Symbol:
Pik3c2b
Name:
phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta
RGD ID:
1306541
Description:
Predicted to enable 1-phosphatidylinositol-3-kinase activity and 1-phosphatidylinositol-4-phosphate 3-kinase activity. Predicted to be involved in cell migration; intracellular signal transduction; and phosphatidylinositol-3-phosphate biosynthetic process. Predicted to act upstream of or within autophagosome organization and cellular response to starvation. Predicted to be located in cytosol; endocytic vesicle; and nucleus. Predicted to be active in cytoplasm and plasma membrane. Orthologous to human PIK3C2B (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta); PARTICIPATES IN inositol phosphate metabolic pathway; phosphatidylinositol 3-kinase signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC289021; nuclear cap binding protein subunit 2; phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta; phosphoinositide-3-kinase, class 2 beta polypeptide; phosphoinositide-3-kinase, class 2, beta polypeptide
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PIK3C2B (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pik3c2b (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pik3c2b (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PIK3C2B (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PIK3C2B (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pik3c2b (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PIK3C2B (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PIK3C2B (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pik3c2b (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MTIF3 (mitochondrial translational initiation factor 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PIK3C2B (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pik3c2b (phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pik3c2b (phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
piki-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pi3K68D
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 47,046,866 - 47,107,733 (+) NCBI GRCr8 mRatBN7.2 13 44,494,673 - 44,555,663 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 44,495,050 - 44,555,612 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 47,101,804 - 47,160,253 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 48,389,909 - 48,448,360 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 45,650,489 - 45,709,098 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 49,848,939 - 49,909,404 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 49,850,189 - 49,911,202 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 54,919,438 - 54,977,791 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 45,954,337 - 46,013,206 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 45,987,757 - 46,027,587 (+) NCBI Celera 13 44,829,361 - 44,887,236 (+) NCBI Celera Cytogenetic Map 13 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pik3c2b Rat 1,2-dimethylhydrazine decreases expression ISO Pik3c2b (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PIK3C2B mRNA CTD PMID:22206623 Pik3c2b Rat 17beta-estradiol multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PIK3C2B mRNA CTD PMID:30165855 Pik3c2b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PIK3C2B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3C2B mRNA CTD PMID:26238291 Pik3c2b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3C2B mRNA CTD PMID:33387578 Pik3c2b Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:32119087 Pik3c2b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PIK3C2B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of PIK3C2B mRNA CTD PMID:28628672 Pik3c2b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PIK3C2B mRNA CTD PMID:24780913 and PMID:25825206 Pik3c2b Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PIK3C2B mRNA CTD PMID:31881176 Pik3c2b Rat afimoxifene multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in decreased expression of PIK3C2B mRNA] CTD PMID:21233418 Pik3c2b Rat all-trans-retinoic acid decreases expression ISO PIK3C2B (Homo sapiens) 6480464 Tretinoin results in decreased expression of PIK3C2B mRNA CTD PMID:33167477 Pik3c2b Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PIK3C2B mRNA CTD PMID:30779732 Pik3c2b Rat benzene-1,2,4-triol decreases expression ISO PIK3C2B (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of PIK3C2B mRNA CTD PMID:39245080 Pik3c2b Rat benzo[a]pyrene decreases expression ISO PIK3C2B (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PIK3C2B mRNA CTD PMID:26238291 Pik3c2b Rat benzo[a]pyrene diol epoxide I decreases expression ISO PIK3C2B (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Pik3c2b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PIK3C2B mRNA CTD PMID:25181051 