 mRNA	CTD	PMID:30284816
Pgk2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PGK2 mRNA	CTD	PMID:25181051
Pgk2	Rat	bisphenol A	decreases methylation	ISO	PGK2 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of PGK2 gene	CTD	PMID:31601247
Pgk2	Rat	bisphenol AF	increases expression	ISO	PGK2 (Homo sapiens)	6480464	bisphenol AF results in increased expression of PGK2 mRNA	CTD	PMID:31121516
Pgk2	Rat	caffeine	decreases expression	ISO	PGK2 (Homo sapiens)	6480464	Caffeine results in decreased expression of PGK2 protein	CTD	PMID:31195006
Pgk2	Rat	carbon nanotube	decreases expression	ISO	PGK2 (Homo sapiens)	6480464	Nanotubes and Carbon results in decreased expression of PGK2 protein	CTD	PMID:22157353
Pgk2	Rat	carbon nanotube	increases expression	ISO	Pgk2 (Mus musculus)	6480464	Nanotubes and Carbon results in increased expression of PGK2 protein	CTD	PMID:33892499
Pgk2	Rat	ciguatoxin CTX1B	affects expression	ISO	Pgk2 (Mus musculus)	6480464	Ciguatoxins affects the expression of PGK2 mRNA	CTD	PMID:18353800
Pgk2	Rat	diclofenac	multiple interactions	ISO	Pgk2 (Mus musculus)	6480464	[Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of PGK2 mRNA	CTD	PMID:37844793
Pgk2	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of PGK2 protein	CTD	PMID:33656234
Pgk2	Rat	graphite	decreases expression	ISO	PGK2 (Homo sapiens)	6480464	Graphite results in decreased expression of PGK2 protein	CTD	PMID:22157353
Pgk2	Rat	ibuprofen	multiple interactions	ISO	Pgk2 (Mus musculus)	6480464	[Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of PGK2 mRNA	CTD	PMID:37844793
Pgk2	Rat	potassium dichromate	increases expression	ISO	Pgk2 (Mus musculus)	6480464	Potassium Dichromate results in increased expression of PGK2 mRNA	CTD	PMID:23608068
Pgk2	Rat	sodium arsenite	decreases expression	ISO	Pgk2 (Mus musculus)	6480464	sodium arsenite results in decreased expression of PGK2 mRNA and sodium arsenite results in decreased expression of PGK2 protein	CTD	PMID:32991915
Pgk2	Rat	sodium arsenite	affects expression	ISO	PGK2 (Homo sapiens)	6480464	sodium arsenite affects the expression of PGK2 mRNA	CTD	PMID:23648393
Pgk2	Rat	sodium fluoride	increases expression	ISO	Pgk2 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of PGK2 protein	CTD	PMID:28918527

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgk2	Rat	flagellated sperm motility	acts_upstream_of_or_within	ISO	Pgk2 (Mus musculus)	1624291	MGI:4421784 PMID:19759366	RGD	PMID:19759366
Pgk2	Rat	gluconeogenesis	involved_in	IBA	MGI:97555 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgk2	Rat	glycolytic process	involved_in	IEA	UniPathway:UPA00109	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Pgk2	Rat	glycolytic process	involved_in	IEA	ARBA:ARBA00035055	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Pgk2	Rat	glycolytic process	involved_in	IEA	InterPro:IPR001576 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgk2	Rat	glycolytic process	acts_upstream_of_or_within	ISO	Pgk2 (Mus musculus)	1624291	PMID:19759366	RGD	PMID:19759366
Pgk2	Rat	glycolytic process	involved_in	IEA	UniProtKB-KW:KW-0324	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgk2	Rat	glycolytic process	involved_in	IBA	FB:FBgn0250906 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgk2	Rat	cilium	located_in	ISO	Pgk2 (Mus musculus)	1624291	PMID:16687649	RGD	PMID:16687649
Pgk2	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pgk2	Rat	cytosol	is_active_in	IBA	MGI:97555 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgk2	Rat	sperm fibrous sheath	is_active_in	IBA	MGI:97563 and PANTHER:PTN001685897	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgk2	Rat	sperm fibrous sheath	located_in	ISO	Pgk2 (Mus musculus)	1624291	PMID:16687649	RGD	PMID:16687649

