Symbol:
Pik3cg
Name:
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
RGD ID:
1306468
Description:
Enables 1-phosphatidylinositol-3-kinase activity. Involved in several processes, including hepatocyte apoptotic process; negative regulation of triglyceride catabolic process; and phosphatidylinositol phosphate biosynthetic process. Part of phosphatidylinositol 3-kinase complex. Used to study liver cirrhosis. Biomarker of diabetic retinopathy. Human ortholog(s) of this gene implicated in autistic disorder; immunodeficiency 97; and swine influenza. Orthologous to human PIK3CG (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma); PARTICIPATES IN phosphatidylinositol 3-kinase-Akt signaling pathway; eicosanoid signaling pathway; ephrin - ephrin receptor bidirectional signaling axis; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform; phosphoinositide-3-kinase, catalytic, gamma polypeptide; Pi3k
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PIK3CG (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Pik3cg (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pik3cg (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PIK3CG (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PIK3CG (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pik3cg (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PIK3CG (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PIK3CG (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pik3cg (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PIK3CG (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pik3cg (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pik3cg (phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
age-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pik3cg
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 54,494,247 - 54,529,563 (-) NCBI GRCr8 GRCr8 Ensembl 6 54,478,603 - 54,529,509 (-) Ensembl GRCr8 Ensembl mRatBN7.2 6 48,766,778 - 48,802,098 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 48,766,864 - 48,802,043 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 49,076,821 - 49,111,984 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 49,391,750 - 49,426,907 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 48,836,049 - 48,871,239 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 51,465,696 - 51,501,234 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 51,465,908 - 51,498,337 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 61,106,730 - 61,142,184 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 50,441,892 - 50,476,931 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 6 47,971,127 - 48,004,061 (-) NCBI Celera RGSC_v3.1 6 50,447,918 - 50,480,237 (-) NCBI Cytogenetic Map 6 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pik3cg Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO Pik3cg (Mus musculus) 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Pik3cg Rat 1,2-dichloroethane decreases expression ISO Pik3cg (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PIK3CG mRNA CTD PMID:28960355 Pik3cg Rat 1,2-dimethylhydrazine increases expression ISO Pik3cg (Mus musculus) 6480464 1,2-Dimethylhydrazine results in increased expression of PIK3CG mRNA CTD PMID:22206623 Pik3cg Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PIK3CG mRNA; Estradiol results in increased expression of PIK3CG more ... CTD PMID:31212184 Pik3cg Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Pik3cg (Mus musculus) 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Pik3cg Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Pik3cg (Mus musculus) 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Pik3cg Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PIK3CG (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PIK3CG mRNA] CTD PMID:11007951 Pik3cg Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PIK3CG mRNA CTD PMID:32109520|PMID:34747641 Pik3cg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PIK3CG (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3CG mRNA CTD PMID:11007951 Pik3cg Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO Pik3cg (Mus musculus) 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Pik3cg Rat 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of PIK3CG mRNA CTD PMID:26186136 Pik3cg Rat 4,4'-sulfonyldiphenol affects methylation ISO Pik3cg (Mus musculus) 6480464 bisphenol S affects the methylation of PIK3CG gene CTD PMID:31683443 Pik3cg Rat 4-nonylphenol increases expression EXP 6480464 4-nonylphenol results in increased expression of PIK3CG mRNA CTD PMID:30228064 Pik3cg Rat 4-nonylphenol multiple interactions EXP 6480464 4-nonylphenol promotes the reaction [bisphenol A results in increased expression of PIK3CG mRNA]; bisphenol A more ... CTD PMID:30228064 Pik3cg Rat 5-aza-2'-deoxycytidine increases expression ISO PIK3CG (Homo sapiens) 6480464 Decitabine results in increased expression of PIK3CG mRNA CTD PMID:17785578 Pik3cg Rat acetohydrazide decreases expression ISO Pik3cg (Mus musculus) 6480464 acetylhydrazine results in decreased expression of PIK3CG mRNA CTD PMID:15282401 Pik3cg Rat afimoxifene decreases response to substance ISO PIK3CG (Homo sapiens) 6480464 PIK3CG results in decreased susceptibility to afimoxifene CTD PMID:21233418 Pik3cg Rat aflatoxin B1 decreases methylation ISO PIK3CG (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PIK3CG gene CTD PMID:27153756 Pik3cg Rat all-trans-retinoic acid increases expression ISO PIK3CG (Homo sapiens) 6480464 Tretinoin results in increased expression of PIK3CG mRNA; Tretinoin results in increased expression of PIK3CG more ... CTD PMID:15498508|PMID:16054129|PMID:19176369|PMID:33167477 Pik3cg Rat allethrin decreases expression EXP 6480464 Allethrins results in decreased expression of PIK3CG mRNA CTD PMID:35742842 Pik3cg Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of PIK3CG mRNA CTD PMID:35163327 Pik3cg Rat amosite asbestos increases expression ISO Pik3cg (Mus musculus) 6480464 Asbestos, Amosite results in increased expression of PIK3CG mRNA CTD PMID:29112861 Pik3cg Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PIK3CG mRNA CTD PMID:30779732 Pik3cg Rat arsenite(3-) decreases expression ISO Pik3cg (Mus musculus) 6480464 arsenite results in decreased expression of PIK3CG mRNA CTD PMID:18191166 Pik3cg Rat arsenite(3-) increases expression ISO Pik3cg (Mus musculus) 6480464 arsenite results in increased expression of PIK3CG mRNA CTD PMID:33053406 Pik3cg Rat arsenous acid decreases expression ISO PIK3CG (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PIK3CG protein CTD PMID:34042274 Pik3cg Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of PIK3CG mRNA CTD PMID:31187311 Pik3cg Rat benzo[a]pyrene increases mutagenesis ISO PIK3CG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of PIK3CG gene CTD PMID:25435355 Pik3cg Rat