more ... Pik3c2b Rat bisphenol A multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PIK3C2B mRNA CTD PMID:28628672 Pik3c2b Rat buta-1,3-diene decreases expression ISO Pik3c2b (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of PIK3C2B mRNA CTD PMID:29038090 Pik3c2b Rat captan increases expression ISO Pik3c2b (Mus musculus) 6480464 Captan results in increased expression of PIK3C2B mRNA CTD PMID:31558096 Pik3c2b Rat CGP 52608 multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PIK3C2B gene] CTD PMID:28238834 Pik3c2b Rat chenodeoxycholic acid multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA CTD PMID:32152650 Pik3c2b Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of PIK3C2B mRNA CTD PMID:23125180 Pik3c2b Rat cisplatin decreases response to substance ISO PIK3C2B (Homo sapiens) 6480464 PIK3C2B results in decreased susceptibility to Cisplatin CTD PMID:21986133 Pik3c2b Rat cisplatin multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PIK3C2B mRNA CTD PMID:27392435 Pik3c2b Rat cisplatin increases expression ISO PIK3C2B (Homo sapiens) 6480464 Cisplatin results in increased expression of PIK3C2B mRNA CTD PMID:27392435 Pik3c2b Rat clobetasol decreases expression ISO Pik3c2b (Mus musculus) 6480464 Clobetasol results in decreased expression of PIK3C2B mRNA CTD PMID:27462272 Pik3c2b Rat clothianidin decreases expression ISO PIK3C2B (Homo sapiens) 6480464 clothianidin results in decreased expression of PIK3C2B mRNA CTD PMID:31626844 Pik3c2b Rat copper(II) chloride decreases expression ISO PIK3C2B (Homo sapiens) 6480464 cupric chloride results in decreased expression of PIK3C2B mRNA CTD PMID:38568856 Pik3c2b Rat copper(II) sulfate decreases expression ISO PIK3C2B (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PIK3C2B mRNA CTD PMID:19549813 Pik3c2b Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PIK3C2B mRNA CTD PMID:26577399 Pik3c2b Rat cyclosporin A decreases expression ISO PIK3C2B (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PIK3C2B mRNA CTD PMID:20106945 and PMID:25562108 Pik3c2b Rat cyclosporin A multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA CTD PMID:32152650 Pik3c2b Rat deoxycholic acid multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA CTD PMID:32152650 Pik3c2b Rat dexamethasone increases expression ISO PIK3C2B (Homo sapiens) 6480464 Dexamethasone results in increased expression of PIK3C2B mRNA CTD PMID:25047013 Pik3c2b Rat dexamethasone multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PIK3C2B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of PIK3C2B mRNA CTD PMID:28628672 Pik3c2b Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PIK3C2B mRNA CTD PMID:21266533 Pik3c2b Rat dicrotophos increases expression ISO PIK3C2B (Homo sapiens) 6480464 dicrotophos results in increased expression of PIK3C2B mRNA CTD PMID:28302478 Pik3c2b Rat disodium selenite increases expression ISO PIK3C2B (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PIK3C2B mRNA CTD PMID:18175754 Pik3c2b Rat doxorubicin decreases expression ISO PIK3C2B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PIK3C2B mRNA CTD PMID:29803840 Pik3c2b Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of PIK3C2B mRNA CTD PMID:29391264 Pik3c2b Rat fenpyroximate decreases expression ISO PIK3C2B (Homo sapiens) 6480464 fenpyroximate results in decreased expression of PIK3C2B mRNA CTD PMID:33512557 Pik3c2b Rat folpet increases expression ISO Pik3c2b (Mus musculus) 6480464 folpet results in increased expression of PIK3C2B mRNA CTD PMID:31558096 Pik3c2b Rat fonofos increases methylation ISO PIK3C2B (Homo sapiens) 6480464 Fonofos results in increased methylation of PIK3C2B promoter CTD PMID:22847954 Pik3c2b Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PIK3C2B mRNA CTD PMID:22061828 Pik3c2b Rat glycochenodeoxycholic acid multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA CTD PMID:32152650 Pik3c2b Rat glycocholic acid multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA CTD PMID:32152650 Pik3c2b Rat glycodeoxycholic acid multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA CTD PMID:32152650 Pik3c2b Rat indometacin multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PIK3C2B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of PIK3C2B mRNA CTD PMID:28628672 Pik3c2b Rat iron atom increases expression EXP 6480464 Iron deficiency results in increased expression of PIK3C2B mRNA CTD PMID:16629162 Pik3c2b Rat iron(0) increases expression EXP 6480464 Iron deficiency results in increased expression of PIK3C2B mRNA CTD PMID:16629162 Pik3c2b Rat menadione affects expression ISO PIK3C2B (Homo sapiens) 6480464 Vitamin K 3 affects the expression of PIK3C2B mRNA CTD PMID:20044591 Pik3c2b Rat methotrexate affects response to substance ISO PIK3C2B (Homo sapiens) 6480464 PIK3C2B