Symbol:
Usp53
Name:
ubiquitin specific peptidase 53
RGD ID:
1306615
Description:
Predicted to enable K63-linked deubiquitinase activity. Predicted to be involved in response to auditory stimulus and sensory perception of sound. Predicted to act upstream of or within action potential; epithelial cell apoptotic process; and outer hair cell apoptotic process. Predicted to be located in bicellular tight junction. Predicted to be active in cell-cell junction. Human ortholog(s) of this gene implicated in progressive familial intrahepatic cholestasis. Orthologous to human USP53 (ubiquitin specific peptidase 53); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
inactive ubiquitin carboxyl-terminal hydrolase 53; LOC295425; ubiquitin specific protease 53
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 213,744,106 - 213,805,619 (-) NCBI GRCr8 mRatBN7.2 2 211,059,512 - 211,120,942 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 211,059,520 - 211,120,943 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 218,737,119 - 218,798,537 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 216,644,894 - 216,706,326 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 211,491,226 - 211,552,659 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 227,098,795 - 227,160,385 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 227,098,795 - 227,160,379 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 246,460,175 - 246,521,772 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 219,620,238 - 219,681,958 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 219,585,547 - 219,629,826 (-) NCBI Celera 2 203,488,517 - 203,550,236 (-) NCBI Celera Cytogenetic Map 2 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp53 Rat (1->4)-beta-D-glucan multiple interactions ISO Usp53 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP53 mRNA CTD PMID:36331819 Usp53 Rat 1,2-dimethylhydrazine decreases expression ISO Usp53 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP53 mRNA CTD PMID:22206623 Usp53 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO USP53 (Homo sapiens) 6480464 2 more ... CTD PMID:31173147 Usp53 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO USP53 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Usp53 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO USP53 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP53 mRNA CTD PMID:20106945 Usp53 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP53 mRNA CTD PMID:33387578 Usp53 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO USP53 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of USP53 mRNA CTD PMID:22574217 Usp53 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp53 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP53 mRNA CTD PMID:21570461 and PMID:28213091 Usp53 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Usp53 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of USP53 mRNA CTD PMID:18691609 Usp53 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Usp53 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of USP53 mRNA CTD PMID:26251327 Usp53 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO USP53 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP53 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of USP53 mRNA CTD PMID:28628672 Usp53 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of USP53 mRNA CTD PMID:30723492 Usp53 Rat 4,4'-sulfonyldiphenol multiple interactions ISO USP53 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of USP53 mRNA CTD PMID:28628672 Usp53 Rat 4,4'-sulfonyldiphenol increases expression ISO Usp53 (Mus musculus) 6480464 bisphenol S results in increased expression of USP53 mRNA CTD PMID:30951980 and PMID:39298647 Usp53 Rat 4-hydroxyphenyl retinamide increases expression ISO Usp53 (Mus musculus) 6480464 Fenretinide results in increased expression of USP53 mRNA CTD PMID:28973697 Usp53 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of USP53 mRNA CTD PMID:28959563 Usp53 Rat aflatoxin B1 decreases methylation ISO USP53 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of USP53 gene CTD PMID:27153756 Usp53 Rat all-trans-retinoic acid increases expression ISO USP53 (Homo sapiens) 6480464 Tretinoin results in increased expression of USP53 mRNA CTD PMID:21934132 Usp53 Rat arsenite(3-) multiple interactions ISO