benzo[a]pyrene affects methylation ISO PIK3CG (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PIK3CG 5' UTR CTD PMID:27901495 Pik3cg Rat benzo[a]pyrene increases methylation ISO PIK3CG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PIK3CG promoter CTD PMID:27901495 Pik3cg Rat benzo[a]pyrene increases expression ISO PIK3CG (Homo sapiens) 6480464 Benzo(a)pyrene metabolite results in increased expression of PIK3CG mRNA; Benzo(a)pyrene results in increased expression of more ... CTD PMID:26314263|PMID:32234424 Pik3cg Rat bis(2-chloroethyl) sulfide increases expression ISO Pik3cg (Mus musculus) 6480464 Mustard Gas results in increased expression of PIK3CG mRNA CTD PMID:18955075 Pik3cg Rat bis(2-ethylhexyl) phthalate multiple interactions ISO PIK3CG (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of PIK3CG more ... CTD PMID:33872906 Pik3cg Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [BMS 754807 co-treated with Diethylhexyl Phthalate] results in decreased expression of PIK3CG mRNA; [BMS 754807 more ... CTD PMID:31212184 Pik3cg Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PIK3CG protein CTD PMID:31212184 Pik3cg Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pik3cg (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PIK3CG mRNA; Diethylhexyl Phthalate results in decreased expression more ... CTD PMID:33091774 Pik3cg Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Pik3cg (Mus musculus) 6480464 Dibutyl Phthalate promotes the reaction [Diethylhexyl Phthalate results in decreased expression of PIK3CG mRNA]; Dibutyl more ... CTD PMID:33091774 Pik3cg Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PIK3CG mRNA; bisphenol A results in increased expression more ... CTD PMID:27539358|PMID:30228064|PMID:35567931 Pik3cg Rat bisphenol A increases expression ISO Pik3cg (Mus musculus) 6480464 bisphenol A results in increased expression of PIK3CG mRNA CTD PMID:38701888 Pik3cg Rat bisphenol A multiple interactions EXP 6480464 4-nonylphenol promotes the reaction [bisphenol A results in increased expression of PIK3CG mRNA]; bisphenol A more ... CTD PMID:30228064 Pik3cg Rat bisphenol F decreases expression EXP 6480464 4,4'-bisphenol F results in decreased expression of PIK3CG mRNA CTD PMID:26186136 Pik3cg Rat BMS-754807 multiple interactions EXP 6480464 [BMS 754807 co-treated with Diethylhexyl Phthalate] results in decreased expression of PIK3CG mRNA; [BMS 754807 more ... CTD PMID:31212184 Pik3cg Rat cadmium atom decreases expression ISO PIK3CG (Homo sapiens) 6480464 Cadmium results in decreased expression of PIK3CG mRNA CTD PMID:24376830 Pik3cg Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PIK3CG mRNA CTD PMID:33453195 Pik3cg Rat calcium silicate increases expression ISO Pik3cg (Mus musculus) 6480464 calcium silicate results in increased expression of PIK3CG mRNA CTD PMID:29279043 Pik3cg Rat captan decreases expression ISO Pik3cg (Mus musculus) 6480464 Captan results in decreased expression of PIK3CG mRNA CTD PMID:31558096 Pik3cg Rat carbon nanotube increases expression ISO Pik3cg (Mus musculus) 6480464 Nanotubes, Carbon results in increased expression of PIK3CG mRNA CTD PMID:29112861 Pik3cg Rat CGP 52608 multiple interactions ISO PIK3CG (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PIK3CG gene] CTD PMID:28238834 Pik3cg Rat chlorpyrifos decreases expression ISO Pik3cg (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PIK3CG mRNA CTD PMID:37019170 Pik3cg Rat cisplatin decreases response to substance ISO PIK3CG (Homo sapiens) 6480464 PIK3CG results in decreased susceptibility to Cisplatin CTD PMID:21652733 Pik3cg Rat cobalt dichloride increases expression ISO PIK3CG (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PIK3CG mRNA CTD PMID:26314263 Pik3cg Rat cordycepin affects binding ISO PIK3CG (Homo sapiens) 6480464 cordycepin binds to PIK3CG protein CTD PMID:33014856 Pik3cg Rat corilagin multiple interactions EXP 6480464 corilagin inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of PIK3CG mRNA] CTD PMID:35103375 Pik3cg Rat cycloheximide multiple interactions ISO PIK3CG (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PIK3CG mRNA] CTD PMID:11007951 Pik3cg Rat cyhalothrin affects binding ISO PIK3CG (Homo sapiens) 6480464 cyhalothrin binds to PIK3CG protein CTD PMID:32278787 Pik3cg Rat deoxynivalenol affects phosphorylation ISO Pik3cg (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of PIK3CG protein CTD PMID:23811945 Pik3cg Rat diarsenic trioxide decreases expression ISO PIK3CG (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PIK3CG protein CTD PMID:34042274 Pik3cg Rat dibutyl phthalate multiple interactions ISO Pik3cg (Mus musculus) 6480464 Dibutyl Phthalate promotes the reaction [Diethylhexyl Phthalate results in decreased expression of PIK3CG mRNA]; Dibutyl more ... CTD PMID:33091774 Pik3cg Rat dibutyl phthalate decreases expression ISO Pik3cg (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PIK3CG mRNA; Dibutyl Phthalate results in decreased expression more ... CTD PMID:33091774 Pik3cg Rat dioxygen decreases expression ISO Pik3cg (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of PIK3CG mRNA CTD PMID:24205000 Pik3cg Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of PIK3CG mRNA; Oxygen deficiency results in increased expression more ... CTD PMID:37923178 Pik3cg Rat dioxygen multiple interactions EXP 6480464 kaempferol inhibits the reaction [Oxygen deficiency results in increased expression of PIK3CG mRNA]; kaempferol inhibits more ... CTD PMID:37923178 Pik3cg Rat diquat decreases expression ISO Pik3cg (Mus musculus) 6480464 Diquat results in decreased expression of PIK3CG mRNA CTD PMID:36851058 Pik3cg Rat ethanol multiple interactions ISO Pik3cg (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PIK3CG mRNA CTD PMID:30517762 Pik3cg Rat ethanol increases expression ISO Pik3cg (Mus musculus) 6480464 Ethanol results in increased expression of PIK3CG mRNA CTD PMID:30319688 Pik3cg Rat folpet decreases expression ISO Pik3cg (Mus musculus) 6480464 folpet results in decreased expression of PIK3CG mRNA CTD PMID:31558096 Pik3cg Rat formaldehyde increases expression ISO PIK3CG (Homo sapiens) 6480464 Formaldehyde results in increased expression of PIK3CG mRNA CTD PMID:23649840 Pik3cg Rat glycyrrhetinate decreases activity ISO Pik3cg (Mus musculus) 6480464 18alpha-glycyrrhetinic acid results in decreased activity of PIK3CG protein CTD PMID:21644799 Pik3cg Rat glycyrrhetinic acid decreases activity ISO Pik3cg (Mus musculus) 6480464 18alpha-glycyrrhetinic acid results in decreased activity of PIK3CG protein CTD PMID:21644799 Pik3cg Rat glycyrrhizinic acid decreases activity ISO Pik3cg (Mus musculus) 6480464 Glycyrrhizic Acid results in decreased activity of PIK3CG protein CTD PMID:21644799 Pik3cg Rat GSK-J4 increases expression ISO PIK3CG (Homo sapiens) 6480464 GSK-J4 results