Symbol:
Mgst3
Name:
microsomal glutathione S-transferase 3
RGD ID:
1306373
Description:
Enables glutathione peroxidase activity. Predicted to be involved in leukotriene biosynthetic process and prostanoid metabolic process. Predicted to be located in mitochondrial outer membrane. Predicted to be active in endoplasmic reticulum and nuclear envelope. Orthologous to human MGST3 (microsomal glutathione S-transferase 3); PARTICIPATES IN glutathione metabolic pathway; phase I biotransformation pathway via cytochrome P450; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
glutathione S-transferase 3, mitochondrial; LOC289197
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 82,059,480 - 82,080,418 (-) NCBI GRCr8 mRatBN7.2 13 79,526,541 - 79,547,479 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 79,526,541 - 79,547,411 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 82,156,415 - 82,177,230 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 83,463,504 - 83,484,105 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 80,701,212 - 80,722,001 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 85,601,499 - 85,622,392 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 85,601,499 - 85,622,314 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 90,244,188 - 90,265,081 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 83,038,049 - 83,058,802 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 83,052,236 - 83,073,033 (-) NCBI Celera 13 79,231,777 - 79,252,592 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mgst3 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MGST3 mRNA] CTD PMID:31150632 Mgst3 Rat (1->4)-beta-D-glucan multiple interactions ISO Mgst3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MGST3 mRNA CTD PMID:36331819 Mgst3 Rat 1,2-dimethylhydrazine multiple interactions ISO Mgst3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MGST3 mRNA CTD PMID:22206623 Mgst3 Rat 1,2-dimethylhydrazine decreases expression ISO Mgst3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MGST3 mRNA CTD PMID:22206623 Mgst3 Rat 17alpha-ethynylestradiol multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MGST3 mRNA CTD PMID:17942748 Mgst3 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MGST3 mRNA CTD PMID:17557909 Mgst3 Rat 17alpha-ethynylestradiol increases expression ISO Mgst3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MGST3 mRNA CTD PMID:17942748 Mgst3 Rat 17beta-estradiol increases expression ISO Mgst3 (Mus musculus) 6480464 Estradiol results in increased expression of MGST3 mRNA CTD PMID:15289156 Mgst3 Rat 17beta-estradiol decreases expression ISO Mgst3 (Mus musculus) 6480464 Estradiol results in decreased expression of MGST3 mRNA CTD PMID:39298647 Mgst3 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of MGST3 mRNA CTD PMID:32145629 Mgst3 Rat 17beta-estradiol decreases expression ISO MGST3 (Homo sapiens) 6480464 Estradiol results in decreased expression of MGST3 mRNA CTD PMID:23019147 Mgst3 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Mgst3 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Mgst3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 and PMID:32352317 Mgst3 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Mgst3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Mgst3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with AHR protein mutant form] results in increased expression of MGST3 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MGST3 mRNA CTD PMID:17942748 and PMID:22496397 Mgst3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MGST3 mRNA CTD PMID:34747641 Mgst3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MGST3 mRNA CTD PMID:32109520 Mgst3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Mgst3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MGST3 mRNA CTD PMID:28213091 Mgst3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mgst3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MGST3 mRNA CTD PMID:21570461 and PMID:26377647 Mgst3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MGST3 mRNA CTD PMID:18465118 more ... Mgst3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Mgst3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MGST3 mRNA CTD PMID:21346803 Mgst3 Rat 2-butoxyethanol increases expression