Symbol:
Eif3f
Name:
eukaryotic translation initiation factor 3, subunit F
RGD ID:
1306112
Description:
Predicted to enable deubiquitinase activity; identical protein binding activity; and translation initiation factor binding activity. Predicted to contribute to translation initiation factor activity. Predicted to be involved in IRES-dependent viral translational initiation and translational initiation. Predicted to be part of eukaryotic translation initiation factor 3 complex, eIF3m. Predicted to be active in synapse. Biomarker of type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in autosomal recessive intellectual developmental disorder 67. Orthologous to human EIF3F (eukaryotic translation initiation factor 3 subunit F); PARTICIPATES IN translation initiation pathway; RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; clofibric acid.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Eif3s5; eukaryotic translation initiation factor 3 subunit F; eukaryotic translation initiation factor 3, subunit 5 (epsilon); LOC293427
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EIF3F (eukaryotic translation initiation factor 3 subunit F) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Eif3f (eukaryotic translation initiation factor 3, subunit F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Eif3f (eukaryotic translation initiation factor 3 subunit F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EIF3F (eukaryotic translation initiation factor 3 subunit F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EIF3F (eukaryotic translation initiation factor 3 subunit F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Eif3f (eukaryotic translation initiation factor 3 subunit F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EIF3F (eukaryotic translation initiation factor 3 subunit F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EIF3F (eukaryotic translation initiation factor 3 subunit F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Eif3f (eukaryotic translation initiation factor 3 subunit F) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
EIF3F (eukaryotic translation initiation factor 3 subunit F)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Eif3f (eukaryotic translation initiation factor 3, subunit F)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
eif3f (eukaryotic translation initiation factor 3, subunit F)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
eIF3f1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
eIF3f2
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
eif-3.F
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
eif3f
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 172,369,062 - 172,378,043 (+) NCBI GRCr8 mRatBN7.2 1 162,934,220 - 162,943,204 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 162,934,212 - 162,943,204 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 171,275,990 - 171,284,948 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 178,461,984 - 178,470,941 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 171,134,237 - 171,143,197 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 173,532,826 - 173,541,806 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 173,532,803 - 173,541,847 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 180,523,029 - 180,532,009 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 166,398,519 - 166,407,783 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 166,509,415 - 166,518,431 (-) NCBI Celera 1 160,840,884 - 160,849,844 (+) NCBI Celera Cytogenetic Map 1 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Eif3f Rat (-)-epigallocatechin 3-gallate decreases expression ISO EIF3F (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of EIF3F protein CTD PMID:31195006 Eif3f Rat (1->4)-beta-D-glucan multiple interactions ISO Eif3f (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EIF3F mRNA CTD PMID:36331819 Eif3f Rat 1,2-dimethylhydrazine multiple interactions ISO Eif3f (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EIF3F mRNA CTD PMID:22206623 Eif3f Rat 17alpha-ethynylestradiol affects expression ISO Eif3f (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of EIF3F mRNA CTD PMID:17555576 Eif3f Rat 17alpha-ethynylestradiol multiple interactions ISO Eif3f (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EIF3F mRNA CTD PMID:17942748 Eif3f Rat 17alpha-ethynylestradiol increases expression ISO Eif3f (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of EIF3F mRNA CTD PMID:17942748 Eif3f Rat 17beta-estradiol affects expression ISO EIF3F (Homo sapiens) 6480464 Estradiol affects the expression of EIF3F mRNA CTD PMID:22574217 Eif3f Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Eif3f (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Eif3f Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Eif3f (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EIF3F mRNA CTD PMID:17942748 