Symbol:
Pak6
Name:
p21 (RAC1) activated kinase 6
RGD ID:
1306213
Description:
Predicted to enable protein serine/threonine kinase activity. Predicted to be involved in cellular response to starvation; intracellular signal transduction; and regulation of MAPK cascade. Predicted to act upstream of or within learning or memory; locomotory behavior; and neuron projection morphogenesis. Predicted to be located in cell junction; fibrillar center; and nucleoplasm. Predicted to be active in cytoplasm and postsynaptic density. Human ortholog(s) of this gene implicated in clear cell renal cell carcinoma. Orthologous to several human genes including PAK6 (p21 (RAC1) activated kinase 6); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; renal cell carcinoma pathway; T cell receptor signaling pathway; INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 6-propyl-2-thiouracil; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC296078; p21 (CDKN1A)-activated kinase 6; p21 protein (Cdc42/Rac)-activated kinase 6; p21-activated kinase 6; serine/threonine-protein kinase PAK 6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PAK6 (p21 (RAC1) activated kinase 6) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):
Pak6 (p21 (RAC1) activated kinase 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pak6 (p21 (RAC1) activated kinase 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PAK6 (p21 (RAC1) activated kinase 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PAK6 (p21 (RAC1) activated kinase 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pak6 (p21 (RAC1) activated kinase 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PAK6 (p21 (RAC1) activated kinase 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PAK6 (p21 (RAC1) activated kinase 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pak6 (p21 (RAC1) activated kinase 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PAK6 (p21 (RAC1) activated kinase 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pak6 (p21 (RAC1) activated kinase 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BUB1B-PAK6 (BUB1B-PAK6 readthrough)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pak6b (p21 protein (Cdc42/Rac)-activated kinase 6b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CLA4
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
mbt
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
pak-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SKM1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
pak6
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 126,092,576 - 126,128,320 (+) NCBI GRCr8 mRatBN7.2 3 105,638,248 - 105,674,399 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 105,638,653 - 105,672,975 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 109,312,014 - 109,345,868 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 117,907,575 - 117,941,432 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 115,567,941 - 115,601,794 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 110,442,175 - 110,486,317 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 110,442,637 - 110,487,526 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 116,987,226 - 117,027,426 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 105,141,150 - 105,191,676 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 105,080,467 - 105,088,577 (+) NCBI Celera 3 104,554,473 - 104,587,411 (+) NCBI Celera Cytogenetic Map 3 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pak6 Rat 17beta-estradiol multiple interactions ISO RGD:1314703 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PAK6 mRNA; Estradiol inhibits the more ... CTD PMID:29389661|PMID:30165855|PMID:32088792 Pak6 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2,5,2',5'-tetrachlorobiphenyl results in decreased expression of PAK6 mRNA CTD PMID:23829299 Pak6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1314704 6480464 Tetrachlorodibenzodioxin affects the expression of PAK6 mRNA CTD PMID:21570461 Pak6 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1314704 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of PAK6 mRNA CTD PMID:20188158|PMID:26251327 Pak6 Rat 3-methylcholanthrene multiple interactions ISO RGD:1314704 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of PAK6 mRNA CTD PMID:23519560 Pak6 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1314703 6480464 bisphenol S inhibits the reaction [ESR1 protein