ISO Mgst3 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of MGST3 mRNA CTD PMID:19812364 Mgst3 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Mgst3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:19692669 and PMID:20959002 Mgst3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Mgst3 (Mus musculus) 6480464 3 more ... CTD PMID:18723825 Mgst3 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Mgst3 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of MGST3 mRNA CTD PMID:30951980 Mgst3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Mgst3 (Mus musculus) 6480464 Fenretinide results in decreased expression of MGST3 mRNA CTD PMID:16467112 and PMID:28973697 Mgst3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of MGST3 mRNA CTD PMID:28959563 Mgst3 Rat aflatoxin B1 decreases expression ISO Mgst3 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of MGST3 mRNA CTD PMID:19770486 Mgst3 Rat aflatoxin B1 increases methylation ISO MGST3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MGST3 gene CTD PMID:27153756 Mgst3 Rat all-trans-retinoic acid multiple interactions ISO Mgst3 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of MGST3 mRNA CTD PMID:30951980 Mgst3 Rat all-trans-retinoic acid decreases expression ISO MGST3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of MGST3 mRNA CTD PMID:33167477 Mgst3 Rat amiodarone increases expression ISO Mgst3 (Mus musculus) 6480464 Amiodarone results in increased expression of MGST3 mRNA CTD PMID:24535564 Mgst3 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of MGST3 mRNA CTD PMID:30047161 Mgst3 Rat antirheumatic drug increases expression ISO MGST3 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of MGST3 mRNA CTD PMID:24449571 Mgst3 Rat Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of MGST3 mRNA CTD PMID:18178546 Mgst3 Rat arsenite(3-) multiple interactions ISO MGST3 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MGST3 mRNA] CTD PMID:32406909 Mgst3 Rat artesunate affects response to substance ISO MGST3 (Homo sapiens) 6480464 MGST3 mRNA affects the susceptibility to artesunate CTD PMID:15796179 Mgst3 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of MGST3 mRNA CTD PMID:36841081 Mgst3 Rat Azoxymethane multiple interactions ISO Mgst3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of MGST3 mRNA CTD PMID:29950665 Mgst3 Rat benzo[a]pyrene increases expression ISO Mgst3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MGST3 mRNA CTD PMID:19770486 Mgst3 Rat benzo[a]pyrene decreases methylation ISO MGST3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MGST3 promoter CTD PMID:27901495 Mgst3 Rat benzo[a]pyrene multiple interactions ISO Mgst3 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of MGST3 mRNA] CTD PMID:22228805 Mgst3 Rat bifenthrin increases expression ISO Mgst3 (Mus musculus) 6480464 bifenthrin results in increased expression of MGST3 mRNA CTD PMID:26071804 Mgst3 Rat bis(2-ethylhexyl) phthalate increases expression ISO MGST3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of MGST3 mRNA CTD PMID:31163220 Mgst3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Mgst3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of MGST3 mRNA CTD PMID:33754040 Mgst3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MGST3 mRNA CTD PMID:25181051 and PMID:32145629 Mgst3 Rat bisphenol A increases expression ISO MGST3 (Homo sapiens) 6480464 bisphenol A results in increased expression of MGST3 protein CTD PMID:37567409 Mgst3 Rat bisphenol A decreases expression ISO Mgst3 (Mus musculus) 6480464 bisphenol A results in decreased expression of MGST3 mRNA CTD PMID:35598803 Mgst3 Rat bisphenol A increases expression ISO Mgst3 (Mus musculus) 6480464 bisphenol A results in increased expression of MGST3 mRNA CTD PMID:34585602 Mgst3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MGST3 mRNA CTD PMID:30816183 more ... Mgst3 Rat bisphenol A affects expression ISO MGST3 (Homo sapiens) 6480464 bisphenol A affects the expression of MGST3 mRNA CTD PMID:30903817 Mgst3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MGST3 mRNA CTD PMID:30903817 Mgst3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MGST3 gene CTD PMID:28505145 Mgst3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of MGST3 gene CTD PMID:28505145 