in increased expression of PIK3CG mRNA CTD PMID:29301935 Pik3cg Rat hexadecanoic acid decreases phosphorylation ISO Pik3cg (Mus musculus) 6480464 Palmitic Acid results in decreased phosphorylation of PIK3CG protein CTD PMID:38174997 Pik3cg Rat hexadecanoic acid multiple interactions ISO Pik3cg (Mus musculus) 6480464 ADORA2B protein affects the reaction [Palmitic Acid results in decreased phosphorylation of PIK3CG protein]; ADORA2B more ... CTD PMID:38174997 Pik3cg Rat hydrazine decreases expression ISO Pik3cg (Mus musculus) 6480464 hydrazine results in decreased expression of PIK3CG mRNA CTD PMID:15282401 Pik3cg Rat IC-87114 multiple interactions ISO Pik3cg (Mus musculus) 6480464 IC 87114 inhibits the reaction [Toluene 2,4-Diisocyanate results in increased expression of PIK3CG protein] CTD PMID:33711354 Pik3cg Rat idelalisib decreases expression ISO Pik3cg (Mus musculus) 6480464 idelalisib results in decreased expression of PIK3CG mRNA CTD PMID:31522336 Pik3cg Rat isoprenaline multiple interactions ISO Pik3cg (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Isoproterenol results in increased activity of PIK3CG protein]; wortmannin inhibits the more ... CTD PMID:15178407 Pik3cg Rat isoprenaline increases activity ISO Pik3cg (Mus musculus) 6480464 Isoproterenol results in increased activity of PIK3CG protein CTD PMID:15178407 Pik3cg Rat kaempferol multiple interactions EXP 6480464 kaempferol inhibits the reaction [Oxygen deficiency results in increased expression of PIK3CG mRNA]; kaempferol inhibits more ... CTD PMID:37923178 Pik3cg Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of PIK3CG more ... CTD PMID:36652739 Pik3cg Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of PIK3CG more ... CTD PMID:36652739 Pik3cg Rat letrozole decreases expression EXP 6480464 Letrozole results in decreased expression of PIK3CG mRNA CTD PMID:33491863 Pik3cg Rat letrozole multiple interactions EXP 6480464 ADM protein inhibits the reaction [Letrozole results in decreased expression of PIK3CG mRNA] CTD PMID:33491863 Pik3cg Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of PIK3CG mRNA CTD PMID:35283115 Pik3cg Rat lipopolysaccharide increases phosphorylation ISO Pik3cg (Mus musculus) 38599186 lipopolysaccharide increases phosphorylation of Pik3cg protein in cardiac myocytes RGD Pik3cg Rat LY294002 multiple interactions ISO PIK3CG (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [tamibarotene results in increased expression of and results in increased activity more ... CTD PMID:15020266 Pik3cg Rat LY294002 decreases expression ISO Pik3cg (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased expression of PIK3CG mRNA CTD PMID:31522336 Pik3cg Rat LY294002 decreases activity ISO PIK3CG (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased activity of PIK3CG protein CTD PMID:16794257 Pik3cg Rat LY294002 multiple interactions ISO Pik3cg (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Isoproterenol results in increased activity of PIK3CG protein]; 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the more ... CTD PMID:15178407|PMID:31522336 Pik3cg Rat LY294002 decreases activity ISO Pik3cg (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased activity of PIK3CG protein CTD PMID:16179367 Pik3cg Rat metformin decreases expression ISO PIK3CG (Homo sapiens) 6480464 Metformin results in decreased expression of PIK3CG mRNA CTD PMID:32589349 Pik3cg Rat metformin multiple interactions ISO PIK3CG (Homo sapiens) 6480464 [Metformin co-treated with Pioglitazone] results in decreased expression of PIK3CG mRNA CTD PMID:32589349 Pik3cg Rat methylmercury(1+) increases expression ISO PIK3CG (Homo sapiens) 6480464 methylmercury II results in increased expression of PIK3CG mRNA CTD PMID:26314263 Pik3cg Rat mono(2-ethylhexyl) phthalate multiple interactions ISO PIK3CG (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of PIK3CG more ... CTD PMID:33872906 Pik3cg Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression EXP 6480464 Methylnitronitrosoguanidine results in increased expression of PIK3CG mRNA CTD PMID:35103375 Pik3cg Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions EXP 6480464 corilagin inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of PIK3CG mRNA] CTD PMID:35103375 Pik3cg Rat nickel atom increases expression ISO PIK3CG (Homo sapiens) 6480464 Nickel results in increased expression of PIK3CG mRNA CTD PMID:25583101 Pik3cg Rat nitrates increases expression EXP 6480464 Nitrates results in increased expression of PIK3CG mRNA CTD PMID:30022042 Pik3cg Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of PIK3CG mRNA CTD PMID:27832966 Pik3cg Rat Nonylphenol increases expression EXP 6480464 nonylphenol results in increased expression of PIK3CG mRNA CTD PMID:27832966 Pik3cg Rat ochratoxin A increases expression ISO PIK3CG (Homo sapiens) 6480464 ochratoxin A metabolite results in increased expression of PIK3CG mRNA; ochratoxin A results in increased more ... CTD PMID:26314263 Pik3cg Rat okadaic acid decreases expression ISO PIK3CG (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of PIK3CG mRNA CTD PMID:38832940 Pik3cg Rat PCB138 multiple interactions ISO Pik3cg (Mus musculus) 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Pik3cg Rat pioglitazone multiple interactions ISO PIK3CG (Homo sapiens) 6480464 [Metformin co-treated with Pioglitazone] results in decreased expression of PIK3CG mRNA CTD PMID:32589349 Pik3cg Rat quercetin decreases activity ISO PIK3CG (Homo sapiens) 6480464 Quercetin results in decreased activity of PIK3CG protein CTD PMID:16794257 Pik3cg Rat resveratrol decreases activity ISO PIK3CG (Homo sapiens) 6480464 resveratrol results in decreased activity of PIK3CG protein CTD PMID:17550345 Pik3cg Rat silicon dioxide decreases expression ISO Pik3cg (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of PIK3CG mRNA CTD PMID:19073995 Pik3cg Rat silicon dioxide increases expression ISO Pik3cg (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PIK3CG mRNA CTD PMID:29341224 Pik3cg Rat sirolimus multiple interactions ISO Pik3cg (Mus musculus) 6480464 Sirolimus inhibits the reaction [TGFB1 protein results in decreased expression of PIK3CG mRNA] CTD PMID:31522336 Pik3cg Rat sirolimus multiple interactions EXP 6480464 [Sirolimus co-treated with Diethylhexyl Phthalate] results in decreased phosphorylation of PIK3CG protein CTD PMID:31212184 Pik3cg Rat sirolimus decreases expression ISO Pik3cg (Mus musculus) 6480464 Sirolimus results in decreased expression of PIK3CG mRNA CTD PMID:31522336 Pik3cg Rat sodium arsenite decreases expression ISO PIK3CG (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PIK3CG mRNA CTD PMID:24516582 Pik3cg Rat sodium arsenite decreases expression ISO Pik3cg (Mus musculus) 6480464 sodium arsenite results in decreased expression of PIK3CG mRNA CTD PMID:37682722 Pik3cg Rat sodium