binds to PAK6 protein] CTD PMID:29389661 Pak6 Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1314704 6480464 bisphenol S affects the methylation of PAK6 gene CTD PMID:31683443 Pak6 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PAK6 mRNA CTD PMID:24780913 Pak6 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PAK6 mRNA CTD PMID:28959563 Pak6 Rat afimoxifene decreases response to substance ISO RGD:1314703 6480464 PAK6 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Pak6 Rat all-trans-retinoic acid multiple interactions ISO RGD:1314704 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PAK6 mRNA CTD PMID:36189433 Pak6 Rat all-trans-retinoic acid decreases expression ISO RGD:1314704 6480464 Tretinoin results in decreased expression of PAK6 mRNA CTD PMID:36189433 Pak6 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PAK6 mRNA CTD PMID:30779732 Pak6 Rat aristolochic acid A increases expression ISO RGD:1314703 6480464 aristolochic acid I results in increased expression of PAK6 mRNA CTD PMID:33212167 Pak6 Rat arsenite(3-) increases expression ISO RGD:1314704 6480464 arsenite results in increased expression of PAK6 mRNA CTD PMID:33053406 Pak6 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PAK6 gene CTD PMID:35440735 Pak6 Rat benzo[a]pyrene decreases expression ISO RGD:1314704 6480464 Benzo(a)pyrene results in decreased expression of PAK6 mRNA CTD PMID:19770486 Pak6 Rat benzo[a]pyrene increases expression ISO RGD:1314703 6480464 Benzo(a)pyrene results in increased expression of PAK6 mRNA CTD PMID:35870112 Pak6 Rat benzo[a]pyrene affects methylation ISO RGD:1314703 6480464 Benzo(a)pyrene affects the methylation of PAK6 5' UTR CTD PMID:27901495 Pak6 Rat benzo[a]pyrene decreases methylation ISO RGD:1314703 6480464 Benzo(a)pyrene results in decreased methylation of PAK6 exon CTD PMID:27901495 Pak6 Rat benzo[a]pyrene increases expression ISO RGD:1314704 6480464 Benzo(a)pyrene results in increased expression of PAK6 mRNA CTD PMID:23735875 Pak6 Rat benzo[e]pyrene increases methylation ISO RGD:1314703 6480464 benzo(e)pyrene results in increased methylation of PAK6 3' UTR CTD PMID:30157460 Pak6 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PAK6 mRNA CTD PMID:26496021 Pak6 Rat bisphenol A increases expression ISO RGD:1314704 6480464 bisphenol A results in increased expression of PAK6 mRNA CTD PMID:34585602 Pak6 Rat bisphenol A increases methylation ISO RGD:1314704 6480464 bisphenol A results in increased methylation of PAK6 promoter CTD PMID:27312807 Pak6 Rat bisphenol A multiple interactions ISO RGD:1314703 6480464 [bisphenol A binds to and affects the folding of AR protein] promotes the reaction [AR more ... CTD PMID:28751236 Pak6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PAK6 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:34947998 Pak6 Rat bisphenol AF multiple interactions ISO RGD:1314703 6480464 [bisphenol AF binds to and affects the folding of AR protein] promotes the reaction [AR more ... CTD PMID:28751236|PMID:29389661 Pak6 Rat cadmium dichloride affects expression ISO RGD:1314704 6480464 Cadmium Chloride affects the expression of PAK6 mRNA CTD PMID:29408670 Pak6 Rat cadmium dichloride decreases expression ISO RGD:1314703 6480464 Cadmium Chloride results in decreased expression of PAK6 mRNA CTD PMID:38568856 Pak6 Rat calcitriol decreases expression ISO RGD:1314703 6480464 Calcitriol results in decreased expression of PAK6 mRNA CTD PMID:16002434 Pak6 Rat carbon nanotube increases expression ISO RGD:1314704 6480464 Nanotubes, Carbon analog results in increased expression of PAK6 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Pak6 Rat chlorpyrifos increases expression ISO RGD:1314704 6480464 Chlorpyrifos results in increased expression of PAK6 mRNA CTD PMID:37019170 Pak6 Rat cocaine decreases expression ISO RGD:1314703 6480464 Cocaine results in decreased expression of PAK6 mRNA CTD PMID:18000554 Pak6 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of PAK6 mRNA CTD PMID:26033743 Pak6 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of PAK6 mRNA CTD PMID:26033743 Pak6 Rat copper(II) chloride decreases expression ISO RGD:1314703 6480464 cupric chloride results in decreased expression of PAK6 mRNA CTD PMID:38568856 Pak6 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PAK6 mRNA CTD PMID:26577399 Pak6 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PAK6 mRNA CTD PMID:27523638 Pak6 Rat cyclosporin A decreases