Mgst3 Rat bisphenol AF increases expression ISO MGST3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of MGST3 protein CTD PMID:34186270 Mgst3 Rat Bisphenol B increases expression ISO MGST3 (Homo sapiens) 6480464 bisphenol B results in increased expression of MGST3 protein CTD PMID:34186270 Mgst3 Rat bisphenol F decreases expression ISO Mgst3 (Mus musculus) 6480464 bisphenol F results in decreased expression of MGST3 mRNA CTD PMID:38685157 Mgst3 Rat buta-1,3-diene increases expression ISO Mgst3 (Mus musculus) 6480464 1 and 3-butadiene results in increased expression of MGST3 mRNA CTD PMID:29038090 Mgst3 Rat butylated hydroxyanisole increases expression ISO Mgst3 (Mus musculus) 6480464 Butylated Hydroxyanisole results in increased expression of MGST3 mRNA CTD PMID:18723825 Mgst3 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of MGST3 mRNA CTD PMID:25993096 Mgst3 Rat calciol decreases expression ISO Mgst3 (Mus musculus) 6480464 Cholecalciferol results in decreased expression of MGST3 mRNA CTD PMID:16508948 Mgst3 Rat carbon nanotube increases expression ISO Mgst3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Mgst3 Rat carbon nanotube decreases expression ISO Mgst3 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of MGST3 mRNA CTD PMID:25620056 Mgst3 Rat CGP 52608 multiple interactions ISO MGST3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MGST3 gene] CTD PMID:28238834 Mgst3 Rat chlordecone increases expression ISO Mgst3 (Mus musculus) 6480464 Chlordecone results in increased expression of MGST3 mRNA CTD PMID:33711761 Mgst3 Rat chloropicrin affects expression ISO MGST3 (Homo sapiens) 6480464 chloropicrin affects the expression of MGST3 mRNA CTD PMID:26352163 Mgst3 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of MGST3 mRNA CTD PMID:19440498 Mgst3 Rat cholic acid increases expression ISO Mgst3 (Mus musculus) 6480464 Cholic Acid results in increased expression of MGST3 mRNA CTD PMID:17521389 Mgst3 Rat ciguatoxin CTX1B affects expression ISO Mgst3 (Mus musculus) 6480464 Ciguatoxins affects the expression of MGST3 mRNA CTD PMID:18353800 Mgst3 Rat clofibrate multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MGST3 mRNA more ... CTD PMID:17585979 and PMID:22496397 Mgst3 Rat clofibrate increases expression ISO Mgst3 (Mus musculus) 6480464 Clofibrate results in increased expression of MGST3 mRNA CTD PMID:18723825 and PMID:22496397 Mgst3 Rat copper atom multiple interactions ISO Mgst3 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of MGST3 mRNA CTD PMID:15467011 Mgst3 Rat copper atom multiple interactions ISO MGST3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MGST3 mRNA CTD PMID:30911355 Mgst3 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of MGST3 mRNA CTD PMID:30556269 Mgst3 Rat copper(0) multiple interactions ISO Mgst3 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of MGST3 mRNA CTD PMID:15467011 Mgst3 Rat copper(0) multiple interactions ISO MGST3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MGST3 mRNA CTD PMID:30911355 Mgst3 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of MGST3 mRNA CTD PMID:30556269 Mgst3 Rat coumarin decreases expression EXP 6480464 coumarin results in decreased expression of MGST3 mRNA CTD PMID:18480146 Mgst3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of MGST3 mRNA CTD PMID:26577399 Mgst3 Rat cyclosporin A decreases expression ISO MGST3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MGST3 mRNA CTD PMID:25562108 Mgst3 Rat dexamethasone decreases expression ISO Mgst3 (Mus musculus) 6480464 Dexamethasone results in decreased expression of MGST3 mRNA CTD PMID:18723825 Mgst3 Rat dexamethasone increases expression ISO MGST3 (Homo sapiens) 6480464 Dexamethasone results in increased expression of MGST3 mRNA CTD PMID:25047013 Mgst3 Rat dexamethasone increases expression ISO Mgst3 (Mus musculus) 6480464 Dexamethasone results in increased expression of MGST3 mRNA CTD PMID:22733784 Mgst3 Rat dextran sulfate multiple interactions ISO Mgst3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of MGST3 mRNA CTD PMID:29950665 Mgst3 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of MGST3 mRNA CTD PMID:19440498 Mgst3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of MGST3 mRNA CTD PMID:21266533 Mgst3 Rat dichloroacetic acid