arsenite affects methylation ISO PIK3CG (Homo sapiens) 6480464 sodium arsenite affects the methylation of PIK3CG gene CTD PMID:28589171 Pik3cg Rat tamibarotene multiple interactions ISO PIK3CG (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [tamibarotene results in increased expression of and results in increased activity more ... CTD PMID:15020266 Pik3cg Rat tamibarotene increases expression ISO PIK3CG (Homo sapiens) 6480464 tamibarotene results in increased expression of PIK3CG mRNA CTD PMID:15020266|PMID:15498508 Pik3cg Rat testosterone increases expression ISO Pik3cg (Mus musculus) 6480464 Testosterone deficiency results in increased expression of PIK3CG mRNA CTD PMID:33848595 Pik3cg Rat tetrachloromethane multiple interactions ISO Pik3cg (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PIK3CG mRNA CTD PMID:30517762 Pik3cg Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PIK3CG mRNA CTD PMID:34492290 Pik3cg Rat titanium dioxide increases expression ISO Pik3cg (Mus musculus) 6480464 titanium dioxide results in increased expression of PIK3CG mRNA CTD PMID:23131501|PMID:35295148 Pik3cg Rat titanium dioxide affects expression ISO Pik3cg (Mus musculus) 6480464 titanium dioxide affects the expression of PIK3CG mRNA CTD PMID:17656681 Pik3cg Rat toluene 2,4-diisocyanate increases expression ISO Pik3cg (Mus musculus) 6480464 Toluene 2,4-Diisocyanate results in increased expression of PIK3CG protein CTD PMID:33711354 Pik3cg Rat toluene 2,4-diisocyanate multiple interactions ISO Pik3cg (Mus musculus) 6480464 IC 87114 inhibits the reaction [Toluene 2,4-Diisocyanate results in increased expression of PIK3CG protein]; N-(1-(7-fluoro-2-(pyridin-2-yl)quinolin-3-yl)ethyl)-9H-purin-6-amine more ... CTD PMID:33711354 Pik3cg Rat tributylstannane increases expression ISO PIK3CG (Homo sapiens) 6480464 tributyltin results in increased expression of PIK3CG mRNA CTD PMID:26314263 Pik3cg Rat Tributyltin oxide increases expression ISO PIK3CG (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in increased expression of PIK3CG mRNA CTD PMID:26314263 Pik3cg Rat triphenyl phosphate affects expression ISO PIK3CG (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PIK3CG mRNA CTD PMID:37042841 Pik3cg Rat trovafloxacin decreases expression ISO Pik3cg (Mus musculus) 6480464 trovafloxacin results in decreased expression of PIK3CG mRNA CTD PMID:35537566 Pik3cg Rat tungsten decreases expression ISO Pik3cg (Mus musculus) 6480464 Tungsten results in decreased expression of PIK3CG mRNA CTD PMID:30912803 Pik3cg Rat valproic acid increases methylation ISO PIK3CG (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PIK3CG gene CTD PMID:29154799 Pik3cg Rat wortmannin multiple interactions ISO Pik3cg (Mus musculus) 6480464 wortmannin inhibits the reaction [Isoproterenol results in increased activity of PIK3CG protein] CTD PMID:15178407 Pik3cg Rat wortmannin multiple interactions EXP 6480464 wortmannin promotes the reaction [GRK2 protein promotes the reaction [GRK2 protein binds to PIK3CG protein]] CTD PMID:28759639 Pik3cg Rat wortmannin decreases activity ISO Pik3cg (Mus musculus) 6480464 wortmannin results in decreased activity of PIK3CG protein CTD PMID:21644799 Pik3cg Rat xanthohumol multiple interactions ISO Pik3cg (Mus musculus) 6480464 xanthohumol inhibits the reaction [TNFSF11 protein results in increased expression of PIK3CG mRNA] CTD PMID:23994090 Pik3cg Rat zinc dichloride multiple interactions ISO Pik3cg (Mus musculus) 6480464 PIK3CG protein affects the reaction [zinc chloride results in increased activity of MAP3K1 protein]; PIK3CG more ... CTD PMID:11306679
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Pik3cg Rat 1-phosphatidylinositol-3-kinase activity IDA 4144086 RGD Pik3cg Rat 1-phosphatidylinositol-3-kinase activity enables IEA UniProtKB:Q9JHG7|ensembl:ENSMUSP00000062864 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pik3cg Rat 1-phosphatidylinositol-3-kinase activity enables IBA FB:FBgn0015278|FB:FBgn0015279|MGI:1203729|MGI:1203730|MGI:1206581|MGI:1353576|MGI:1922019|PANTHER:PTN000005674|RGD:1306468|RGD:620231|RGD:620916|RGD:620917|UniProtKB:O00443|UniProtKB:O00750|UniProtKB:P32871|UniProtKB:P42336|UniProtKB:P48736 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pik3cg Rat 1-phosphatidylinositol-3-kinase activity enables ISO Pik3cg (Mus musculus) 1624291 PMID:11054537 RGD PMID:11054537 Pik3cg Rat 1-phosphatidylinositol-3-kinase activity enables IEA UniProtKB:P48736|ensembl:ENSP00000419260 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pik3cg Rat 1-phosphatidylinositol-3-kinase activity enables IEA ARBA:ARBA00086609 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Pik3cg Rat 1-phosphatidylinositol-3-kinase activity enables ISO PIK3CG (Homo sapiens) 1624291 PMID:11277933, PMID:16123124 RGD PMID:11277933|PMID:16123124 Pik3cg Rat 1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity enables ISO PIK3CG (Homo sapiens) 1624291 PMID:12502714, PMID:15135396, PMID:16123124 RGD PMID:12502714|PMID:15135396|PMID:16123124 Pik3cg Rat 1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity enables IEA UniProtKB:P48736|ensembl:ENSP00000419260 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pik3cg Rat 1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity enables IEA EC:2.7.1.153 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Pik3cg Rat 1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity enables IBA PANTHER:PTN000799659|UniProtKB:O42391|UniProtKB:P42336|UniProtKB:P48736 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pik3cg Rat 1-phosphatidylinositol-4-phosphate 3-kinase activity enables ISO PIK3CG (Homo sapiens) 1624291 PMID:16123124 RGD PMID:16123124 Pik3cg Rat 1-phosphatidylinositol-4-phosphate 3-kinase activity enables IEA UniProtKB:P48736|ensembl:ENSP00000419260 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pik3cg Rat 1-phosphatidylinositol-4-phosphate 3-kinase activity enables IBA FB:FBgn0015278|FB:FBgn0015279|MGI:1203730|PANTHER:PTN000005674|RGD:620231|UniProtKB:O00443|UniProtKB:O00750|UniProtKB:P48736 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pik3cg Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pik3cg Rat ephrin receptor binding enables ISO PIK3CG (Homo sapiens) 1624291 UniProtKB:O09127 PMID:11416136 RGD PMID:11416136 Pik3cg Rat ephrin receptor binding enables IEA UniProtKB:P48736|ensembl:ENSP00000419260 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pik3cg Rat identical protein binding enables ISO PIK3CG (Homo sapiens) 1624291 UniProtKB:P48736 PMID:20562859, PMID:23824069 RGD PMID:20562859|PMID:23824069 Pik3cg Rat identical protein binding enables IEA UniProtKB:P48736|ensembl:ENSP00000419260 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pik3cg Rat kinase activity enables IEA UniProtKB-KW:KW-0418 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pik3cg Rat kinase