protein affects the susceptibility to Methotrexate CTD PMID:16217747 Pik3c2b Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PIK3C2B gene CTD PMID:35440735 Pik3c2b Rat methylmercury chloride decreases expression ISO PIK3C2B (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PIK3C2B mRNA CTD PMID:28001369 Pik3c2b Rat myricetin decreases expression ISO PIK3C2B (Homo sapiens) 6480464 myricetin results in decreased expression of PIK3C2B protein CTD PMID:29698783 Pik3c2b Rat nefazodone decreases expression ISO PIK3C2B (Homo sapiens) 6480464 nefazodone results in decreased expression of PIK3C2B mRNA CTD PMID:32152650 Pik3c2b Rat nefazodone multiple interactions ISO PIK3C2B (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in decreased expression of PIK3C2B mRNA CTD PMID:32152650 Pik3c2b Rat nitrates increases expression EXP 6480464 Nitrates results in increased expression of PIK3C2B mRNA CTD PMID:30022042 Pik3c2b Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of PIK3C2B mRNA CTD PMID:26720608 Pik3c2b Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PIK3C2B mRNA CTD PMID:25729387 Pik3c2b Rat paracetamol affects expression ISO Pik3c2b (Mus musculus) 6480464 Acetaminophen affects the expression of PIK3C2B mRNA CTD PMID:17562736 Pik3c2b Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PIK3C2B mRNA CTD PMID:33387578 Pik3c2b Rat paracetamol affects response to substance ISO PIK3C2B (Homo sapiens) 6480464 PIK3C2B gene polymorphism affects the susceptibility to Acetaminophen CTD PMID:26104854 Pik3c2b Rat parathion increases methylation ISO PIK3C2B (Homo sapiens) 6480464 Parathion results in increased methylation of PIK3C2B promoter CTD PMID:22847954 Pik3c2b Rat perfluorohexanesulfonic acid decreases expression ISO PIK3C2B (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of PIK3C2B mRNA CTD PMID:25812627 Pik3c2b Rat perfluorononanoic acid decreases expression ISO PIK3C2B (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of PIK3C2B mRNA CTD PMID:25812627 Pik3c2b Rat perfluorooctane-1-sulfonic acid decreases expression ISO PIK3C2B (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of PIK3C2B mRNA CTD PMID:25812627 Pik3c2b Rat perfluorooctanoic acid decreases expression ISO PIK3C2B (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PIK3C2B mRNA CTD PMID:25812627 Pik3c2b Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Pik3c2b (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of PIK3C2B mRNA CTD PMID:28903501 Pik3c2b Rat pyrimidifen decreases expression ISO PIK3C2B (Homo sapiens) 6480464 pyrimidifen results in decreased expression of PIK3C2B mRNA CTD PMID:33512557 Pik3c2b Rat quercetin increases expression ISO PIK3C2B (Homo sapiens) 6480464 Quercetin results in increased expression of PIK3C2B protein CTD PMID:19207037 Pik3c2b Rat sodium arsenite decreases expression ISO PIK3C2B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PIK3C2B mRNA CTD PMID:38568856 Pik3c2b Rat sunitinib increases expression ISO PIK3C2B (Homo sapiens) 6480464 Sunitinib results in increased expression of PIK3C2B mRNA CTD PMID:31533062 Pik3c2b Rat terbufos increases methylation ISO PIK3C2B (Homo sapiens) 6480464 terbufos results in increased methylation of PIK3C2B promoter CTD PMID:22847954 Pik3c2b Rat titanium dioxide increases expression ISO Pik3c2b (Mus musculus) 6480464 titanium dioxide results in increased expression of PIK3C2B mRNA CTD PMID:35295148 Pik3c2b Rat titanium dioxide decreases methylation ISO Pik3c2b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PIK3C2B gene CTD PMID:35295148 Pik3c2b Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PIK3C2B mRNA CTD PMID:25729387 Pik3c2b Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of PIK3C2B mRNA CTD PMID:25729387 Pik3c2b Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PIK3C2B mRNA CTD PMID:33387578 Pik3c2b Rat trimellitic anhydride increases expression ISO Pik3c2b (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PIK3C2B mRNA CTD PMID:19042947 Pik3c2b Rat triphenyl phosphate affects expression ISO PIK3C2B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PIK3C2B mRNA CTD PMID:37042841 Pik3c2b Rat triptonide decreases expression ISO Pik3c2b (Mus musculus) 6480464 triptonide results in decreased expression of PIK3C2B mRNA CTD PMID:33045310 Pik3c2b Rat tungsten decreases expression ISO Pik3c2b (Mus musculus) 6480464 Tungsten results in decreased expression of PIK3C2B mRNA CTD PMID:30912803 Pik3c2b Rat valproic acid decreases expression ISO PIK3C2B (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PIK3C2B mRNA CTD PMID:28001369