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgk2	Rat	ADP binding	enables	IBA	PANTHER:PTN000150497 and Pgk1 (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgk2	Rat	ATP binding	enables	IBA	PANTHER:PTN000150497 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgk2	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgk2	Rat	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgk2	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgk2	Rat	phosphoglycerate kinase activity	enables	ISO	PGK2 (Homo sapiens)	1624291	PMID:1278465 and PMID:5009693	RGD	PMID:1278465 and PMID:5009693
Pgk2	Rat	phosphoglycerate kinase activity	enables	IEA	ARBA:ARBA00035066	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Pgk2	Rat	phosphoglycerate kinase activity	enables	IEA	InterPro:IPR001576 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgk2	Rat	phosphoglycerate kinase activity	enables	IEA	EC:2.7.2.3	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Pgk2	Rat	phosphoglycerate kinase activity	enables	ISO	Pgk2 (Mus musculus)	1624291	MGI:4421784 PMID:19759366 and PMID:2823118	RGD	PMID:19759366 and PMID:2823118
Pgk2	Rat	phosphoglycerate kinase activity	enables	IBA	MGI:97555 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgk2	Rat	protein binding	enables	ISO	PGK2 (Homo sapiens)	1624291	UniProtKB:P00558 more ...	RGD	PMID:28514442 more ...
Pgk2	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgk2	Rat	gluconeogenesis pathway		IEA		6907045		KEGG	rno:00010
Pgk2	Rat	glycolysis pathway		IEA		6907045		KEGG	rno:00010
Pgk2	Rat	glycolysis/gluconeogenesis pathway		IEA		6907045		KEGG	rno:00010

BioCyc Pathways

gluconeogenesis III	glycolysis III (from glucose)

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:2823118	PMID:12477932	PMID:16687649	PMID:19759366	PMID:21630459	PMID:23533145	PMID:25002582

Pgk2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	27,976,913 - 27,978,479 (+)	NCBI		GRCr8
mRatBN7.2	9	20,480,367 - 20,481,933 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	20,480,203 - 20,571,481 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	29,010,916 - 29,012,482 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	34,114,730 - 34,116,296 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	32,425,549 - 32,427,115 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	24,095,774 - 24,097,340 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	24,095,751 - 24,097,337 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	22,956,349 - 22,957,915 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	16,705,747 - 16,707,313 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	16,703,068 - 16,704,633 (+)	NCBI
Celera	9	18,123,078 - 18,124,644 (+)	NCBI		Celera
Cytogenetic Map	9	q13	NCBI

PGK2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	49,785,660 - 49,787,285 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	49,785,660 - 49,787,285 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	49,753,373 - 49,754,998 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	49,861,323 - 49,862,966 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	49,861,324 - 49,862,966	NCBI
Celera	6	51,309,449 - 51,311,138 (-)	NCBI		Celera
Cytogenetic Map	6	p12.3	NCBI
HuRef	6	49,483,695 - 49,485,384 (-)	NCBI		HuRef
CHM1_1	6	49,756,278 - 49,757,967 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	49,627,627 - 49,629,252 (-)	NCBI		T2T-CHM13v2.0

Pgk2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	40,517,909 - 40,519,500 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	40,517,906 - 40,519,531 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	40,207,018 - 40,208,609 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	40,207,015 - 40,208,640 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	40,343,963 - 40,345,554 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	39,670,497 - 39,672,026 (-)	NCBI		MGSCv36	mm8
Celera	17	43,614,083 - 43,615,674 (-)	NCBI		Celera
Cytogenetic Map	17	B2	NCBI
cM Map	17	19.44	NCBI