activity enables IEA InterPro:IPR018936 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pik3cg Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pik3cg Rat phosphatidylinositol kinase activity enables IEA ARBA:ARBA00033494 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Pik3cg Rat protein binding enables ISO Pik3cg (Mus musculus) 1624291 UniProtKB:Q3U6Q4 PMID:15797027, PMID:21665146, PMID:23824069 RGD PMID:15797027|PMID:21665146|PMID:23824069 Pik3cg Rat protein binding enables ISO PIK3CG (Homo sapiens) 1624291 UniProtKB:O02696|UniProtKB:P05067|UniProtKB:P0DOE7|UniProtKB:P15056|UniProtKB:P68404-2|UniProtKB:Q13370|UniProtKB:Q3U6Q4 PMID:12507995, PMID:21393242, PMID:23824069, PMID:25556234, PMID:32814053, PMID:35512704 RGD PMID:12507995|PMID:21393242|PMID:23824069|PMID:25556234|PMID:32814053|PMID:35512704 Pik3cg Rat protein serine kinase activity enables ISO PIK3CG (Homo sapiens) 1624291 PMID:12502714 RGD PMID:12502714 Pik3cg Rat protein serine kinase activity enables IEA UniProtKB:P48736|ensembl:ENSP00000419260 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pik3cg Rat protein serine/threonine kinase activity enables IEA UniProtKB-KW:KW-0723 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pik3cg Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - SMPDB
Imported Annotations - PID (archival)
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-nonylphenol (EXP) 5-aza-2'-deoxycytidine (ISO) acetohydrazide (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) alpha-Zearalanol (EXP) amosite asbestos (ISO) amphetamine (EXP) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) BMS-754807 (EXP) cadmium atom (ISO) cadmium dichloride (EXP) calcium silicate (ISO) captan (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt dichloride (ISO) cordycepin (ISO) corilagin (EXP) cycloheximide (ISO) cyhalothrin (ISO) deoxynivalenol (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dioxygen (EXP,ISO) diquat (ISO) ethanol (ISO) folpet (ISO) formaldehyde (ISO) glycyrrhetinate (ISO) glycyrrhetinic acid (ISO) glycyrrhizinic acid (ISO) GSK-J4 (ISO) hexadecanoic acid (ISO) hydrazine (ISO) IC-87114 (ISO) idelalisib (ISO) isoprenaline (ISO) kaempferol (EXP) lead diacetate (EXP) lead(0) (EXP) letrozole (EXP) lidocaine (EXP) lipopolysaccharide (ISO) LY294002 (ISO) metformin (ISO) methylmercury(1+) (ISO) mono(2-ethylhexyl) phthalate (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (EXP) nickel atom (ISO) nitrates (EXP) Nonylphenol (EXP) ochratoxin A (ISO) okadaic acid (ISO) PCB138 (ISO) pioglitazone (ISO) quercetin (ISO) resveratrol (ISO) silicon dioxide (ISO) sirolimus (EXP,ISO) sodium arsenite (ISO) tamibarotene (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) tributylstannane (ISO) Tributyltin oxide (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) tungsten (ISO) valproic acid (ISO) wortmannin (EXP,ISO) xanthohumol (ISO) zinc dichloride (ISO)
Biological Process
angiogenesis (IEA) behavioral response to pain (IDA) cell migration (IBA) cellular response to cAMP (IEA,ISO) chemotaxis (IEA) endocytosis (IEA) G protein-coupled receptor signaling pathway (IEA,ISO) hepatocyte apoptotic process (IMP) immune system process (IEA) inflammatory response (IEA) lipid metabolic process (IEA) negative regulation of fibroblast apoptotic process (IEA,ISO) negative regulation of triglyceride catabolic process (IMP) phosphatidylinositol 3-kinase/protein kinase B signal transduction (IBA,IEA,ISO) phosphatidylinositol phosphate biosynthetic process (IDA,IEA,ISO) phosphatidylinositol-3-phosphate biosynthetic process (IBA,IEA) phosphatidylinositol-mediated signaling (IBA) phospholipase C-activating G protein-coupled receptor signaling pathway (ISO) positive regulation of acute inflammatory response (IMP) positive regulation of catalytic activity (ISO) positive regulation of cytosolic calcium ion concentration (IMP) positive regulation of endothelial cell migration (IEA,ISO) positive regulation of MAP kinase activity (ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO) positive regulation of Rac protein signal transduction (IEA,ISO) protein phosphorylation (ISO) regulation of angiogenesis (IEA,ISO) regulation of calcium ion transmembrane transport (IEA,ISO) regulation of locomotion (IEA) regulation of protein phosphorylation (ISO) secretory granule localization (IMP) sphingosine-1-phosphate receptor signaling pathway (IEA,ISO)
Cellular Component
cytoplasm (IBA,IEA,ISO) cytosol (IEA,ISO) membrane (IEA,ISO) phosphatidylinositol 3-kinase complex (IDA) phosphatidylinositol 3-kinase complex, class IA (IBA,ISO) phosphatidylinositol 3-kinase complex, class IB (IBA,IEA,ISO) plasma membrane (IBA,IEA,ISO)
Molecular Function
1-phosphatidylinositol-3-kinase activity (IBA,IDA,IEA,ISO) 1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity (IBA,IEA,ISO) 1-phosphatidylinositol-4-phosphate 3-kinase activity (IBA,IEA,ISO) ATP binding (IEA) ephrin receptor binding (IEA,ISO) identical protein binding (IEA,ISO) kinase activity (IEA) nucleotide binding (IEA) phosphatidylinositol kinase activity (IEA) protein binding (ISO) protein serine kinase activity (IEA,ISO) protein serine/threonine kinase activity (IEA) transferase activity (IEA)
1.
Acylated and unacylated ghrelin attenuate isoproterenol-induced lipolysis in isolated rat visceral adipocytes through activation of phosphoinositide 3-kinase gamma and phosphodiesterase 3B.
Baragli A, etal., Biochim Biophys Acta. 2011 Jun;1811(6):386-96. Epub 2011 Mar 22.
2.
Class IB-phosphatidylinositol 3-kinase (PI3K) deficiency ameliorates IA-PI3K-induced systemic lupus but not T cell invasion.
Barber DF, etal., J Immunol. 2006 Jan 1;176(1):589-93.
3.
PI3Kgamma within a nonhematopoietic cell type negatively regulates diet-induced thermogenesis and promotes obesity and insulin resistance.
Becattini B, etal., Proc Natl Acad Sci U S A. 2011 Oct 18;108(42):E854-63. Epub 2011 Sep 26.
4.
A specific role of phosphatidylinositol 3-kinase gamma. A regulation of autonomic Ca(2)+ oscillations in cardiac cells.
Bony C, etal., J Cell Biol. 2001 Feb 19;152(4):717-28.
5.
PI3Kgamma controls leukocyte recruitment, tissue injury, and lethality in a model of graft-versus-host disease in mice.
Castor MG, etal., J Leukoc Biol. 2011 Jun;89(6):955-64. Epub 2011 Mar 14.
6.
Improvement of the resistance against early Mycobacterium tuberculosis-infection in the absence of PI3Kγ enzyme is associated with increase of CD4+IL-17+ cells and neutrophils.
Cavalcanti-Neto MP, etal., Tuberculosis (Edinb). 2018 Dec;113:1-9. doi: 10.1016/j.tube.2018.08.009. Epub 2018 Aug 23.
7.
Deletion of the phosphoinositide 3-kinase p110gamma gene attenuates murine atherosclerosis.
Chang JD, etal., Proc Natl Acad Sci U S A. 2007 May 8;104(19):8077-82. Epub 2007 May 2.
8.
S100B-mediated protection against the pro-apoptotic effects of ethanol on fetal rhombencephalic neurons.