Eif3f Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EIF3F mRNA CTD PMID:33387578 Eif3f Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of EIF3F mRNA CTD PMID:34747641 Eif3f Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Eif3f (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EIF3F mRNA CTD PMID:21570461 Eif3f Rat 2,6-dimethoxyphenol multiple interactions ISO EIF3F (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization of EIF3F protein CTD PMID:38598786 Eif3f Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Eif3f (Mus musculus) 6480464 3 more ... CTD PMID:37080397 Eif3f Rat 4,4'-sulfonyldiphenol increases expression ISO Eif3f (Mus musculus) 6480464 bisphenol S results in increased expression of EIF3F mRNA CTD PMID:39298647 Eif3f Rat actinomycin D multiple interactions ISO EIF3F (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of EIF3F protein CTD PMID:38460933 Eif3f Rat aflatoxin B1 decreases methylation ISO EIF3F (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of EIF3F gene CTD PMID:27153756 Eif3f Rat all-trans-retinoic acid decreases expression ISO EIF3F (Homo sapiens) 6480464 Tretinoin results in decreased expression of EIF3F mRNA CTD PMID:33167477 Eif3f Rat antirheumatic drug increases expression ISO EIF3F (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of EIF3F mRNA CTD PMID:24449571 Eif3f Rat arsenite(3-) multiple interactions ISO EIF3F (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to EIF3F mRNA] CTD PMID:32406909 Eif3f Rat arsenous acid increases expression ISO EIF3F (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of EIF3F mRNA CTD PMID:20458559 Eif3f Rat benzo[a]pyrene increases expression ISO Eif3f (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of EIF3F mRNA CTD PMID:22228805 Eif3f Rat benzo[a]pyrene increases methylation ISO EIF3F (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of EIF3F promoter CTD PMID:27901495 Eif3f Rat benzo[a]pyrene diol epoxide I increases expression ISO EIF3F (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Eif3f Rat bis(2-ethylhexyl) phthalate increases expression ISO Eif3f (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of EIF3F mRNA CTD PMID:33754040 Eif3f Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of EIF3F mRNA CTD PMID:25181051 Eif3f Rat bisphenol A multiple interactions ISO EIF3F (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of EIF3F gene CTD PMID:31601247 Eif3f Rat bisphenol A increases expression ISO Eif3f (Mus musculus) 6480464 bisphenol A results in increased expression of EIF3F mRNA CTD PMID:32156529 and PMID:33221593 Eif3f Rat bisphenol AF increases expression ISO EIF3F (Homo sapiens) 6480464 bisphenol AF results in increased expression of EIF3F protein CTD PMID:34186270 Eif3f Rat cadmium atom multiple interactions ISO EIF3F (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of EIF3F mRNA CTD PMID:35301059 Eif3f Rat cadmium dichloride affects localization ISO EIF3F (Homo sapiens) 6480464 Cadmium Chloride affects the localization of EIF3F protein CTD PMID:18261755 Eif3f Rat cadmium dichloride multiple interactions ISO EIF3F (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of EIF3F mRNA CTD PMID:35301059 Eif3f Rat cadmium dichloride increases expression ISO EIF3F (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of EIF3F mRNA CTD PMID:26472689 Eif3f Rat caffeine decreases phosphorylation ISO EIF3F (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of EIF3F protein CTD PMID:35688186 Eif3f Rat CGP 52608 multiple interactions ISO EIF3F (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to EIF3F gene] CTD PMID:28238834 Eif3f Rat chloropicrin decreases expression ISO EIF3F (Homo sapiens) 6480464 chloropicrin results in decreased expression of EIF3F mRNA CTD PMID:28476498 Eif3f Rat chloropicrin affects expression ISO EIF3F (Homo sapiens) 6480464 chloropicrin affects the expression of EIF3F mRNA CTD PMID:26352163 Eif3f Rat chlorpyrifos increases expression ISO Eif3f (Mus musculus) 6480464 Chlorpyrifos results in increased expression of EIF3F mRNA CTD PMID:37019170 Eif3f Rat choline multiple interactions ISO Eif3f (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of EIF3F gene CTD PMID:20938992 Eif3f Rat chromium(6+) affects expression ISO Eif3f (Mus musculus) 6480464 chromium hexavalent ion affects the expression of EIF3F mRNA CTD PMID:28472532 Eif3f Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of EIF3F mRNA CTD PMID:17602206 Eif3f Rat clothianidin decreases expression ISO EIF3F (Homo sapiens) 6480464 clothianidin results in decreased expression of EIF3F mRNA CTD PMID:31626844 Eif3f Rat cobalt dichloride increases expression ISO EIF3F (Homo sapiens) 6480464 cobaltous chloride results in increased expression of EIF3F mRNA CTD PMID:19376846 Eif3f Rat copper(II) sulfate decreases expression ISO EIF3F (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of EIF3F mRNA CTD PMID:19549813 Eif3f Rat CU-O LINKAGE decreases expression ISO EIF3F (Homo sapiens) 