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) afimoxifene (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) captan (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chloroprene (EXP) cisplatin (ISO) clobetasol (ISO) clothianidin (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) deoxycholic acid (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) disodium selenite (ISO) doxorubicin (ISO) endosulfan (EXP) fenpyroximate (ISO) folpet (ISO) fonofos (ISO) gentamycin (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) indometacin (ISO) iron atom (EXP) iron(0) (EXP) menadione (ISO) methotrexate (ISO) methoxychlor (EXP) methylmercury chloride (ISO) myricetin (ISO) nefazodone (ISO) nitrates (EXP) nitrofen (EXP) oxaliplatin (EXP) paracetamol (EXP,ISO) parathion (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) pyrimidifen (ISO) quercetin (ISO) sodium arsenite (ISO) sunitinib (ISO) terbufos (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO)
Pik3c2b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 47,046,866 - 47,107,733 (+) NCBI GRCr8 mRatBN7.2 13 44,494,673 - 44,555,663 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 44,495,050 - 44,555,612 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 47,101,804 - 47,160,253 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 48,389,909 - 48,448,360 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 45,650,489 - 45,709,098 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 49,848,939 - 49,909,404 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 49,850,189 - 49,911,202 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 54,919,438 - 54,977,791 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 45,954,337 - 46,013,206 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 45,987,757 - 46,027,587 (+) NCBI Celera 13 44,829,361 - 44,887,236 (+) NCBI Celera Cytogenetic Map 13 q13 NCBI
PIK3C2B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 204,422,633 - 204,494,805 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 204,422,628 - 204,494,805 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 204,391,761 - 204,463,933 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 202,658,384 - 202,726,097 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 201,123,420 - 201,191,131 NCBI Celera 1 177,527,172 - 177,594,672 (-) NCBI Celera Cytogenetic Map 1 q32.1 NCBI HuRef 1 175,556,880 - 175,624,580 (-) NCBI HuRef CHM1_1 1 205,815,608 - 205,882,878 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 203,687,208 - 203,759,206 (-) NCBI T2T-CHM13v2.0
Pik3c2b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 132,973,410 - 133,036,429 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 132,973,405 - 133,036,425 (+) Ensembl GRCm39 Ensembl GRCm38 1 133,045,672 - 133,108,691 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 133,045,667 - 133,108,687 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 134,942,589 - 135,005,265 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 134,873,558 - 134,934,994 (+) NCBI MGSCv36 mm8 Celera 1 135,655,035 - 135,720,282 (+) NCBI Celera Cytogenetic Map 1 E4 NCBI cM Map 1 57.75 NCBI
Pik3c2b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 40,247,382 - 40,317,556 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 40,247,690 - 40,317,556 (-) NCBI ChiLan1.0 ChiLan1.0
PIK3C2B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 44,882,135 - 44,960,492 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 44,847,333 - 44,920,688 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 180,024,889 - 180,096,287 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 184,313,233 - 184,384,454 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 184,313,233 - 184,384,454 (-) Ensembl panpan1.1 panPan2
PIK3C2B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 974,248 - 1,016,226 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 975,749 - 1,027,679 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 1,069,379 - 1,134,940 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 969,737 - 1,035,426 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 969,759 - 1,035,859 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 966,025 - 1,031,937 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 1,357,807 - 1,423,477 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 1,557,935 - 1,623,716 (-) NCBI UU_Cfam_GSD_1.0
Pik3c2b
PIK3C2B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 65,073,738 - 65,154,538 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 65,073,728 - 65,154,861 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 71,409,230 - 71,490,324 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PIK3C2B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 24,855,712 - 24,926,050 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 24,855,766 - 24,926,346 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 25,615,537 - 25,686,367 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pik3c2b
.