Druse MJ, etal., Brain Res. 2007 May 30;1150:46-54. Epub 2007 Mar 13.
9.
Inhibitor of PI3Kgamma ameliorates TNBS-induced colitis in mice by affecting the functional activity of CD4+CD25+FoxP3+ regulatory T cells.
Dutra RC, etal., Br J Pharmacol. 2011 May;163(2):358-74. doi: 10.1111/j.1476-5381.2011.01226.x.
10.
Key role of phosphoinositide 3-kinase class IB in pancreatic cancer.
Edling CE, etal., Clin Cancer Res. 2010 Oct 15;16(20):4928-37. doi: 10.1158/1078-0432.CCR-10-1210. Epub 2010 Sep 28.
11.
Phosphoinositide 3-Kinase {gamma} Inhibition Plays a Crucial Role in Early Steps of Inflammation by Blocking Neutrophil Recruitment.
Ferrandi C, etal., J Pharmacol Exp Ther. 2007 Sep;322(3):923-30. Epub 2007 May 25.
12.
Phosphatidyl Inositol 3 Kinase-Gamma Balances Antiviral and Inflammatory Responses During Influenza A H1N1 Infection: From Murine Model to Genetic Association in Patients.
Garcia CC, etal., Front Immunol. 2018 May 15;9:975. doi: 10.3389/fimmu.2018.00975. eCollection 2018.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Phosphatidylinositol 3-kinase gamma inhibition ameliorates inflammation and tumor growth in a model of colitis-associated cancer.
Gonzalez-Garcia A, etal., Gastroenterology. 2010 Apr;138(4):1374-83. Epub 2009 Dec 11.
16.
Loss of phosphoinositide 3-kinase gamma decreases migration and activation of phagocytes but not T cell activation in antigen-induced arthritis.
Gruen M, etal., BMC Musculoskelet Disord. 2010 Apr 7;11:63.
17.
Activation of PI3Kγ/Akt pathway mediates bone cancer pain in rats.
Guan X, etal., J Neurochem. 2015 Aug;134(3):590-600. doi: 10.1111/jnc.13139. Epub 2015 Jun 4.
18.
PI3Kgamma protects from myocardial ischemia and reperfusion injury through a kinase-independent pathway.
Haubner BJ, etal., PLoS One. 2010 Feb 22;5(2):e9350.
19.
Phosphatidylinositol-3-kinase p110gamma contributes to bile salt-induced apoptosis in primary rat hepatocytes and human hepatoma cells.
Hohenester S, etal., J Hepatol. 2010 Nov;53(5):918-26. Epub 2010 Jul 17.
20.
Effect of miR-182 on hepatic fibrosis induced by Schistosomiasis japonica by targeting FOXO1 through PI3K/AKT signaling pathway.
Huang Y, etal., J Cell Physiol. 2018 Oct;233(10):6693-6704. doi: 10.1002/jcp.26469. Epub 2018 Apr 25.
21.
Prolactin-stimulated transepithelial calcium transport in duodenum and Caco-2 monolayer are mediated by the phosphoinositide 3-kinase pathway.
Jantarajit W, etal., Am J Physiol Endocrinol Metab. 2007 Jul;293(1):E372-84. Epub 2007 May 8.
22.
Phosphatidylinositol-3-kinase gamma plays a central role in blood-brain barrier dysfunction in acute experimental stroke.
Jin R, etal., Stroke. 2011 Jul;42(7):2033-44. Epub 2011 May 5.
23.
Platelet-derived growth factor-BB-mediated activation of Akt suppresses smooth muscle-specific gene expression through inhibition of mitogen-activated protein kinase and redistribution of serum response factor.
Kaplan-Albuquerque N, etal., J Biol Chem. 2003 Oct 10;278(41):39830-8. Epub 2003 Jul 25.
24.
PI3K-gamma inhibition ameliorates acute lung injury through regulation of IkappaBalpha/NF-kappaB pathway and innate immune responses.
Kim DI, etal., J Clin Immunol. 2012 Apr;32(2):340-51. Epub 2011 Dec 24.
25.
Loss of insulin-mediated vasoprotection: early effect of diabetes on pericyte-containing microvessels of the retina.
Kobayashi T and Puro DG, Invest Ophthalmol Vis Sci. 2007 May;48(5):2350-5.
26.
Phosphatidylinositol 3-Kinase γ is required for the development of experimental cerebral malaria.
Lacerda-Queiroz N, etal., PLoS One. 2015 Mar 16;10(3):e0119633. doi: 10.1371/journal.pone.0119633. eCollection 2015.
27.
Lack of phosphoinositide 3-kinase-gamma attenuates ventilator-induced lung injury.
Lionetti V, etal., Crit Care Med. 2006 Jan;34(1):134-41.
28.
Repression of microRNA-21 inhibits retinal vascular endothelial cell growth and angiogenesis via PTEN dependent-PI3K/Akt/VEGF signaling pathway in diabetic retinopathy.
Lu JM, etal., Exp Eye Res. 2020 Jan;190:107886. doi: 10.1016/j.exer.2019.107886. Epub 2019 Nov 21.
29.
PI3Kγ mediates kaposi's sarcoma-associated herpesvirus vGPCR-induced sarcomagenesis.
Martin D, etal., Cancer Cell. 2011 Jun 14;19(6):805-13. doi: 10.1016/j.ccr.2011.05.005.
30.
Phosphoinositide-3 kinase gamma activity contributes to sepsis and organ damage by altering neutrophil recruitment.
Martin EL, etal., Am J Respir Crit Care Med. 2010 Sep 15;182(6):762-73. Epub 2010 May 27.
31.
Importance of phosphoinositide 3-kinase gamma in the host defense against pneumococcal infection.
Maus UA, etal., Am J Respir Crit Care Med. 2007 May 1;175(9):958-66. doi: 10.1164/rccm.200610-1533OC. Epub 2007 Feb 22.
32.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
33.
Novel roles of local insulin-like growth factor-1 activation in gastric ulcer healing: promotes actin polymerization, cell proliferation, re-epithelialization, and induces cyclooxygenase-2 in a phosphatidylinositol 3-kinase-dependent manner.
Nguyen T, etal., Am J Pathol. 2007 Apr;170(4):1219-28.
34.
Involvement of phosphoinositide 3-kinase gamma in the neuro-inflammatory response and cognitive impairments induced by beta-amyloid 1-40 peptide in mice.
Passos GF, etal., Brain Behav Immun. 2010 Mar;24(3):493-501. Epub 2009 Dec 16.
35.
Targeted inhibition of beta-adrenergic receptor kinase-1-associated phosphoinositide-3 kinase activity preserves beta-adrenergic receptor signaling and prolongs survival in heart failure induced by calsequestrin overexpression.
Perrino C, etal., J Am Coll Cardiol. 2005 Jun 7;45(11):1862-70.
36.
Insulin granule recruitment and exocytosis is dependent on p110gamma in insulinoma and human beta-cells.
Pigeau GM, etal., Diabetes. 2009 Sep;58(9):2084-92. Epub 2009 Jun 23.
37.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
38.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
39.