methylation ISO RGD:1314703 6480464 Cyclosporine results in decreased methylation of PAK6 promoter CTD PMID:27989131 Pak6 Rat DDE decreases expression ISO RGD:1314703 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of PAK6 mRNA CTD PMID:38568856 Pak6 Rat Dibutyl phosphate affects expression ISO RGD:1314703 6480464 di-n-butylphosphoric acid affects the expression of PAK6 mRNA CTD PMID:37042841 Pak6 Rat dorsomorphin multiple interactions ISO RGD:1314703 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Pak6 Rat entinostat increases expression ISO RGD:1314703 6480464 entinostat results in increased expression of PAK6 mRNA CTD PMID:26272509 Pak6 Rat entinostat multiple interactions ISO RGD:1314703 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Pak6 Rat finasteride decreases expression EXP 6480464 Finasteride results in decreased expression of PAK6 mRNA CTD PMID:24136188 Pak6 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PAK6 mRNA CTD PMID:33387578 Pak6 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of PAK6 mRNA CTD PMID:22129741 Pak6 Rat lead(0) affects expression ISO RGD:1314703 6480464 Lead affects the expression of PAK6 mRNA CTD PMID:28903495 Pak6 Rat maneb multiple interactions ISO RGD:1314704 6480464 [Maneb co-treated with Paraquat] results in decreased expression of PAK6 mRNA CTD PMID:36117858 Pak6 Rat mercury dibromide multiple interactions ISO RGD:1314703 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Pak6 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of PAK6 mRNA CTD PMID:35863504 Pak6 Rat methapyrilene increases methylation ISO RGD:1314703 6480464 Methapyrilene results in increased methylation of PAK6 3' UTR CTD PMID:30157460 Pak6 Rat methotrexate increases expression ISO RGD:1314703 6480464 Methotrexate results in increased expression of PAK6 mRNA CTD PMID:21678067 Pak6 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1314704 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PAK6 mRNA CTD PMID:36189433 Pak6 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of PAK6 mRNA CTD PMID:22129741 Pak6 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of PAK6 mRNA CTD PMID:22129741 Pak6 Rat ozone multiple interactions ISO RGD:1314704 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Pak6 Rat paracetamol affects expression ISO RGD:1314704 6480464 Acetaminophen affects the expression of PAK6 mRNA CTD PMID:17562736 Pak6 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PAK6 mRNA CTD PMID:33387578 Pak6 Rat paraquat multiple interactions ISO RGD:1314704 6480464 [Maneb co-treated with Paraquat] results in decreased expression of PAK6 mRNA CTD PMID:36117858 Pak6 Rat PCB138 affects expression EXP 6480464 2,2',3',4,4',5-hexachlorobiphenyl affects the expression of PAK6 mRNA CTD PMID:23829299 Pak6 Rat phenobarbital affects expression ISO RGD:1314704 6480464 Phenobarbital affects the expression of PAK6 mRNA CTD PMID:19136022 Pak6 Rat phenylmercury acetate increases expression ISO RGD:1314703 6480464 Phenylmercuric Acetate results in increased expression of PAK6 mRNA CTD PMID:26272509 Pak6 Rat phenylmercury acetate multiple interactions ISO RGD:1314703 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Pak6 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:1314704 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of PAK6 mRNA CTD PMID:23519560 Pak6 Rat pirinixic acid affects expression ISO RGD:1314704 6480464 pirinixic acid affects the expression of PAK6 mRNA CTD PMID:19136022 Pak6 Rat pirinixic acid decreases expression ISO RGD:1314704 6480464 pirinixic acid results in decreased expression of PAK6 mRNA CTD PMID:23811191 Pak6 Rat potassium dichromate decreases expression ISO RGD:1314704 6480464 Potassium Dichromate results in decreased expression of PAK6 mRNA CTD PMID:23608068 Pak6 Rat resveratrol multiple interactions ISO RGD:1314703 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PAK6 mRNA CTD PMID:23557933 Pak6 Rat SB 431542 multiple interactions ISO RGD:1314703 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Pak6 Rat sodium arsenite decreases expression ISO RGD:1314703 6480464 sodium arsenite results in decreased expression of PAK6 mRNA CTD PMID:38568856 Pak6 Rat sodium arsenite decreases expression ISO RGD:1314704 6480464 sodium arsenite results in decreased expression of PAK6 mRNA CTD PMID:37682722 Pak6 Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of PAK6 mRNA CTD PMID:24136188 Pak6 Rat sunitinib decreases