increases expression ISO Mgst3 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of MGST3 mRNA CTD PMID:28962523 Mgst3 Rat dicrotophos decreases expression ISO MGST3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of MGST3 mRNA CTD PMID:28302478 Mgst3 Rat diethylstilbestrol increases expression ISO Mgst3 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of MGST3 mRNA CTD PMID:15289156 Mgst3 Rat diethylstilbestrol decreases expression ISO MGST3 (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of MGST3 mRNA CTD PMID:36621641 Mgst3 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of MGST3 mRNA CTD PMID:21658437 Mgst3 Rat dinophysistoxin 1 increases expression ISO MGST3 (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of MGST3 mRNA CTD PMID:28939011 Mgst3 Rat diquat increases expression ISO Mgst3 (Mus musculus) 6480464 Diquat results in increased expression of MGST3 mRNA CTD PMID:36851058 Mgst3 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of MGST3 mRNA CTD PMID:21551480 Mgst3 Rat doxorubicin affects expression ISO MGST3 (Homo sapiens) 6480464 Doxorubicin affects the expression of MGST3 mRNA CTD PMID:29803840 Mgst3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of MGST3 mRNA CTD PMID:29391264 Mgst3 Rat ethanol increases expression ISO Mgst3 (Mus musculus) 6480464 Ethanol results in increased expression of MGST3 mRNA CTD PMID:19167417 Mgst3 Rat ethanol affects expression ISO Mgst3 (Mus musculus) 6480464 Ethanol affects the expression of MGST3 mRNA CTD PMID:30319688 Mgst3 Rat ethoxyquin increases expression ISO Mgst3 (Mus musculus) 6480464 Ethoxyquin results in increased expression of MGST3 mRNA CTD PMID:18723825 Mgst3 Rat fenofibrate increases expression ISO Mgst3 (Mus musculus) 6480464 Fenofibrate results in increased expression of MGST3 mRNA CTD PMID:11798191 Mgst3 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of MGST3 mRNA CTD PMID:24793618 Mgst3 Rat folic acid decreases expression ISO Mgst3 (Mus musculus) 6480464 Folic Acid results in decreased expression of MGST3 mRNA CTD PMID:25629700 Mgst3 Rat folic acid multiple interactions ISO Mgst3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MGST3 mRNA CTD PMID:22206623 Mgst3 Rat genistein increases expression ISO Mgst3 (Mus musculus) 6480464 Genistein results in increased expression of MGST3 mRNA CTD PMID:15289156 Mgst3 Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of MGST3 gene CTD PMID:28505145 Mgst3 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of MGST3 mRNA CTD PMID:24136188 Mgst3 Rat hydrogen peroxide increases expression ISO Mgst3 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of MGST3 mRNA CTD PMID:14729362 Mgst3 Rat hydrogen peroxide increases expression ISO MGST3 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of MGST3 mRNA CTD PMID:18951874 Mgst3 Rat inulin multiple interactions ISO Mgst3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of MGST3 mRNA CTD PMID:36331819 Mgst3 Rat isoflavones affects expression ISO MGST3 (Homo sapiens) 6480464 Isoflavones affects the expression of MGST3 mRNA CTD PMID:16365062 Mgst3 Rat ivermectin decreases expression ISO MGST3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MGST3 protein CTD PMID:32959892 Mgst3 Rat leflunomide decreases expression ISO MGST3 (Homo sapiens) 6480464 leflunomide results in decreased expression of MGST3 mRNA CTD PMID:28988120 Mgst3 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of MGST3 mRNA CTD PMID:24136188 Mgst3 Rat maneb multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of MGST3 mRNA CTD PMID:36117858 Mgst3 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of MGST3 mRNA CTD PMID:28801915 Mgst3 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of MGST3 mRNA CTD PMID:16393664 and PMID:30467583 Mgst3 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of MGST3 mRNA CTD PMID:30047161 Mgst3 Rat methylmercury chloride increases expression ISO MGST3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of MGST3 mRNA CTD PMID:29581082 Mgst3 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of MGST3 mRNA CTD PMID:19840844 Mgst3 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of MGST3 mRNA CTD PMID:24136188 Mgst3 Rat nickel atom affects expression EXP 6480464 Nickel affects the expression of MGST3 mRNA CTD