Assembly: Rnor_5.0 Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
13
49871598
49871599
C
T
snv
CDR View more Information
Predicted Target Of
Count of predictions: 110 Count of miRNA genes: 98 Interacting mature miRNAs: 101 Transcripts: ENSRNOT00000042125 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 6893344 Cm79 Cardiac mass QTL 79 1.5 0.04 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 43720770 62022792 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1300163 Cardf1 Cardiac cell morphology QTL 1 4.18 aorta morphology trait (VT:0000272) artery lesion measurement (CMO:0000975) 13 11929449 45417941 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61339 Bp24 Blood pressure QTL 24 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 5994668 44807491 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 2303032 Bp328 Blood pressure QTL 328 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 41184022 45417941 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 2302275 Gluco37 Glucose level QTL 37 3.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 13 11929449 46193066 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 4145117 Mcs27 Mammary carcinoma susceptibility QTL 27 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 13 43437904 47841255 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 2301962 Cm72 Cardiac mass QTL 72 4.12 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 13 31241331 58363171 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000042125 ⟹ ENSRNOP00000051488
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 44,495,050 - 44,555,612 (+) Ensembl Rnor_6.0 Ensembl 13 49,850,189 - 49,908,350 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090170 ⟹ ENSRNOP00000071933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 44,495,050 - 44,555,612 (+) Ensembl Rnor_6.0 Ensembl 13 49,870,976 - 49,911,202 (+) Ensembl
RefSeq Acc Id:
NM_001105951 ⟹ NP_001099421
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 47,047,127 - 47,105,208 (+) NCBI mRatBN7.2 13 44,495,050 - 44,553,137 (+) NCBI Rnor_6.0 13 49,850,189 - 49,908,350 (+) NCBI Rnor_5.0 13 54,919,438 - 54,977,791 (+) NCBI RGSC_v3.4 13 45,954,337 - 46,013,206 (+) RGD Celera 13 44,829,361 - 44,887,236 (+) RGD
Sequence:
TGCCGGCGGCCTGGGCCGCGGTCCTGGCAGGAGCCGGTGAGCCTCGCGCGCCGTGCAGTGCGCTGGCTGTCCGGGAGATGGCTTCTCCCCGCTCGCCCGCCGCTCGCGCTATTGTCTCACCCGGGGCT
hide sequence
RefSeq Acc Id:
XM_006249754 ⟹ XP_006249816
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 47,047,074 - 47,107,733 (+) NCBI mRatBN7.2 13 44,494,993 - 44,555,663 (+) NCBI Rnor_6.0 13 49,850,123 - 49,909,404 (+) NCBI Rnor_5.0 13 54,919,438 - 54,977,791 (+) NCBI
Sequence:
GAGGCCCGGGTTCCCGCCGCCCCGCCCTCTGGCTCCCGCGACCAGGCGATTCGGTGTTGCGGCTGCTGCCGGCGGCCTGGGCCGCGGTCCTGGCAGGAGCCGGTGAGCCTCGCGCGCCGTGCAGTGCG
hide sequence
RefSeq Acc Id:
XM_006249756 ⟹ XP_006249818