6480464 cupric oxide results in decreased expression of EIF3F protein CTD PMID:25470785 Eif3f Rat diarsenic trioxide increases expression ISO EIF3F (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of EIF3F mRNA CTD PMID:20458559 Eif3f Rat fenthion decreases expression ISO Eif3f (Mus musculus) 6480464 Fenthion results in decreased expression of EIF3F mRNA CTD PMID:34813904 Eif3f Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of EIF3F mRNA CTD PMID:34044035 Eif3f Rat folic acid multiple interactions ISO Eif3f (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Eif3f Rat FR900359 affects phosphorylation ISO EIF3F (Homo sapiens) 6480464 FR900359 affects the phosphorylation of EIF3F protein CTD PMID:37730182 Eif3f Rat fulvestrant multiple interactions ISO EIF3F (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of EIF3F gene CTD PMID:31601247 Eif3f Rat furfural multiple interactions ISO EIF3F (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Eif3f Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of EIF3F mRNA CTD PMID:22061828 Eif3f Rat glyphosate decreases expression ISO Eif3f (Mus musculus) 6480464 Glyphosate results in decreased expression of EIF3F protein CTD PMID:37208198 Eif3f Rat GSK-J4 increases expression ISO EIF3F (Homo sapiens) 6480464 GSK-J4 results in increased expression of EIF3F mRNA CTD PMID:29301935 Eif3f Rat hydrogen peroxide affects expression ISO EIF3F (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of EIF3F mRNA CTD PMID:22489041 Eif3f Rat ivermectin decreases expression ISO EIF3F (Homo sapiens) 6480464 Ivermectin results in decreased expression of EIF3F protein CTD PMID:32959892 Eif3f Rat L-methionine multiple interactions ISO Eif3f (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of EIF3F gene CTD PMID:20938992 Eif3f Rat mercury atom decreases expression ISO EIF3F (Homo sapiens) 6480464 Mercury results in decreased expression of EIF3F mRNA CTD PMID:16823088 Eif3f Rat mercury(0) decreases expression ISO EIF3F (Homo sapiens) 6480464 Mercury results in decreased expression of EIF3F mRNA CTD PMID:16823088 Eif3f Rat methylmercury chloride decreases expression ISO EIF3F (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of EIF3F mRNA CTD PMID:28001369 Eif3f Rat nitrates multiple interactions ISO Eif3f (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of EIF3F mRNA CTD PMID:35964746 Eif3f Rat Nutlin-3 multiple interactions ISO EIF3F (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of EIF3F protein CTD PMID:38460933 Eif3f Rat okadaic acid decreases expression ISO EIF3F (Homo sapiens) 6480464 Okadaic Acid results in decreased expression of EIF3F mRNA CTD PMID:38832940 Eif3f Rat paracetamol increases expression ISO EIF3F (Homo sapiens) 6480464 Acetaminophen results in increased expression of EIF3F protein CTD PMID:22230336 Eif3f Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Eif3f (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of EIF3F mRNA CTD PMID:36331819 Eif3f Rat potassium chromate increases expression ISO EIF3F (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of EIF3F mRNA CTD PMID:22714537 Eif3f Rat quercetin affects binding ISO EIF3F (Homo sapiens) 6480464 Quercetin analog binds to EIF3F protein CTD PMID:21798748 Eif3f Rat SB 431542 multiple interactions ISO EIF3F (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of EIF3F protein CTD PMID:37664457 Eif3f Rat sodium arsenite increases expression ISO EIF3F (Homo sapiens) 6480464 sodium arsenite results in increased expression of EIF3F protein CTD PMID:28713220 Eif3f Rat sodium arsenite decreases expression ISO EIF3F (Homo sapiens) 6480464 sodium arsenite results in decreased expression of EIF3F protein CTD PMID:30528433 Eif3f Rat sodium arsenite multiple interactions ISO EIF3F (Homo sapiens) 6480464 sodium arsenite promotes the reaction [H3-3A protein binds to EIF3F protein] CTD PMID:37734572 Eif3f Rat sodium chloride multiple interactions ISO EIF3F (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of EIF3F protein CTD PMID:38598786 Eif3f Rat sodium fluoride decreases expression ISO Eif3f (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of EIF3F protein CTD PMID:28918527 Eif3f Rat tamoxifen affects expression ISO Eif3f (Mus musculus) 6480464 Tamoxifen affects the expression of EIF3F mRNA CTD PMID:17555576 Eif3f Rat tetrachloromethane increases expression ISO Eif3f (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of EIF3F mRNA CTD PMID:31919559 Eif3f Rat thimerosal decreases expression ISO EIF3F (Homo sapiens) 6480464 Thimerosal results in decreased expression of EIF3F mRNA CTD PMID:27188386 Eif3f Rat titanium dioxide decreases expression ISO Eif3f (Mus musculus) 6480464 titanium dioxide results in decreased expression of EIF3F mRNA CTD PMID:23557971 Eif3f Rat titanium dioxide decreases methylation ISO Eif3f (Mus musculus) 6480464 titanium dioxide results in decreased methylation of EIF3F enhancer CTD PMID:35295148 Eif3f Rat valproic acid increases expression ISO EIF3F (Homo sapiens) 6480464 Valproic Acid results in increased expression of EIF3F mRNA CTD PMID:26272509