PMID:19440498 Mgst3 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of MGST3 mRNA CTD PMID:24136188 Mgst3 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of MGST3 mRNA CTD PMID:33484710 Mgst3 Rat nitrogen dioxide increases expression ISO MGST3 (Homo sapiens) 6480464 Nitrogen Dioxide results in increased expression of MGST3 mRNA CTD PMID:27206323 Mgst3 Rat nitroprusside affects expression EXP 6480464 Nitroprusside affects the expression of MGST3 mRNA CTD PMID:17496435 Mgst3 Rat okadaic acid multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of MGST3 mRNA CTD PMID:19840844 Mgst3 Rat okadaic acid increases expression ISO MGST3 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of MGST3 mRNA CTD PMID:28939011 Mgst3 Rat oltipraz multiple interactions ISO Mgst3 (Mus musculus) 6480464 [oltipraz results in increased activity of NFE2L2 protein] which results in increased expression of MGST3 mRNA CTD PMID:22496397 Mgst3 Rat oltipraz increases expression ISO Mgst3 (Mus musculus) 6480464 oltipraz results in increased expression of MGST3 mRNA CTD PMID:18723825 and PMID:22496397 Mgst3 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of MGST3 mRNA CTD PMID:25729387 Mgst3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MGST3 mRNA CTD PMID:25729387 Mgst3 Rat ozone multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of MGST3 mRNA CTD PMID:34911549 Mgst3 Rat paracetamol multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MGST3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MGST3 mRNA] CTD PMID:17585979 Mgst3 Rat paracetamol affects expression ISO Mgst3 (Mus musculus) 6480464 Acetaminophen affects the expression of MGST3 mRNA CTD PMID:17562736 Mgst3 Rat paraquat multiple interactions ISO Mgst3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of MGST3 mRNA CTD PMID:36117858 Mgst3 Rat parathion increases expression ISO Mgst3 (Mus musculus) 6480464 Parathion results in increased expression of MGST3 mRNA CTD PMID:34813904 Mgst3 Rat PCB138 multiple interactions ISO Mgst3 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Mgst3 Rat pentachlorophenol increases expression ISO Mgst3 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of MGST3 mRNA CTD PMID:23892564 Mgst3 Rat perfluorooctane-1-sulfonic acid increases expression ISO Mgst3 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of MGST3 mRNA CTD PMID:20936131 Mgst3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mgst3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MGST3 mRNA more ... CTD PMID:36331819 Mgst3 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Mgst3 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of MGST3 mRNA CTD PMID:26300304 Mgst3 Rat perfluorooctanoic acid multiple interactions ISO Mgst3 (Mus musculus) 6480464 [perfluorooctanoic acid co-treated with Dietary Fats more ... CTD PMID:20118188 and PMID:23626681 Mgst3 Rat perfluorooctanoic acid increases expression ISO MGST3 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of MGST3 mRNA CTD PMID:37302725 Mgst3 Rat perfluorooctanoic acid increases expression ISO Mgst3 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of MGST3 mRNA CTD PMID:20118188 and PMID:23626681 Mgst3 Rat phenobarbital affects expression ISO MGST3 (Homo sapiens) 6480464 Phenobarbital affects the expression of MGST3 mRNA CTD PMID:19159669 Mgst3 Rat phenobarbital increases expression ISO Mgst3 (Mus musculus) 6480464 Phenobarbital results in increased expression of MGST3 mRNA CTD PMID:31836555 Mgst3 Rat phenobarbital affects expression ISO Mgst3 (Mus musculus) 6480464 Phenobarbital affects the expression of MGST3 mRNA CTD PMID:23091169 Mgst3 Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of MGST3 mRNA CTD PMID:33945839 Mgst3 Rat pirinixic acid multiple interactions ISO MGST3 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of MGST3 mRNA CTD PMID:19710929 Mgst3 Rat pirinixic acid increases expression ISO Mgst3 (Mus musculus) 6480464 pirinixic acid results in increased expression of MGST3 mRNA CTD PMID:11798191 more ... Mgst3 Rat pirinixic acid multiple interactions ISO Mgst3 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of MGST3 mRNA CTD PMID:20813756 Mgst3 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of MGST3 mRNA CTD PMID:19162173 Mgst3 