Pgk2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955411	8,216,432 - 8,218,065 (+)	NCBI	ChiLan1.0	ChiLan1.0

PGK2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	64,255,058 - 64,270,523 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	60,120,713 - 60,136,179 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	49,355,154 - 49,356,804 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	50,615,916 - 50,617,599 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	50,616,199 - 50,617,452 (-)	Ensembl	panpan1.1		panPan2

PGK2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	17,616,653 - 17,622,073 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	17,610,662 - 17,622,324 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	17,512,676 - 17,518,089 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	18,110,850 - 18,116,264 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	18,104,848 - 18,116,522 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	17,629,958 - 17,635,375 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	17,736,007 - 17,741,431 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	17,865,686 - 17,871,100 (-)	NCBI		UU_Cfam_GSD_1.0

PGK2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	43,839,241 - 43,840,892 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	43,839,239 - 43,840,892 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	50,231,411 - 50,233,064 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	7	q14-q15	NCBI

PGK2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	22,619,062 - 22,621,157 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	22,619,615 - 22,620,868 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	49,758,034 - 49,759,685 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pgk2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624799	14,621,673 - 14,622,926 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624799	14,621,413 - 14,623,050 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pgk2
5 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	188
Count of miRNA genes:	127
Interacting mature miRNAs:	137
Transcripts:	ENSRNOT00000018177
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631211	Bw4	Body weight QTL4	5.31		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	9	5109826	50109826	Rat
2303559	Gluco54	Glucose level QTL 54	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	1254084	46254084	Rat
7411609	Foco16	Food consumption QTL 16	25.6	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	8952560	53952560	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
61450	Ciaa3	CIA Autoantibody QTL 3	6.5		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	9	7954720	22071169	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	1	37999212	Rat
1641911	Alcrsp13	Alcohol response QTL 13			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	1	43718459	Rat
1354650	Despr5	Despair related QTL 5	4.01	0.0017	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	9	1254084	46254084	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	40594091	Rat
61425	Cia15	Collagen induced arthritis QTL 15	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	9	5109826	42921101	Rat
70226	Eae4	Experimental allergic encephalomyelitis QTL 4			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	9	1	25661317	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	1	37999212	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
724543	Cm20	Cardiac mass QTL 20	3.9		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	16961398	40594091	Rat
1600365	Mcs20	Mammary carcinoma susceptibility QTL 20	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	9	13533770	42791750	Rat
11353947	Bp392	Blood pressure QTL 392			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	7283252	52283252	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	1	37999212	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
1298088	Edpm11	Estrogen-dependent pituitary mass QTL 11	2.5		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	1	43718459	Rat
9589133	Insul26	Insulin level QTL 26	17.96	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	9	8952560	53952560	Rat

BE106404

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	20,481,700 - 20,481,851 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	24,097,108 - 24,097,258	NCBI	Rnor6.0
Rnor_5.0	9	22,957,683 - 22,957,833	UniSTS	Rnor5.0
RGSC_v3.4	9	16,707,081 - 16,707,231	UniSTS	RGSC3.4
Celera	9	18,124,412 - 18,124,562	UniSTS
RH 3.4 Map	9	175.5	UniSTS
Cytogenetic Map	9	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
2	7	2	17	15	18	12	8	12	40	16	16	5	27	6


RefSeq Transcripts	NM_001012130	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC134725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018177 ⟹ ENSRNOP00000018177

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	20,480,203 - 20,554,260 (+)	Ensembl
Rnor_6.0 Ensembl	9	24,095,751 - 24,097,337 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112647 ⟹ ENSRNOP00000094932

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	20,480,203 - 20,555,169 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115954 ⟹ ENSRNOP00000081650

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	20,480,203 - 20,571,481 (+)	Ensembl

RefSeq Acc Id:

NM_001012130 ⟹ NP_001012130

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	27,976,913 - 27,978,479 (+)	NCBI
mRatBN7.2	9	20,480,367 - 20,481,933 (+)	NCBI
Rnor_6.0	9	24,095,774 - 24,097,340 (+)	NCBI
Rnor_5.0	9	22,956,349 - 22,957,915 (+)	NCBI
RGSC_v3.4	9	16,705,747 - 16,707,313 (+)	RGD
Celera	9	18,123,078 - 18,124,644 (+)	RGD

Sequence:

show sequence

CCGAGACAGCCTCCCGGCAGAGGTTGTCACTCAGCATACCATCAAAATGGCTCTTTCTAGTAAGTTGACTCTGGACAAAGTGGATGTTAAGGAAAAAAGAGTCATCATGAGAGTAGATTTCAACGTTC
CCATGAAGAATAACCAAATTACAAACAACCAGAGAATCAAGGCTGCCATCCCAAGCATCAAATACTGTCTGGACAATGGAGCCACGTCCGTAGTTCTCATGAGTCACCTCGGCCGGCCTGATGGTATC
CCCATGCCGGACAAATACTCATTACAGCCTGTTGCTGCTGAGCTCAAGTCCCTACTGAACAAGGACGTTATATTCTTAAAGGACTGTGTGGGCTCTGAAATAGAGAAAGCCTGTGCCAACCCAGGTAA
AGGCTCTGTAATCCTTCTGGAGAACCTGCGCTTTCATGTGGAGGAAGAAGGGAAGGGTAAAGATGCTTCTGGACAAAAGATTACCGCTGAGCCTGATAAAGTGGAAGCCTTCCGAGCTTCACTGTCCA
AACTCGGTGATGTCTACGTCAACGATGCTTTTGGCACTGCACATCGGGCTCACAGTTCCATGGTGGGAATAAATTTGCCCCAGAAGGCATCTGGGTTCCTCATGAAGAAGGAGCTAGATTATTTTTCC
AAGGTCTTAGAAAAGCCAGAGAGGCCCTTCCTGGCTATTCTTGGTGGAGCCAAAGTGACAGACAAGATCCAACTTATCAAAAATATGTTAGACAAAGTCAATTTCATGATTATTGGTGGTGCGATGGC
TTTCACCTTCCTGAAAGAACTCAAGAACATGAAGATTGGTGCTTCCTTGTTTGATGAAGACGGAGCCAAGATCGTCAAAGAGATCATGGACAAGGCAGAAAAGAATGGCGTAAAGATAACCTTTCCTG
TTGACTTTGTTACCGGTGACAAGTTTGATGAGCATGCTAAAGTTGGACAAGCCACTGTAGAATCTGGTATACCATCTGGCTGGATGGGTTTGGATTGCGGCCCTGAGAGCATTAAAAACAATGCTCAA
ATTGTGGCCCAAGCAAAGCTGATTGTTTGGAATGGACCTCTGGGGGTATTTGAATGGGATGGCTTTGCTAAGGGAACCAAAGCCCTCATGGATGAAGTTGTAAAGGCCACCTCCAATGGCTGTATCAC
CATCATAGGAGGCGGGGACACTGCTACTTGCTGTGCCAAATGGAACACTGAAGACAAGGTCAGCCATGTGAGCACAGGAGGCGGGGCAAGTCTTGAGCTTCTGGAAGGCAAAACCCTTCCAGGGGTAG
AGGCCCTCAGCAACATGTAATTGTCATAATGCATTTGCTTCCTGTTTCCTGCGATCAGTGCCAGAACCAATTCAGTGCTTTTACATCTCAACCTAACCTTGTCTCAATGTTGGTTAACATCTACTCGG
TATCAAGACCCAGGTAAAGGGCTAGCAGTGAGCCGTATCAGCCCATCTTAATTCTGTCACGCCTTTGTTAGCCTCTTCAAGATCTCATCAGGATTCCCCACAGTCCTTCCTAGGGAGAAACCATTCTC
GTGTCAACTATTAAAGAACTGAGCTGAGTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001012130	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83568	(Get FASTA)	NCBI Sequence Viewer
	EDM18667	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018177.4
	ENSRNOP00000081650
	ENSRNOP00000081650.1
	ENSRNOP00000094932.1