Role of PI3Kdelta and PI3Kgamma in inflammatory arthritis and tissue localization of neutrophils.
Randis TM, etal., Eur J Immunol. 2008 May;38(5):1215-24.
40.
GOA pipeline
RGD automated data pipeline
41.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
42.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
43.
Comprehensive gene review and curation
RGD comprehensive gene curation
44.
Absence of PI3Kgamma leads to increased leukocyte apoptosis and diminished severity of experimental autoimmune encephalomyelitis.
Rodrigues DH, etal., J Neuroimmunol. 2010 May;222(1-2):90-4. Epub 2010 Mar 19.
45.
Frontline Science: Coincidental null mutation of Csf2rα in a colony of PI3Kγ-/- mice causes alveolar macrophage deficiency and fatal respiratory viral infection.
Schneider C, etal., J Leukoc Biol. 2017 Feb;101(2):367-376. doi: 10.1189/jlb.4HI0316-157R. Epub 2016 Jul 28.
46.
Association of INPP1, PIK3CG, and TSC2 gene variants with autistic disorder: implications for phosphatidylinositol signalling in autism.
Serajee FJ, etal., J Med Genet. 2003 Nov;40(11):e119.
47.
Canonical PI3Kγ signaling in myeloid cells restricts Trypanosoma cruzi infection and dampens chagasic myocarditis.
Silva MC, etal., Nat Commun. 2018 Apr 17;9(1):1513. doi: 10.1038/s41467-018-03986-3.
48.
Involvement of phosphoinositide 3-kinase gamma in angiogenesis and healing of experimental myocardial infarction in mice.
Siragusa M, etal., Circ Res. 2010 Mar 5;106(4):757-68. Epub 2010 Jan 7.
49.
[The antagonistic effect of PI3K-gamma inhibitor AS605240 on cardiac hypertrophy and cardiac fibrosis induced by isoproterenol in rats].
Song LF, etal., Sichuan Da Xue Xue Bao Yi Xue Ban. 2011 Jul;42(4):471-4.
50.
Phosphatidylinositol 3-kinase-γ signaling promotes Campylobacter jejuni-induced colitis through neutrophil recruitment in mice.
Sun X, etal., J Immunol. 2013 Jan 1;190(1):357-65. doi: 10.4049/jimmunol.1201825. Epub 2012 Nov 23.
51.
Essential role of phosphoinositide 3-kinase gamma in eosinophil chemotaxis within acute pulmonary inflammation.
Thomas M, etal., Immunology. 2009 Mar;126(3):413-22. Epub 2008 Aug 27.
52.
Cardioprotection induced by olprinone, a phosphodiesterase III inhibitor, involves phosphatidylinositol-3-OH kinase-Akt and a mitochondrial permeability transition pore during early reperfusion.
Tosaka S, etal., J Anesth. 2007;21(2):176-80. Epub 2007 May 30.
53.
The absence of functional PI3Kgamma prevents leukocyte recruitment and ameliorates DSS-induced colitis in mice.
van Dop WA, etal., Immunol Lett. 2010 Jun 15;131(1):33-9. doi: 10.1016/j.imlet.2010.03.008. Epub 2010 Mar 27.
54.
CDK2 regulation through PI3K and CDK4 is necessary for cell cycle progression of primary rat hepatocytes.
Wierod L, etal., Cell Prolif. 2007 Aug;40(4):475-87.
55.
The alarmin cytokine, high mobility group box 1, is produced by viable cardiomyocytes and mediates the lipopolysaccharide-induced myocardial dysfunction via a TLR4/phosphatidylinositol 3-kinase gamma pathway.
Xu H, etal., J Immunol. 2010 Feb 1;184(3):1492-8. doi: 10.4049/jimmunol.0902660. Epub 2009 Dec 18.
56.
The PI3K/Akt pathway mediates the nongenomic cardioprotective effects of estrogen following trauma-hemorrhage.
Yu HP, etal., Ann Surg. 2007 Jun;245(6):971-7.
57.
Tissue kallikrein reverses insulin resistance and attenuates nephropathy in diabetic rats by activation of phosphatidylinositol 3-kinase/protein kinase B and adenosine 5'-monophosphate-activated protein kinase signaling pathways.
Yuan G, etal., Endocrinology. 2007 May;148(5):2016-26. Epub 2007 Feb 1.
58.
Involvement of phosphoinositide 3-kinases in neutrophil activation and the development of acute lung injury.
Yum HK, etal., J Immunol. 2001 Dec 1;167(11):6601-8. doi: 10.4049/jimmunol.167.11.6601.
59.
Stimulatory effect of puerarin on bone formation through activation of PI3K/Akt pathway in rat calvaria osteoblasts.
Zhang Y, etal., Planta Med. 2007 Apr;73(4):341-7. Epub 2007 Apr 18.
Pik3cg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 54,494,247 - 54,529,563 (-) NCBI GRCr8 GRCr8 Ensembl 6 54,478,603 - 54,529,509 (-) Ensembl GRCr8 Ensembl mRatBN7.2 6 48,766,778 - 48,802,098 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 48,766,864 - 48,802,043 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 49,076,821 - 49,111,984 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 49,391,750 - 49,426,907 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 48,836,049 - 48,871,239 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 51,465,696 - 51,501,234 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 51,465,908 - 51,498,337 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 61,106,730 - 61,142,184 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 50,441,892 - 50,476,931 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 6 47,971,127 - 48,004,061 (-) NCBI Celera RGSC_v3.1 6 50,447,918 - 50,480,237 (-) NCBI Cytogenetic Map 6 q16 NCBI
PIK3CG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 106,865,282 - 106,908,980 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 106,865,278 - 106,908,980 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 106,505,727 - 106,549,425 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 106,293,160 - 106,334,828 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 106,099,874 - 106,141,543 NCBI Celera 7 101,311,222 - 101,352,879 (+) NCBI Celera Cytogenetic Map 7 q22.3 NCBI HuRef 7 100,864,687 - 100,906,376 (+) NCBI HuRef CHM1_1 7 106,439,450 - 106,481,120 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 108,181,318 - 108,225,014 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 105,867,019 - 105,908,676 (+) NCBI
Pik3cg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 32,223,128 - 32,258,675 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 32,223,472 - 32,258,658 (-) Ensembl GRCm39 Ensembl GRCm38 12 32,173,397 - 32,208,677 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 32,173,473 - 32,208,659 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 32,858,262 - 32,893,514 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 32,760,883 - 32,793,717 (-) NCBI MGSCv36 mm8 Celera 12 33,627,107 - 33,665,676 (-) NCBI Celera Cytogenetic Map 12 A3 NCBI cM Map 12 13.74 NCBI
Pik3cg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955410 11,402,520 - 11,437,422 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955410 11,402,476 - 11,433,335 (+) NCBI ChiLan1.0 ChiLan1.0
PIK3CG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 143,705,405 - 143,748,878 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 191,975,373 - 192,018,845 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 98,841,974 - 98,885,446 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 111,569,947 - 111,611,614 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 111,570,148 - 111,611,614 (+) Ensembl panpan1.1 panPan2
PIK3CG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 13,576,966 - 13,611,748 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 13,570,999 - 13,611,141 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 13,224,877 - 13,259,686 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 13,848,210 - 13,882,893 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 13,847,825 - 13,882,854 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 13,664,384 - 13,696,319 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 13,582,574 - 13,617,381 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 13,862,587 - 13,897,681 (-) NCBI UU_Cfam_GSD_1.0
Pik3cg Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 55,959,678 - 55,990,585 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 17,084,920 - 17,112,258 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 17,084,006 - 17,112,264 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PIK3CG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 106,698,207 - 106,745,099 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 106,698,200 - 106,748,217 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 117,537,774 - 117,572,944 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PIK3CG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 75,781,812 - 75,823,404 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 75,784,648 - 75,825,496 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 28,038,017 - 28,081,732 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pik3cg
.