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Mgst3 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of MGST3 mRNA CTD PMID:18723825 Mgst3 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of MGST3 mRNA CTD PMID:30047161 Mgst3 Rat pyrazinecarboxamide increases expression EXP 6480464 Pyrazinamide results in increased expression of MGST3 mRNA CTD PMID:22431067 Mgst3 Rat Rebamipide increases expression EXP 6480464 rebamipide results in increased expression of MGST3 mRNA CTD PMID:18299717 Mgst3 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of MGST3 mRNA CTD PMID:19228061 Mgst3 Rat sodium arsenite increases expression ISO MGST3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MGST3 mRNA CTD PMID:28229933 and PMID:34032870 Mgst3 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of MGST3 mRNA CTD PMID:25993096 Mgst3 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of MGST3 mRNA CTD PMID:30047161 Mgst3 Rat sulindac multiple interactions EXP 6480464 [Sulindac co-treated with lipopolysaccharide and E coli O55-B5] affects the expression of MGST3 mRNA CTD PMID:20371263 Mgst3 Rat sunitinib decreases expression ISO MGST3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of MGST3 mRNA CTD PMID:31533062 Mgst3 Rat temozolomide decreases expression ISO MGST3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of MGST3 mRNA CTD PMID:31758290 Mgst3 Rat tert-butyl hydroperoxide decreases expression ISO MGST3 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of MGST3 mRNA CTD PMID:15336504 Mgst3 Rat tert-butyl hydroperoxide increases expression ISO Mgst3 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of MGST3 mRNA CTD PMID:14729362 and PMID:15336504 Mgst3 Rat tetrachloromethane affects expression ISO Mgst3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of MGST3 mRNA CTD PMID:17484886 Mgst3 Rat tetrachloromethane increases expression ISO Mgst3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of MGST3 mRNA CTD PMID:31919559 Mgst3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MGST3 mRNA CTD PMID:31150632 Mgst3 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of MGST3 mRNA] CTD PMID:31150632 Mgst3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MGST3 mRNA CTD PMID:34492290 Mgst3 Rat titanium dioxide multiple interactions ISO Mgst3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of MGST3 mRNA CTD PMID:29950665 Mgst3 Rat titanium dioxide decreases methylation ISO Mgst3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MGST3 promoter CTD PMID:35295148 Mgst3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MGST3 mRNA CTD PMID:25729387 Mgst3 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of MGST3 mRNA CTD PMID:25729387 Mgst3 Rat trichloroethene increases expression ISO Mgst3 (Mus musculus) 6480464 Trichloroethylene results in increased expression of MGST3 mRNA CTD PMID:25549359 Mgst3 Rat trimellitic anhydride decreases expression ISO Mgst3 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of MGST3 mRNA CTD PMID:19042947 Mgst3 Rat troglitazone increases expression ISO Mgst3 (Mus musculus) 6480464 troglitazone results in increased expression of MGST3 mRNA CTD PMID:28973697 Mgst3 Rat troglitazone increases expression ISO MGST3 (Homo sapiens) 6480464 troglitazone results in increased expression of MGST3 mRNA CTD PMID:25572481 Mgst3 Rat tunicamycin decreases expression ISO Mgst3 (Mus musculus) 6480464 Tunicamycin results in decreased expression of MGST3 mRNA CTD PMID:17127020 Mgst3 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of MGST3 mRNA CTD PMID:24136188 Mgst3 Rat valproic acid affects expression ISO Mgst3 (Mus musculus) 6480464 Valproic Acid affects the expression of MGST3 mRNA CTD PMID:17292431 Mgst3 Rat valproic acid increases expression ISO Mgst3 (Mus musculus) 6480464 Valproic Acid results in increased expression of MGST3 mRNA CTD PMID:21427059 and PMID:24535564 Mgst3 Rat valproic acid decreases methylation ISO MGST3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of MGST3 gene CTD PMID:29154799 Mgst3 Rat valproic acid affects expression ISO MGST3 (Homo sapiens) 6480464 Valproic Acid affects the expression of MGST3 mRNA CTD PMID:25979313 Mgst3 Rat valproic acid increases expression ISO MGST3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MGST3 mRNA CTD PMID:23179753 more ...