USP53 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to USP53 mRNA] CTD PMID:32406909 Usp53 Rat benzo[a]pyrene affects methylation ISO USP53 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of USP53 promoter CTD PMID:27901495 Usp53 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of USP53 mRNA CTD PMID:25181051 Usp53 Rat bisphenol A decreases methylation ISO USP53 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of USP53 gene CTD PMID:31601247 Usp53 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP53 mRNA CTD PMID:33296240 Usp53 Rat bisphenol A decreases expression ISO USP53 (Homo sapiens) 6480464 bisphenol A results in decreased expression of USP53 mRNA CTD PMID:29275510 Usp53 Rat bisphenol A multiple interactions ISO USP53 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP53 mRNA CTD PMID:28628672 Usp53 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of USP53 gene CTD PMID:28505145 Usp53 Rat bisphenol F increases expression ISO Usp53 (Mus musculus) 6480464 bisphenol F results in increased expression of USP53 mRNA CTD PMID:30951980 and PMID:38685157 Usp53 Rat bortezomib increases expression ISO USP53 (Homo sapiens) 6480464 Bortezomib results in increased expression of USP53 mRNA CTD PMID:20977926 Usp53 Rat cadmium atom multiple interactions ISO Usp53 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP53 mRNA CTD PMID:37325564 Usp53 Rat cadmium dichloride multiple interactions ISO Usp53 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of USP53 mRNA CTD PMID:37325564 Usp53 Rat calcitriol increases expression ISO USP53 (Homo sapiens) 6480464 Calcitriol results in increased expression of USP53 mRNA CTD PMID:26485663 Usp53 Rat carbamazepine affects expression ISO USP53 (Homo sapiens) 6480464 Carbamazepine affects the expression of USP53 mRNA CTD PMID:25979313 Usp53 Rat CGP 52608 multiple interactions ISO USP53 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP53 gene] CTD PMID:28238834 Usp53 Rat chlorpyrifos decreases expression ISO Usp53 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of USP53 mRNA CTD PMID:37019170 Usp53 Rat choline multiple interactions ISO Usp53 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of USP53 gene CTD PMID:20938992 Usp53 Rat cisplatin increases expression ISO USP53 (Homo sapiens) 6480464 Cisplatin results in increased expression of USP53 mRNA CTD PMID:27594783 Usp53 Rat cisplatin multiple interactions ISO USP53 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of USP53 mRNA CTD PMID:27392435 Usp53 Rat cisplatin decreases expression ISO USP53 (Homo sapiens) 6480464 Cisplatin results in decreased expression of USP53 mRNA CTD PMID:27392435 Usp53 Rat copper atom multiple interactions ISO USP53 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of USP53 mRNA CTD PMID:20971185 Usp53 Rat copper(0) multiple interactions ISO USP53 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of USP53 mRNA CTD PMID:20971185 Usp53 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of USP53 mRNA CTD PMID:27523638 Usp53 Rat dexamethasone increases expression ISO USP53 (Homo sapiens) 6480464 Dexamethasone results in increased expression of USP53 mRNA CTD PMID:25047013 Usp53 Rat dexamethasone multiple interactions ISO USP53 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP53 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of USP53 mRNA CTD PMID:28628672 Usp53 Rat diallyl trisulfide increases expression ISO USP53 (Homo sapiens) 6480464 diallyl trisulfide results in increased expression of USP53 mRNA CTD PMID:34995734 Usp53 Rat dibutyl phthalate increases expression ISO Usp53 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of USP53 mRNA CTD PMID:21266533 Usp53 Rat dicrotophos decreases expression ISO USP53 (Homo sapiens) 6480464 dicrotophos results in decreased expression of USP53 mRNA CTD PMID:28302478 Usp53 Rat dioxygen increases expression ISO Usp53 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of USP53 mRNA CTD PMID:20880076 Usp53 Rat ethanol multiple interactions ISO USP53 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of USP53 mRNA CTD PMID:23378141 Usp53 Rat ethanol increases expression ISO Usp53 (Mus musculus) 6480464 Ethanol results in increased expression of USP53 mRNA CTD PMID:30319688 Usp53 Rat ethanol affects expression ISO Usp53 (Mus musculus) 6480464 Ethanol affects