expression ISO RGD:1314703 6480464 Sunitinib results in decreased expression of PAK6 mRNA CTD PMID:31533062 Pak6 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PAK6 mRNA CTD PMID:26496021 Pak6 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PAK6 mRNA CTD PMID:22659510 Pak6 Rat titanium dioxide decreases methylation ISO RGD:1314704 6480464 titanium dioxide results in decreased methylation of PAK6 gene CTD PMID:35295148 Pak6 Rat titanium dioxide increases methylation ISO RGD:1314704 6480464 titanium dioxide results in increased methylation of PAK6 promoter CTD PMID:35295148 Pak6 Rat triphenyl phosphate affects expression ISO RGD:1314703 6480464 triphenyl phosphate affects the expression of PAK6 mRNA CTD PMID:37042841 Pak6 Rat triptonide increases expression ISO RGD:1314704 6480464 triptonide results in increased expression of PAK6 mRNA CTD PMID:33045310 Pak6 Rat valproic acid affects expression ISO RGD:1314703 6480464 Valproic Acid affects the expression of PAK6 mRNA CTD PMID:25979313 Pak6 Rat valproic acid multiple interactions ISO RGD:1314703 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Pak6 Rat valproic acid increases expression ISO RGD:1314703 6480464 Valproic Acid results in increased expression of PAK6 mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509|PMID:27188386 Pak6 Rat valproic acid increases methylation ISO RGD:1314703 6480464 Valproic Acid results in increased methylation of PAK6 gene CTD PMID:29154799 Pak6 Rat vanadyl sulfate decreases expression ISO RGD:1314703 6480464 vanadyl sulfate results in decreased expression of PAK6 mRNA CTD PMID:16330358
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Pak6 Rat ATP binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Pak6 Rat ATP binding enables IEA InterPro:IPR000719|InterPro:IPR017441 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pak6 Rat kinase activity enables IEA UniProtKB-KW:KW-0418 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pak6 Rat nucleotide binding enables IEA UniRule:UR001503341 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Pak6 Rat protein binding enables ISO RGD:1314703 1624291 UniProtKB:O75031|UniProtKB:P60953|UniProtKB:P62258|UniProtKB:Q5S007|UniProtKB:Q96L33|UniProtKB:Q9H4E5 PMID:20936779, PMID:24510904, PMID:24947832, PMID:25416956, PMID:28514442, PMID:31515488, PMID:31980649, PMID:32296183, PMID:32707033, PMID:33961781, PMID:36931259 RGD PMID:20936779|PMID:24510904|PMID:24947832|PMID:25416956|PMID:28514442|PMID:31515488|PMID:31980649|PMID:32296183|PMID:32707033|PMID:33961781|PMID:36931259 Pak6 Rat protein kinase activity enables IEA InterPro:IPR000719 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pak6 Rat protein serine/threonine kinase activity enables IEA UniProtKB-KW:KW-0723 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pak6 Rat protein serine/threonine kinase activity enables IEA EC:2.7.11.1 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Pak6 Rat protein serine/threonine kinase activity enables IEA InterPro:IPR033923 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pak6 Rat protein serine/threonine kinase activity enables IBA CGD:CAL0000192143|FB:FBgn0025743|FB:FBgn0044826|FB:FBgn0261456|FB:FBgn0267698|MGI:1339975|MGI:1339984|MGI:1349394|MGI:1355329|MGI:1920334|PANTHER:PTN000684825|PomBase:SPAC1F5.09c|PomBase:SPBC1604.14c|RGD:3250|RGD:3251|RGD:621590|SGD:S000000999|SGD:S000005242|UniProtKB:O75914|UniProtKB:O95819|UniProtKB:O96013|UniProtKB:Q13043|UniProtKB:Q13153|UniProtKB:Q13177|UniProtKB:Q13188|UniProtKB:Q8N4C8|UniProtKB:Q9H2K8|UniProtKB:Q9UKE5|WB:WBGene00003144|dictyBase:DDB_G0269166|dictyBase:DDB_G0276459 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pak6 Rat transferase activity enables IEA UniProtKB-KW:KW-0808 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - KEGG (archival)
17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) afimoxifene (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cocaine (ISO) copper atom (EXP) copper(0) (EXP) copper(II) chloride (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) entinostat (ISO) finasteride (EXP) gentamycin (EXP) indole-3-methanol (EXP) lead(0) (ISO) maneb (ISO) mercury dibromide (ISO) methamphetamine (EXP) methapyrilene (ISO) methotrexate (ISO) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) PCB138 (EXP) phenobarbital (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) potassium dichromate (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulindac (EXP) sunitinib (ISO) testosterone (EXP) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vanadyl sulfate (ISO)