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) amitrole (EXP) antirheumatic drug (ISO) Aroclor 1254 (EXP) arsenite(3-) (ISO) artesunate (ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) bifenthrin (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butylated hydroxyanisole (ISO) cadmium dichloride (EXP) calciol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chloropicrin (ISO) chlorpyrifos (EXP) cholic acid (ISO) ciguatoxin CTX1B (ISO) clofibrate (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) coumarin (EXP) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) dextran sulfate (ISO) diazinon (EXP) dibutyl phthalate (EXP) dichloroacetic acid (ISO) dicrotophos (ISO) diethylstilbestrol (EXP,ISO) dinophysistoxin 1 (ISO) diquat (ISO) diuron (EXP) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) ethoxyquin (ISO) fenofibrate (ISO) flutamide (EXP) folic acid (ISO) genistein (EXP,ISO) glafenine (EXP) hydrogen peroxide (ISO) inulin (ISO) isoflavones (ISO) ivermectin (ISO) leflunomide (EXP,ISO) maneb (ISO) manganese(II) chloride (EXP) methapyrilene (EXP) methimazole (EXP) methylmercury chloride (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) nefazodone (EXP) nickel atom (EXP) nimesulide (EXP) nitrofen (EXP) nitrogen dioxide (ISO) nitroprusside (EXP) okadaic acid (ISO) oltipraz (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraquat (ISO) parathion (ISO) PCB138 (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) PhIP (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) propiconazole (EXP) pyrazinecarboxamide (EXP) Rebamipide (EXP) resveratrol (EXP) sodium arsenite (ISO) sodium dichromate (EXP) sulfadimethoxine (EXP) sulindac (EXP) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichloroethene (ISO) trimellitic anhydride (ISO) troglitazone (ISO) tunicamycin (ISO) valdecoxib (EXP) valproic acid (ISO)
Mgst3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 82,059,480 - 82,080,418 (-) NCBI GRCr8 mRatBN7.2 13 79,526,541 - 79,547,479 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 79,526,541 - 79,547,411 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 82,156,415 - 82,177,230 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 83,463,504 - 83,484,105 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 80,701,212 - 80,722,001 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 85,601,499 - 85,622,392 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 85,601,499 - 85,622,314 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 90,244,188 - 90,265,081 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 83,038,049 - 83,058,802 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 83,052,236 - 83,073,033 (-) NCBI Celera 13 79,231,777 - 79,252,592 (-) NCBI Celera Cytogenetic Map 13 q24 NCBI
MGST3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 165,631,234 - 165,656,136 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 165,631,213 - 165,661,796 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 165,600,471 - 165,625,373 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 163,867,074 - 163,891,481 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 162,332,107 - 162,356,511 NCBI Celera 1 138,705,621 - 138,730,025 (+) NCBI Celera Cytogenetic Map 1 q24.1 NCBI HuRef 1 136,847,571 - 136,872,857 (+) NCBI HuRef CHM1_1 1 167,022,686 - 167,047,957 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 164,977,647 - 165,002,573 (+) NCBI T2T-CHM13v2.0
Mgst3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 167,199,535 - 167,221,410 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 167,199,535 - 167,221,410 (-) Ensembl GRCm39 Ensembl GRCm38 1 167,371,966 - 167,393,841 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 167,371,966 - 167,393,841 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 169,302,515 - 169,323,928 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 169,209,059 - 169,230,472 (-) NCBI MGSCv36 mm8 Celera 1 169,789,931 - 169,811,361 (-) NCBI Celera Cytogenetic Map 1 H2.3 NCBI cM Map 1 74.76 NCBI
Mgst3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955462 11,024,789 - 11,031,282 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955462 11,024,678 - 11,041,851 (-) NCBI ChiLan1.0 ChiLan1.0
MGST3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 84,110,120 - 84,137,066 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 83,778,739 - 83,805,682 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 141,063,051 - 141,087,563 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 144,852,428 - 144,876,800 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 144,868,059 - 144,876,684 (+) Ensembl panpan1.1 panPan2