the expression of USP53 mRNA CTD PMID:30319688 Usp53 Rat fluoranthene multiple interactions ISO Usp53 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of USP53 mRNA CTD PMID:28329830 Usp53 Rat folic acid affects expression ISO USP53 (Homo sapiens) 6480464 Folic Acid affects the expression of USP53 mRNA CTD PMID:17320366 Usp53 Rat folic acid multiple interactions ISO USP53 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of USP53 mRNA CTD PMID:23378141 Usp53 Rat folic acid multiple interactions ISO Usp53 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of USP53 gene CTD PMID:20938992 Usp53 Rat formaldehyde increases expression ISO USP53 (Homo sapiens) 6480464 Formaldehyde results in increased expression of USP53 mRNA CTD PMID:20655997 Usp53 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP53 mRNA CTD PMID:33387578 Usp53 Rat indometacin multiple interactions ISO USP53 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of USP53 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of USP53 mRNA CTD PMID:28628672 Usp53 Rat L-methionine multiple interactions ISO Usp53 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of USP53 gene CTD PMID:20938992 Usp53 Rat melphalan decreases expression ISO USP53 (Homo sapiens) 6480464 Melphalan results in decreased expression of USP53 mRNA CTD PMID:22363485 Usp53 Rat mercury atom decreases expression ISO Usp53 (Mus musculus) 6480464 Mercury analog results in decreased expression of USP53 mRNA CTD PMID:25056781 Usp53 Rat mercury(0) decreases expression ISO Usp53 (Mus musculus) 6480464 Mercury analog results in decreased expression of USP53 mRNA CTD PMID:25056781 Usp53 Rat methylmercury chloride decreases expression ISO USP53 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of USP53 mRNA CTD PMID:23179753 more ... Usp53 Rat paracetamol increases expression ISO USP53 (Homo sapiens) 6480464 Acetaminophen results in increased expression of USP53 mRNA CTD PMID:26690555 Usp53 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of USP53 mRNA CTD PMID:33387578 Usp53 Rat perfluorohexanesulfonic acid increases expression ISO Usp53 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of USP53 mRNA CTD PMID:37995155 Usp53 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp53 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP53 mRNA CTD PMID:36331819 Usp53 Rat phenobarbital affects expression ISO Usp53 (Mus musculus) 6480464 Phenobarbital affects the expression of USP53 mRNA CTD PMID:23091169 Usp53 Rat progesterone decreases expression ISO USP53 (Homo sapiens) 6480464 Progesterone results in decreased expression of USP53 mRNA CTD PMID:21540246 Usp53 Rat silicon dioxide decreases expression ISO USP53 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of USP53 mRNA CTD PMID:25895662 Usp53 Rat sodium arsenite decreases expression ISO USP53 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of USP53 mRNA CTD PMID:34032870 Usp53 Rat sodium arsenite decreases expression ISO Usp53 (Mus musculus) 6480464 sodium arsenite results in decreased expression of USP53 mRNA CTD PMID:37682722 Usp53 Rat testosterone decreases expression ISO USP53 (Homo sapiens) 6480464 Testosterone results in decreased expression of USP53 mRNA CTD PMID:33359661 Usp53 Rat tetrachloromethane increases expression ISO Usp53 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of USP53 mRNA CTD PMID:31919559 Usp53 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of USP53 mRNA CTD PMID:23411599 and PMID:34492290 Usp53 Rat thiram increases expression ISO USP53 (Homo sapiens) 6480464 Thiram results in increased expression of USP53 mRNA CTD PMID:38568856 Usp53 Rat titanium dioxide decreases methylation ISO Usp53 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP53 gene and titanium dioxide results in decreased methylation of USP53 promoter CTD PMID:35295148 Usp53 Rat trichostatin A increases expression ISO USP53 (Homo sapiens) 6480464 trichostatin A results in increased expression of USP53 mRNA CTD PMID:26705709 Usp53 Rat triphenyl phosphate affects expression ISO USP53 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP53 mRNA CTD PMID:37042841 Usp53 Rat triptonide increases expression ISO Usp53 (Mus musculus) 6480464 triptonide results in increased expression of USP53 mRNA CTD PMID:33045310 Usp53 Rat urethane increases expression ISO USP53 (Homo