RefSeq Acc Id:

NP_001012130 ⟸ NM_001012130

- UniProtKB:

Q5XIV1 (UniProtKB/TrEMBL), A6JJ65 (UniProtKB/TrEMBL), A0A8I5ZS38 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALSSKLTLDKVDVKEKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKYCLDNGATSVVLMSHLGRPDGIPMPDKYSLQPVAAELKSLLNKDVIFLKDCVGSEIEKACANPGKGSVILLENLRFHVEE
EGKGKDASGQKITAEPDKVEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGINLPQKASGFLMKKELDYFSKVLEKPERPFLAILGGAKVTDKIQLIKNMLDKVNFMIIGGAMAFTFLKELKNMKIGAS
LFDEDGAKIVKEIMDKAEKNGVKITFPVDFVTGDKFDEHAKVGQATVESGIPSGWMGLDCGPESIKNNAQIVAQAKLIVWNGPLGVFEWDGFAKGTKALMDEVVKATSNGCITIIGGGDTATCCAKWN
TEDKVSHVSTGGGASLELLEGKTLPGVEALSNM

hide sequence

Ensembl Acc Id:

ENSRNOP00000018177 ⟸ ENSRNOT00000018177

Ensembl Acc Id:

ENSRNOP00000081650 ⟸ ENSRNOT00000115954

Ensembl Acc Id:

ENSRNOP00000094932 ⟸ ENSRNOT00000112647

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIV1-F1-model_v2	AlphaFold	Q5XIV1	1-417	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696569

Promoter ID:

EPDNEW_R7093

Type:

initiation region

Name:

Pgk2_1

Description:

phosphoglycerate kinase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	24,095,792 - 24,095,852	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-28071	BioCyc
BioCyc Pathway	ANAGLYCOLYSIS-PWY [glycolysis III (from glucose)]	BioCyc
	PWY66-399 [gluconeogenesis III]	BioCyc
BioCyc Pathway Image	ANAGLYCOLYSIS-PWY	BioCyc
	PWY66-399	BioCyc
Ensembl Genes	ENSRNOG00000013600	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018177.6	UniProtKB/TrEMBL
	ENSRNOT00000112647.1	UniProtKB/TrEMBL
	ENSRNOT00000115954	ENTREZGENE
	ENSRNOT00000115954.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.1260	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7111073	IMAGE-MGC_LOAD
InterPro	Phosphoglycerate_kinase	UniProtKB/TrEMBL
	Phosphoglycerate_kinase_CS	UniProtKB/TrEMBL
	Phosphoglycerate_kinase_N	UniProtKB/TrEMBL
	Phosphoglycerate_kinase_sf	UniProtKB/TrEMBL
KEGG Report	rno:316265	UniProtKB/TrEMBL
MGC_CLONE	MGC:93835	IMAGE-MGC_LOAD
NCBI Gene	316265	ENTREZGENE
PANTHER	PGK	UniProtKB/TrEMBL
	PHOSPHOGLYCERATE KINASE 2	UniProtKB/TrEMBL
Pfam	PGK	UniProtKB/TrEMBL
PhenoGen	Pgk2	PhenoGen
PIRSF	Pgk	UniProtKB/TrEMBL
PRINTS	PHGLYCKINASE	UniProtKB/TrEMBL
PROSITE	PGLYCERATE_KINASE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013600	RatGTEx
Superfamily-SCOP	PGK	UniProtKB/TrEMBL
UniProt	A0A8I5ZS38	ENTREZGENE, UniProtKB/TrEMBL
	A6JJ65	ENTREZGENE
	Q5XIV1	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A6JJ65	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Pgk2	phosphoglycerate kinase 2	Pgk2_predicted	phosphoglycerate kinase 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Pgk2_predicted	phosphoglycerate kinase 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Annotations - KEGG (archival)

BioCyc Pathways