Predicted Target Of
Count of predictions: 70 Count of miRNA genes: 35 Interacting mature miRNAs: 35 Transcripts: ENSRNOT00000012487, ENSRNOT00000045589 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
9590290 Uminl2 Urine mineral level QTL 2 3.96 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 6 38783989 83783989 Rat 8693632 Alc27 Alcohol consumption QTL 27 2.2 0.791 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 34323357 51121479 Rat 634318 Bw118 Body weight QTL 118 3.55 abdominal fat pad mass (VT:1000711) abdominal fat pad weight (CMO:0000088) 6 33309549 57730294 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 634307 Bp141 Blood pressure QTL 141 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 35230417 80230417 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 1331779 Rf38 Renal function QTL 38 2.876 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 32074428 72227641 Rat 1354632 Scl29 Serum cholesterol level QTL 29 3.74 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 6 35098709 71636405 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 9590140 Scort4 Serum corticosterone level QTL 4 14.49 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 9590306 Scort18 Serum corticosterone level QTL 18 2.88 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 6893340 Cm77 Cardiac mass QTL 77 0.26 0.57 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 33309549 81132889 Rat 70199 Coreg1 Compensatory renal growth QTL 1 11.8 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 6 35691618 57730540 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 1300143 Rf14 Renal function QTL 14 2.92 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 34434137 77102317 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012487 ⟹ ENSRNOP00000012487
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 6 54,494,334 - 54,529,509 (-) Ensembl mRatBN7.2 Ensembl 6 48,766,864 - 48,802,043 (-) Ensembl Rnor_6.0 Ensembl 6 51,465,908 - 51,498,337 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103315 ⟹ ENSRNOP00000093926
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 6 54,497,688 - 54,529,509 (-) Ensembl mRatBN7.2 Ensembl 6 48,770,218 - 48,802,043 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000133203 ⟹ ENSRNOP00000107394
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 6 54,478,603 - 54,529,509 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000142989 ⟹ ENSRNOP00000109703
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 Ensembl 6 54,502,533 - 54,529,509 (-) Ensembl
RefSeq Acc Id:
NM_001371300 ⟹ NP_001358229
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 54,494,334 - 54,529,509 (-) NCBI mRatBN7.2 6 48,766,864 - 48,802,043 (-) NCBI
RefSeq Acc Id:
XM_003750140 ⟹ XP_003750188
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 54,494,247 - 54,529,440 (-) NCBI mRatBN7.2 6 48,766,778 - 48,801,948 (-) NCBI Rnor_6.0 6 51,465,696 - 51,501,233 (-) NCBI Rnor_5.0 6 61,106,730 - 61,142,184 (-) NCBI
Sequence:
TGTGCTTCAGCAGGAAATGCATTTCTGACACTTTTAAAATGAGCAATCACATGTATAATCAACTTGGTTAAAACTTCCTTCCTGGTAACTGCAACACTTCCTCTGCATCTGGATATGAAGGGAGCCCC
hide sequence
RefSeq Acc Id:
XM_006240003 ⟹ XP_006240065
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 54,494,247 - 54,529,563 (-) NCBI mRatBN7.2 6 48,766,778 - 48,802,098 (-) NCBI Rnor_6.0 6 51,465,696 - 51,501,233 (-) NCBI Rnor_5.0 6 61,106,730 - 61,142,184 (-) NCBI
Sequence:
TGTGCTTCAGCAGGAAATGCATTTCTGACACTTTTAAAATGAGCAATCACATGTATAATCAACTTGGTTAAAACTTCCTTCCTGGTAACTGCAACACTTCCTCTGCATCTGGATATGAAGGGAGCCCC
hide sequence
RefSeq Acc Id:
XM_006240004 ⟹ XP_006240066
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 54,494,247 - 54,529,334 (-) NCBI mRatBN7.2 6 48,766,778 - 48,801,948 (-) NCBI Rnor_6.0 6 51,465,696 - 51,501,233 (-) NCBI Rnor_5.0 6 61,106,730 - 61,142,184 (-) NCBI
Sequence:
TGTGCTTCAGCAGGAAATGCATTTCTGACACTTTTAAAATGAGCAATCACATGTATAATCAACTTGGTTAAAACTTCCTTCCTGGTAACTGCAACACTTCCTCTGCATCTGGATATGAAGGGAGCCCC
hide sequence
RefSeq Acc Id:
XP_003750188 ⟸ XM_003750140
- Peptide Label:
isoform X1
- UniProtKB:
D3ZFJ0 (UniProtKB/TrEMBL), A0A8I6AKZ7 (UniProtKB/TrEMBL)
- Sequence:
MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIYDRYQVVQTLDCLRYWKMM
hide sequence
RefSeq Acc Id:
XP_006240065 ⟸ XM_006240003
- Peptide Label:
isoform X1
- UniProtKB:
D3ZFJ0 (UniProtKB/TrEMBL), A0A8I6AKZ7 (UniProtKB/TrEMBL)
- Sequence:
MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIYDRYQVVQTLDCLRYWKMM
hide sequence
RefSeq Acc Id:
XP_006240066 ⟸ XM_006240004
- Peptide Label:
isoform X1
- UniProtKB:
D3ZFJ0 (UniProtKB/TrEMBL), A0A8I6AKZ7 (UniProtKB/TrEMBL)
- Sequence:
MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIYDRYQVVQTLDCLRYWKMM
hide sequence
Ensembl Acc Id:
ENSRNOP00000012487 ⟸ ENSRNOT00000012487
RefSeq Acc Id:
NP_001358229 ⟸ NM_001371300
- UniProtKB:
D3ZFJ0 (UniProtKB/TrEMBL), A0A8I6AKZ7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000093926 ⟸ ENSRNOT00000103315
Ensembl Acc Id:
ENSRNOP00000109703 ⟸ ENSRNOT00000142989
Ensembl Acc Id:
ENSRNOP00000107394 ⟸ ENSRNOT00000133203
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-10
Pik3cg
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
Pik3cg
phosphoinositide-3-kinase, catalytic, gamma polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Pik3cg
phosphoinositide-3-kinase, catalytic, gamma polypeptide
Pik3cg_predicted
phosphoinositide-3-kinase, catalytic, gamma polypeptide (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Pik3cg_predicted
phosphoinositide-3-kinase, catalytic, gamma polypeptide (predicted)
Symbol and Name status set to approved
70820 APPROVED