Pak6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 126,092,576 - 126,128,320 (+) NCBI GRCr8 mRatBN7.2 3 105,638,248 - 105,674,399 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 105,638,653 - 105,672,975 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 109,312,014 - 109,345,868 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 117,907,575 - 117,941,432 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 115,567,941 - 115,601,794 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 110,442,175 - 110,486,317 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 110,442,637 - 110,487,526 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 116,987,226 - 117,027,426 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 105,141,150 - 105,191,676 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 105,080,467 - 105,088,577 (+) NCBI Celera 3 104,554,473 - 104,587,411 (+) NCBI Celera Cytogenetic Map 3 q35 NCBI
PAK6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 40,239,063 - 40,277,487 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 40,217,428 - 40,277,487 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 40,531,264 - 40,569,688 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 38,319,368 - 38,356,979 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 38,319,367 - 38,356,979 NCBI Celera 15 17,275,604 - 17,335,680 (+) NCBI Celera Cytogenetic Map 15 q15.1 NCBI HuRef 15 17,352,605 - 17,412,646 (+) NCBI HuRef CHM1_1 15 40,629,582 - 40,689,654 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 38,045,955 - 38,084,404 (+) NCBI T2T-CHM13v2.0
Pak6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 118,493,531 - 118,528,501 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 118,493,784 - 118,528,501 (+) Ensembl GRCm39 Ensembl GRCm38 2 118,663,045 - 118,698,020 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 118,663,303 - 118,698,020 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 118,489,313 - 118,523,756 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 118,354,744 - 118,388,677 (+) NCBI MGSCv36 mm8 Celera 2 119,818,133 - 119,852,648 (+) NCBI Celera Cytogenetic Map 2 E5 NCBI cM Map 2 59.41 NCBI
Pak6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 7,178,524 - 7,212,053 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 7,190,584 - 7,211,705 (+) NCBI ChiLan1.0 ChiLan1.0
PAK6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 29,473,050 - 29,511,489 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 33,624,528 - 33,662,919 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 19,173,171 - 19,211,572 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 37,441,567 - 37,466,520 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 37,453,802 - 37,465,119 (+) Ensembl panpan1.1 panPan2
PAK6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 7,424,410 - 7,462,265 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 7,425,948 - 7,461,815 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 7,478,897 - 7,516,220 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 7,553,994 - 7,588,094 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 7,577,691 - 7,588,086 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 7,475,297 - 7,512,646 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 7,581,248 - 7,618,595 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 7,709,827 - 7,747,189 (+) NCBI UU_Cfam_GSD_1.0
Pak6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 85,863,845 - 85,899,290 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 3,713,406 - 3,747,356 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 3,692,058 - 3,747,355 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PAK6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 131,039,318 - 131,076,631 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 131,039,313 - 131,077,420 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 146,145,830 - 146,151,173 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PAK6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 42,737,848 - 42,798,960 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 42,737,613 - 42,750,248 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 98,187,124 - 98,226,525 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pak6
.