MGST3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 38 17,670,329 - 17,691,822 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 38 17,668,752 - 17,718,704 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 38 17,726,881 - 17,748,346 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 38 17,724,958 - 17,751,927 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 38 17,724,911 - 17,778,579 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 38 17,723,864 - 17,745,307 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 38 18,075,030 - 18,096,456 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 38 18,369,309 - 18,390,981 (-) NCBI UU_Cfam_GSD_1.0
Mgst3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 101,807,586 - 101,819,050 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 19,654,441 - 19,659,291 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 19,654,335 - 19,665,994 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MGST3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 85,069,607 - 85,094,981 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 85,069,603 - 85,095,022 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 92,725,520 - 92,750,937 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MGST3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 63,227,351 - 63,252,547 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 63,224,338 - 63,252,340 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 64,986,997 - 65,012,877 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mgst3
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 36 Interacting mature miRNAs: 39 Transcripts: ENSRNOT00000005719 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 8655959 Pur32 Proteinuria QTL 32 8.4 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 74023918 97213863 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738027 Lnnr6 Liver neoplastic nodule remodeling QTL 6 3.3 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 74862117 85581182 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 11530006 Niddm72 Non-insulin dependent diabetes mellitus QTL 72 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 13 74023918 80753406 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 2293341 Glom15 Glomerulus QTL 15 9.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 13 74862117 101339893 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005719 ⟹ ENSRNOP00000005719
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 79,526,541 - 79,547,411 (-) Ensembl Rnor_6.0 Ensembl 13 85,601,499 - 85,622,314 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097875 ⟹ ENSRNOP00000089717
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 79,526,541 - 79,532,869 (-) Ensembl
RefSeq Acc Id:
NM_001191594 ⟹ NP_001178523
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 82,059,480 - 82,080,295 (-) NCBI mRatBN7.2 13 79,526,541 - 79,547,356 (-) NCBI Rnor_6.0 13 85,601,499 - 85,622,314 (-) NCBI Rnor_5.0 13 90,244,188 - 90,265,081 (-) NCBI Celera 13 79,231,777 - 79,252,592 (-) NCBI
Sequence:
GGTCTGCACCAGGCGCGTCAAGAGCCAAGATGGCTGTCCTCTCTAAGGAATATGGATTCGTGCTTCTCACTGGTGCCGCCAGCTTTGTGATGGTGCTCCACCTAGCCATCAACGTGGGCAAAGCCCGC
hide sequence
RefSeq Acc Id:
XM_006250209 ⟹ XP_006250271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 82,059,480 - 82,080,418 (-) NCBI mRatBN7.2 13 79,526,541 - 79,547,479 (-) NCBI Rnor_6.0 13 85,601,499 - 85,622,392 (-) NCBI Rnor_5.0 13 90,244,188 - 90,265,081 (-) NCBI
Sequence:
CCACGCGCTGCCCAAGGCGGAGTGGGGCGGGTCCTGCGGGACAGCTAGAGCCGCACCCAGGCATTGCTGCACGGCTCAGGTCTGCACCAGGCGCGTCAAGGTGAGCCAGAGCCAAGATGGCTGTCCTC
hide sequence
RefSeq Acc Id:
XM_039090502 ⟹ XP_038946430
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 82,059,480 - 82,080,026 (-) NCBI mRatBN7.2 13 79,526,541 - 79,547,086 (-) NCBI
RefSeq Acc Id:
NP_001178523 ⟸ NM_001191594
- UniProtKB:
D4ADS4 (UniProtKB/TrEMBL), A6IDL5 (UniProtKB/TrEMBL), A0A8I6AAX9 (UniProtKB/TrEMBL)
- Sequence:
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGVAWIIGRVLYAYGYYTGDPSKRYRGAVSSLALFALMGT
hide sequence
RefSeq Acc Id:
XP_006250271 ⟸ XM_006250209
- Peptide Label:
isoform X1
- Sequence:
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNT
hide sequence
Ensembl Acc Id:
ENSRNOP00000005719 ⟸ ENSRNOT00000005719
RefSeq Acc Id:
XP_038946430 ⟸ XM_039090502
- Peptide Label:
isoform X1
- UniProtKB:
D4ADS4 (UniProtKB/TrEMBL), A6IDL5 (UniProtKB/TrEMBL), A0A8I6AAX9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000089717 ⟸ ENSRNOT00000097875
RGD ID: 13698974 Promoter ID: EPDNEW_R9499 Type: multiple initiation site Name: Mgst3_1 Description: microsomal glutathione S-transferase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 85,622,352 - 85,622,412 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Mgst3
microsomal glutathione S-transferase 3
Mgst3_predicted
microsomal glutathione S-transferase 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Mgst3_predicted
microsomal glutathione S-transferase 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