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) chloropicrin (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) clofibric acid (EXP) clothianidin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) CU-O LINKAGE (ISO) diarsenic trioxide (ISO) fenthion (ISO) fipronil (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) gentamycin (EXP) glyphosate (ISO) GSK-J4 (ISO) hydrogen peroxide (ISO) ivermectin (ISO) L-methionine (ISO) mercury atom (ISO) mercury(0) (ISO) methylmercury chloride (ISO) nitrates (ISO) Nutlin-3 (ISO) okadaic acid (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) potassium chromate (ISO) quercetin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) tamoxifen (ISO) tetrachloromethane (ISO) thimerosal (ISO) titanium dioxide (ISO) valproic acid (ISO)
Eif3f Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 172,369,062 - 172,378,043 (+) NCBI GRCr8 mRatBN7.2 1 162,934,220 - 162,943,204 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 162,934,212 - 162,943,204 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 171,275,990 - 171,284,948 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 178,461,984 - 178,470,941 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 171,134,237 - 171,143,197 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 173,532,826 - 173,541,806 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 173,532,803 - 173,541,847 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 180,523,029 - 180,532,009 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 166,398,519 - 166,407,783 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 166,509,415 - 166,518,431 (-) NCBI Celera 1 160,840,884 - 160,849,844 (+) NCBI Celera Cytogenetic Map 1 q33 NCBI
EIF3F Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 7,987,337 - 8,001,852 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 7,970,251 - 8,001,862 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 8,008,884 - 8,023,399 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 7,965,443 - 7,974,294 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 7,965,469 - 7,974,287 NCBI Celera 11 8,124,565 - 8,133,440 (+) NCBI Celera Cytogenetic Map 11 p15.4 NCBI HuRef 11 7,675,616 - 7,684,471 (+) NCBI HuRef CHM1_1 11 8,007,872 - 8,016,713 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 8,066,510 - 8,081,027 (+) NCBI T2T-CHM13v2.0
Eif3f Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 108,533,622 - 108,541,149 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 108,533,624 - 108,542,158 (+) Ensembl GRCm39 Ensembl GRCm38 7 108,934,415 - 108,941,942 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 108,934,417 - 108,942,951 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 116,077,929 - 116,085,456 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 108,725,593 - 108,732,866 (+) NCBI MGSCv36 mm8 Celera 7 108,910,871 - 108,918,398 (+) NCBI Celera Cytogenetic Map 7 E3 NCBI cM Map 7 57.21 NCBI
Eif3f Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 23,804,705 - 23,817,044 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 23,805,406 - 23,812,776 (+) NCBI ChiLan1.0 ChiLan1.0
EIF3F Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 10,411,050 - 10,420,006 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 10,373,219 - 10,382,175 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 8,104,384 - 8,113,624 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 7,834,118 - 7,859,981 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 7,850,728 - 7,859,981 (+) Ensembl panpan1.1 panPan2
EIF3F Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 31,514,930 - 31,525,651 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 31,517,777 - 31,525,644 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 31,087,628 - 31,094,967 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 32,392,321 - 32,399,667 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 32,392,333 - 32,401,352 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 31,662,107 - 31,669,456 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 31,828,280 - 31,835,618 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 32,122,018 - 32,129,374 (+) NCBI UU_Cfam_GSD_1.0
Eif3f Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 53,896,443 - 53,904,135 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936528 9,928,470 - 9,938,219 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936528 9,930,419 - 9,938,102 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EIF3F
EIF3F Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 56,804,635 - 56,814,079 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 56,799,838 - 56,813,650 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 154,531,770 - 154,541,226 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Eif3f
.