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 47,068,366 - 47,107,733 (+) NCBI mRatBN7.2 13 44,516,243 - 44,555,663 (+) NCBI Rnor_6.0 13 49,870,951 - 49,909,404 (+) NCBI Rnor_5.0 13 54,919,438 - 54,977,791 (+) NCBI
Sequence:
AATATAATATAATATGTAAAGAACAAAGTCTCTTCATGTCATCCCAGATGGCTAACACAGATGTGTTCATATGCCTTTGGCCCATAAGTGTCTCTGGAGGAGGGGACCTGAAGGCCACCTTATTTACC
hide sequence
RefSeq Acc Id:
XM_063272073 ⟹ XP_063128143
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 47,047,074 - 47,107,733 (+) NCBI
RefSeq Acc Id:
XM_063272074 ⟹ XP_063128144
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 47,046,866 - 47,107,733 (+) NCBI
RefSeq Acc Id:
XM_063272075 ⟹ XP_063128145
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 47,047,073 - 47,105,214 (+) NCBI
RefSeq Acc Id:
NP_001099421 ⟸ NM_001105951
- UniProtKB:
D3ZVF3 (UniProtKB/TrEMBL), A6IC68 (UniProtKB/TrEMBL)
- Sequence:
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHHKEESRAKQNTEPSLISWDEPALDFYSKPAGRRTELKLLRGLSGSDPTLNYNSISPPEELPNSTSQDPQPGTDPWPKGSQSGDYLY
hide sequence
RefSeq Acc Id:
XP_006249816 ⟸ XM_006249754
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K1Q0 (UniProtKB/TrEMBL)
- Sequence:
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHHKEESRAKQNTEPSLISWDEPALDFYSKPAGRRTELKLLRGLSGSDPTLNYNSISPPEELPNSTSQDPQPGTDPWPKGSQSGDYLY
hide sequence
RefSeq Acc Id:
XP_006249818 ⟸ XM_006249756
- Peptide Label:
isoform X4
- UniProtKB:
A0A0G2K1Q0 (UniProtKB/TrEMBL)
- Sequence:
MRQWSPPPQLGAGARPAGRGDPLSSAPIPPPRLRRASSRNDPTYPRPSEPSLERARSKCQPGTPAASLCLADSPDQHRTMPPGPASRANVSSRTHTVTNGHELFEVSEERDEEVAAFCHMLDILRTGS
hide sequence
Ensembl Acc Id:
ENSRNOP00000071933 ⟸ ENSRNOT00000090170
Ensembl Acc Id:
ENSRNOP00000051488 ⟸ ENSRNOT00000042125
RefSeq Acc Id:
XP_063128144 ⟸ XM_063272074
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063128145 ⟸ XM_063272075
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063128143 ⟸ XM_063272073
- Peptide Label:
isoform X1
RGD ID: 13698819 Promoter ID: EPDNEW_R9343 Type: initiation region Name: Pik3c2b_1 Description: phosphatidylinositol-4-phosphate 3-kinase, catalytic subunittype 2 beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 49,850,190 - 49,850,250 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-11
Pik3c2b
phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta
Pik3c2b
nuclear cap binding protein subunit 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-10
Pik3c2b
nuclear cap binding protein subunit 2
Pik3c2b
nuclear cap binding protein subunit 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-10-10
Pik3c2b
nuclear cap binding protein subunit 2
Pik3c2b
phosphoinositide-3-kinase, class 2, beta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Pik3c2b
phosphoinositide-3-kinase, class 2, beta polypeptide
Pik3c2b_predicted
phosphoinositide-3-kinase, class 2, beta polypeptide (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Pik3c2b_predicted
phosphoinositide-3-kinase, class 2, beta polypeptide (predicted)
Symbol and Name status set to approved
70820 APPROVED