sapiens) 6480464 Urethane results in increased expression of USP53 mRNA CTD PMID:28818685 Usp53 Rat valproic acid affects expression ISO Usp53 (Mus musculus) 6480464 Valproic Acid affects the expression of USP53 mRNA CTD PMID:17292431 Usp53 Rat valproic acid increases expression ISO USP53 (Homo sapiens) 6480464 Valproic Acid results in increased expression of USP53 mRNA CTD PMID:28001369 Usp53 Rat valproic acid affects expression ISO USP53 (Homo sapiens) 6480464 Valproic Acid affects the expression of USP53 mRNA CTD PMID:25979313 Usp53 Rat vorinostat increases expression ISO USP53 (Homo sapiens) 6480464 vorinostat results in increased expression of USP53 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bortezomib (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbamazepine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) dexamethasone (ISO) diallyl trisulfide (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dioxygen (ISO) ethanol (ISO) fluoranthene (ISO) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP) indometacin (ISO) L-methionine (ISO) melphalan (ISO) mercury atom (ISO) mercury(0) (ISO) methylmercury chloride (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) progesterone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
Usp53 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 213,744,106 - 213,805,619 (-) NCBI GRCr8 mRatBN7.2 2 211,059,512 - 211,120,942 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 211,059,520 - 211,120,943 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 218,737,119 - 218,798,537 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 216,644,894 - 216,706,326 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 211,491,226 - 211,552,659 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 227,098,795 - 227,160,385 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 227,098,795 - 227,160,379 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 246,460,175 - 246,521,772 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 219,620,238 - 219,681,958 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 219,585,547 - 219,629,826 (-) NCBI Celera 2 203,488,517 - 203,550,236 (-) NCBI Celera Cytogenetic Map 2 q42 NCBI
USP53 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 119,212,601 - 119,295,518 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 119,212,587 - 119,295,518 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 120,133,868 - 120,216,673 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 120,353,230 - 120,436,121 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 117,495,374 - 117,578,263 (+) NCBI Celera Cytogenetic Map 4 q26 NCBI HuRef 4 115,855,506 - 115,938,506 (+) NCBI HuRef CHM1_1 4 120,110,269 - 120,193,235 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 122,517,672 - 122,600,620 (+) NCBI T2T-CHM13v2.0
Usp53 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 122,725,142 - 122,778,184 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 122,725,142 - 122,778,159 (-) Ensembl GRCm39 Ensembl GRCm38 3 122,931,486 - 122,984,900 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 122,931,493 - 122,984,510 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 122,636,519 - 122,687,365 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 122,925,623 - 122,976,469 (-) NCBI MGSCv36 mm8 Celera 3 129,344,003 - 129,395,480 (-) NCBI Celera Cytogenetic Map 3 G1 NCBI cM Map 3 53.75 NCBI
Usp53 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 20,957,807 - 21,023,380 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 20,957,807 - 21,023,380 (-) NCBI ChiLan1.0 ChiLan1.0
USP53 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 116,995,738 - 117,072,253 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 117,292,627 - 117,369,139 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 111,407,037 - 111,483,541 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 121,957,504 - 122,033,818 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 121,984,659 - 122,031,531 (+) Ensembl panpan1.1 panPan2