Predicted Target Of
Count of predictions: 220 Count of miRNA genes: 154 Interacting mature miRNAs: 172 Transcripts: ENSRNOT00000021017 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1582204 Livw1 Liver weight QTL 1 3.6 0.0003 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 1 155422851 172949803 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8693608 Alc24 Alcohol consumption QTL 24 2.3 0.74 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 150452391 168228760 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 631548 Bp88 Blood pressure QTL 88 5 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 156677124 176484451 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
RH129809
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 162,942,999 - 162,943,179 (+) MAPPER mRatBN7.2 Rnor_6.0 1 173,541,602 - 173,541,781 NCBI Rnor6.0 Rnor_5.0 1 180,531,805 - 180,531,984 UniSTS Rnor5.0 RGSC_v3.4 1 166,398,778 - 166,398,957 UniSTS RGSC3.4 Celera 1 160,849,640 - 160,849,819 UniSTS RH 3.4 Map 1 1353.9 UniSTS Cytogenetic Map 1 q33 UniSTS
AA819489
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 172,377,342 - 172,377,881 (+) Marker Load Pipeline mRatBN7.2 1 162,942,503 - 162,943,042 (+) MAPPER mRatBN7.2 Rnor_6.0 1 173,541,106 - 173,541,644 NCBI Rnor6.0 Rnor_5.0 1 180,531,309 - 180,531,847 UniSTS Rnor5.0 RGSC_v3.4 1 166,398,915 - 166,399,453 UniSTS RGSC3.4 Celera 1 160,849,144 - 160,849,682 UniSTS RH 3.4 Map 1 1353.8 UniSTS Cytogenetic Map 1 q33 UniSTS
BF387687
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 162,943,786 - 162,943,936 (+) MAPPER mRatBN7.2 Rnor_6.0 1 173,542,389 - 173,542,538 NCBI Rnor6.0 Rnor_5.0 1 180,532,592 - 180,532,741 UniSTS Rnor5.0 RGSC_v3.4 1 166,398,021 - 166,398,170 UniSTS RGSC3.4 Celera 1 160,850,427 - 160,850,576 UniSTS RH 3.4 Map 1 1354.1 UniSTS Cytogenetic Map 1 q33 UniSTS
RH135039
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 162,941,938 - 162,942,126 (+) MAPPER mRatBN7.2 Rnor_6.0 1 173,540,541 - 173,540,728 NCBI Rnor6.0 Rnor_5.0 1 180,530,744 - 180,530,931 UniSTS Rnor5.0 RGSC_v3.4 1 166,399,831 - 166,400,018 UniSTS RGSC3.4 Celera 1 160,848,579 - 160,848,766 UniSTS RH 3.4 Map 1 1353.9 UniSTS Cytogenetic Map 1 q33 UniSTS
RH124896
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 162,942,972 - 162,943,097 (+) MAPPER mRatBN7.2 Rnor_6.0 1 173,541,575 - 173,541,699 NCBI Rnor6.0 Rnor_5.0 1 180,531,778 - 180,531,902 UniSTS Rnor5.0 RGSC_v3.4 1 166,398,860 - 166,398,984 UniSTS RGSC3.4 Celera 1 160,849,613 - 160,849,737 UniSTS Cytogenetic Map 1 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021017 ⟹ ENSRNOP00000021017
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 162,934,212 - 162,943,204 (+) Ensembl Rnor_6.0 Ensembl 1 173,532,803 - 173,541,847 (+) Ensembl
RefSeq Acc Id:
NM_001277302 ⟹ NP_001264231
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 172,369,062 - 172,378,043 (+) NCBI mRatBN7.2 1 162,934,220 - 162,943,204 (+) NCBI Rnor_6.0 1 173,532,826 - 173,541,806 (+) NCBI Rnor_5.0 1 180,523,029 - 180,532,009 (+) NCBI Celera 1 160,840,884 - 160,849,844 (+) NCBI
Sequence:
CTAGCCTCTCTCTTTCTCGGCAAGATGGCATCCCCAGCCGTACCGGCTAGTGTCCCTCCCGCCACTGCAGCCGCAGCCCCGGCGCCGGCCGTCACCTCAGCCCCGGCTTCAGCCCCGACCCCACCCAC
hide sequence
RefSeq Acc Id:
NP_001264231 ⟸ NM_001277302
- UniProtKB:
D4AC36 (UniProtKB/TrEMBL)
- Sequence:
MASPAVPASVPPATAAAAPAPAVTSAPASAPTPPTPAPAQAATPAAAPAPVSSDPAVATPAAPGQTSTSTPAPAQTPAPSQPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTV
hide sequence
Ensembl Acc Id:
ENSRNOP00000021017 ⟸ ENSRNOT00000021017
RGD ID: 13690299 Promoter ID: EPDNEW_R824 Type: multiple initiation site Name: Eif3f_1 Description: eukaryotic translation initiation factor 3, subunit F SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 173,532,837 - 173,532,897 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Eif3f
eukaryotic translation initiation factor 3, subunit F
Eif3s5_predicted
eukaryotic translation initiation factor 3, subunit 5 (epsilon) (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Eif3s5_predicted
eukaryotic translation initiation factor 3, subunit 5 (epsilon) (predicted)
Symbol and Name status set to approved
70820 APPROVED