Predicted Target Of
Count of predictions: 105 Count of miRNA genes: 87 Interacting mature miRNAs: 94 Transcripts: ENSRNOT00000010471 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1582216 Bw65 Body weight QTL 65 6.3 body mass (VT:0001259) body weight (CMO:0000012) 3 102200529 115665732 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582219 Bw63 Body weight QTL 63 3.8 0.001 body mass (VT:0001259) body weight (CMO:0000012) 3 96127817 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 2302273 Gluco35 Glucose level QTL 35 5.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 80800231 114297550 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH131540
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 126,128,083 - 126,128,296 (+) Marker Load Pipeline mRatBN7.2 3 105,674,162 - 105,674,375 (+) MAPPER mRatBN7.2 Rnor_6.0 3 110,487,108 - 110,487,320 NCBI Rnor6.0 Rnor_5.0 3 117,028,025 - 117,028,237 UniSTS Rnor5.0 RGSC_v3.4 3 105,192,868 - 105,193,080 UniSTS RGSC3.4 Celera 3 104,588,569 - 104,588,781 UniSTS RH 3.4 Map 3 913.5 UniSTS Cytogenetic Map 3 q35 UniSTS
RH131877
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 105,651,864 - 105,652,073 (+) MAPPER mRatBN7.2 Rnor_6.0 3 110,464,920 - 110,465,128 NCBI Rnor6.0 Rnor_5.0 3 117,005,785 - 117,005,993 UniSTS Rnor5.0 RGSC_v3.4 3 105,170,530 - 105,170,738 UniSTS RGSC3.4 Celera 3 104,566,345 - 104,566,553 UniSTS RH 3.4 Map 3 914.79 UniSTS Cytogenetic Map 3 q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
49
113
81
80
49
25
49
6
206
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010471 ⟹ ENSRNOP00000010471
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 105,638,653 - 105,672,975 (+) Ensembl Rnor_6.0 Ensembl 3 110,442,637 - 110,485,702 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089434 ⟹ ENSRNOP00000075254
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 110,466,790 - 110,487,526 (+) Ensembl
RefSeq Acc Id:
NM_001106498 ⟹ NP_001099968
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 126,092,576 - 126,126,894 (+) NCBI mRatBN7.2 3 105,638,653 - 105,672,975 (+) NCBI Rnor_6.0 3 110,442,637 - 110,485,702 (+) NCBI Rnor_5.0 3 116,987,226 - 117,027,426 (+) NCBI RGSC_v3.4 3 105,141,150 - 105,191,676 (+) RGD Celera 3 104,554,473 - 104,587,411 (+) RGD
Sequence:
CCCACTGTCACTGAGTCACCCACCCACCCTGGCTTTTCTTCCTTCCTCCTTTGCATCTGATTATTTGGGGAGCTGAAAACTTGGAGGTGTCCCTGAGGCCCGCCCCTTCTAACTCTCCCCGCCCTACC
hide sequence
RefSeq Acc Id:
XM_039104547 ⟹ XP_038960475
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 126,105,436 - 126,128,320 (+) NCBI mRatBN7.2 3 105,652,018 - 105,674,399 (+) NCBI
RefSeq Acc Id:
NP_001099968 ⟸ NM_001106498
- UniProtKB:
D3ZQ51 (UniProtKB/TrEMBL), A6HPB6 (UniProtKB/TrEMBL)
- Sequence:
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRITRVQLQPMKTVVRGSSVPTEGYISGLLNDIQKLSAISSNTLRGRSPTSRRRAQSLGLLGDDQWAADPDM
hide sequence
Ensembl Acc Id:
ENSRNOP00000075254 ⟸ ENSRNOT00000089434
Ensembl Acc Id:
ENSRNOP00000010471 ⟸ ENSRNOT00000010471
RefSeq Acc Id:
XP_038960475 ⟸ XM_039104547
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-12
Pak6
p21 (RAC1) activated kinase 6
Pak6
p21 protein (Cdc42/Rac)-activated kinase 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-05-27
Pak6
p21 protein (Cdc42/Rac)-activated kinase 6
Pak6
p21 (CDKN1A)-activated kinase 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Pak6
p21 (CDKN1A)-activated kinase 6
Pak6_predicted
p21 (CDKN1A)-activated kinase 6 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Pak6_predicted
p21 (CDKN1A)-activated kinase 6 (predicted)
Symbol and Name status set to approved
70820 APPROVED