USP53 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 38,148,120 - 38,213,370 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 38,163,790 - 38,211,181 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 3,861,879 - 3,927,111 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 38,369,269 - 38,434,855 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 38,369,244 - 38,434,063 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 38,391,722 - 38,456,913 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 38,115,130 - 38,180,517 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 1,619,003 - 1,684,079 (-) NCBI UU_Cfam_GSD_1.0
Usp53
USP53 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 104,500,252 - 104,560,513 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 104,500,204 - 104,560,711 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 112,155,287 - 112,216,729 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP53 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 66,698,816 - 66,775,650 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 66,724,297 - 66,773,354 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 45,558,490 - 45,639,801 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 662 Count of miRNA genes: 266 Interacting mature miRNAs: 336 Transcripts: ENSRNOT00000066581 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1598813 Memor9 Memory QTL 9 2.7 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 199341726 234244620 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 202446871 237938339 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631203 Gluco14 Glucose level QTL 14 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 2 206665645 219003804 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 2299161 Iddm33 Insulin dependent diabetes mellitus QTL 33 2.98 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 206312063 220876787 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat
RH143790
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 211,059,276 - 211,059,398 (+) MAPPER mRatBN7.2 Rnor_6.0 2 227,098,839 - 227,098,960 NCBI Rnor6.0 Rnor_5.0 2 246,460,219 - 246,460,340 UniSTS Rnor5.0 RGSC_v3.4 2 219,620,282 - 219,620,403 UniSTS RGSC3.4 Celera 2 203,488,561 - 203,488,682 UniSTS RH 3.4 Map 2 1538.2 UniSTS Cytogenetic Map 2 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066581 ⟹ ENSRNOP00000063338
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 211,059,520 - 211,120,943 (-) Ensembl Rnor_6.0 Ensembl 2 227,098,795 - 227,160,379 (-) Ensembl
RefSeq Acc Id:
NM_001389268 ⟹ NP_001376197
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 213,744,106 - 213,805,308 (-) NCBI mRatBN7.2 2 211,059,512 - 211,120,718 (-) NCBI
RefSeq Acc Id:
XM_017590782 ⟹ XP_017446271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 213,744,106 - 213,805,619 (-) NCBI mRatBN7.2 2 211,059,512 - 211,120,940 (-) NCBI Rnor_6.0 2 227,099,074 - 227,160,385 (-) NCBI
Sequence:
GCGAGGGAGGGCGGGGTCCAGAGACCTGTTGATTGCAGGTGTCACTGCCCAGACTGGCCCCTGGGTTTGGGGCGTGCGCGCATGCTCTGCGCGGGTCCGGCGGCTGAGAGCGGCGGTGGGGCAGTCTG
hide sequence
RefSeq Acc Id:
XM_039102091 ⟹ XP_038958019
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 213,745,939 - 213,805,590 (-) NCBI mRatBN7.2 2 211,062,231 - 211,120,942 (-) NCBI
RefSeq Acc Id:
XM_063281661 ⟹ XP_063137731
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 213,744,106 - 213,786,771 (-) NCBI
RefSeq Acc Id:
XR_010063594
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 213,746,900 - 213,805,590 (-) NCBI
RefSeq Acc Id:
XP_017446271 ⟸ XM_017590782
- Peptide Label:
isoform X1
- UniProtKB:
D3ZYY9 (UniProtKB/TrEMBL)
- Sequence:
MAWVKFLRKPSGNLGKAYPAGSLLSLAPTVGLLNEPGQNSCFLNSAVQVLWQLDIFRRSLRVLTGHICQGDACIFCALKTIFAQFQHSREKALPSDNIRHALAESFKDEQRFQLGLMDDAAECFENIL
hide sequence
Ensembl Acc Id:
ENSRNOP00000063338 ⟸ ENSRNOT00000066581
RefSeq Acc Id:
NP_001376197 ⟸ NM_001389268
- UniProtKB:
D3ZYY9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038958019 ⟸ XM_039102091
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063137731 ⟸ XM_063281661
- Peptide Label:
isoform X2
RGD ID: 13691730 Promoter ID: EPDNEW_R2255 Type: initiation region Name: Usp53_1 Description: ubiquitin specific peptidase 53 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 227,160,293 - 227,160,353 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Usp53
ubiquitin specific peptidase 53
Usp53_predicted
ubiquitin specific protease 53 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Usp53_predicted
ubiquitin specific protease 53 (predicted)
Symbol and Name status set to approved
70820 APPROVED
