Advanced Search (OLGA)

Gene: Dpep2 (dipeptidase 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dpep2

Name:

dipeptidase 2

RGD ID:

1305746

Description:

Predicted to enable dipeptidase activity. Predicted to be involved in leukotriene D4 catabolic process. Predicted to be located in membrane. Orthologous to human DPEP2 (dipeptidase 2); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC291984

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DPEP2 (dipeptidase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Dpep2 (dipeptidase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DPEP2 (dipeptidase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC489748 (dipeptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DPEP2 (dipeptidase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DPEP2 (dipeptidase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DPEP3 (dipeptidase 3)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	DPEP2 (dipeptidase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Dpep2 (dipeptidase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dpep2 (dipeptidase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6154	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG42750	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG44837	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG5282	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	dpep2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,795,322 - 50,806,320 (-)	NCBI		GRCr8
mRatBN7.2	19	33,883,557 - 33,896,487 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,885,478 - 33,891,954 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	40,701,008 - 40,707,443 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	41,354,322 - 41,360,757 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	43,653,038 - 43,659,469 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,964,098 - 37,975,154 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,964,105 - 37,970,537 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,831,084 - 48,851,920 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,832,224 - 35,838,659 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,837,105 - 35,843,540 (-)	NCBI
Celera	19	33,313,021 - 33,319,456 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dpep2	Rat	autosomal dominant dyskeratosis congenita 6		ISO	DPEP2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita and autosomal dominant 6	ClinVar	PMID:28492532
Dpep2	Rat	Chromosome 16q12 Duplication Syndrome		ISO	DPEP2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 16q12 duplication syndrome	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dpep2	Rat	17beta-estradiol	increases expression	ISO	DPEP2 (Homo sapiens)	6480464	Estradiol results in increased expression of DPEP2 mRNA	CTD	PMID:19619570
Dpep2	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DPEP2 mRNA	CTD	PMID:32741896
Dpep2	Rat	17beta-estradiol	multiple interactions	ISO	DPEP2 (Homo sapiens)	6480464	[Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of DPEP2 mRNA	CTD	PMID:19619570
Dpep2	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DPEP2 mRNA	CTD	PMID:32741896
Dpep2	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	DPEP2 (Homo sapiens)	6480464	[Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of DPEP2 mRNA	CTD	PMID:19619570
Dpep2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Dpep2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of DPEP2 mRNA	CTD	PMID:26377647
Dpep2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	DPEP2 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of DPEP2 mRNA	CTD	PMID:19619570
Dpep2	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Dpep2 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Dpep2	Rat	3,3',4,4',5-pentachlorobiphenyl	increases expression	EXP		6480464	3 more ...	CTD	PMID:23196670
Dpep2	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Dpep2 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of DPEP2 mRNA	CTD	PMID:26251327
Dpep2	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	DPEP2 (Homo sapiens)	6480464	[bisphenol S co-treated with Fulvestrant] results in decreased methylation of DPEP2 gene	CTD	PMID:31601247
Dpep2	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of DPEP2 mRNA	CTD	PMID:31881176
Dpep2	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of DPEP2 mRNA	CTD	PMID:28959563
Dpep2	Rat	aldehydo-D-glucose	increases expression	ISO	Dpep2 (Mus musculus)	6480464	Glucose results in increased expression of DPEP2 mRNA	CTD	PMID:31525975
Dpep2	Rat	amphetamine	increases expression	EXP		6480464	Amphetamine results in increased expression of DPEP2 mRNA	CTD	PMID:30779732
Dpep2	Rat	Azoxymethane	multiple interactions	ISO	Dpep2 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DPEP2 mRNA	CTD	PMID:29950665
Dpep2	Rat	benzo[a]pyrene	increases expression	ISO	Dpep2 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of DPEP2 mRNA	CTD	PMID:22228805
Dpep2	Rat	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of DPEP2 mRNA	CTD	PMID:30085273
Dpep2	Rat	benzo[a]pyrene	affects methylation	ISO	DPEP2 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of DPEP2 promoter	CTD	PMID:27901495
Dpep2	Rat	benzo[b]fluoranthene	increases expression	ISO	Dpep2 (Mus musculus)	6480464	benzo(b)fluoranthene results in increased expression of DPEP2 mRNA	CTD	PMID:26377693
Dpep2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of DPEP2 mRNA	CTD	PMID:25181051 and PMID:34947998
Dpep2	Rat	bisphenol A	multiple interactions	ISO	Dpep2 (Mus musculus)	6480464	[Dextran Sulfate co-treated with bisphenol A] results in decreased expression of DPEP2 protein	CTD	PMID:35999755
Dpep2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with tributyltin] results in decreased expression of DPEP2 mRNA	CTD	PMID:31129395
Dpep2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DPEP2 mRNA	CTD	PMID:30816183 and PMID:32528016
Dpep2	Rat	cadmium atom	multiple interactions	ISO	Dpep2 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DPEP2 mRNA	CTD	PMID:37325564
Dpep2	Rat	cadmium dichloride	multiple interactions	ISO	Dpep2 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DPEP2 mRNA	CTD	PMID:37325564
Dpep2	Rat	carbon nanotube	increases expression	ISO	Dpep2 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Dpep2	Rat	CGP 52608	multiple interactions	ISO	DPEP2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to DPEP2 gene]	CTD	PMID:28238834
Dpep2	Rat	D-glucose	increases expression	ISO	Dpep2 (Mus musculus)	6480464	Glucose results in increased expression of DPEP2 mRNA	CTD	PMID:31525975
Dpep2	Rat	dextran sulfate	multiple interactions	ISO	Dpep2 (Mus musculus)	6480464	[Dextran Sulfate co-treated with bisphenol A] results in decreased expression of DPEP2 protein and [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DPEP2 mRNA	CTD	PMID:29950665 and PMID:35999755
Dpep2	Rat	Dibutyl phosphate	affects expression	ISO	DPEP2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of DPEP2 mRNA	CTD	PMID:37042841
Dpep2	Rat	diuron	decreases expression	ISO	DPEP2 (Homo sapiens)	6480464	Diuron results in decreased expression of DPEP2 mRNA	CTD	PMID:35967413
Dpep2	Rat	fulvestrant	multiple interactions	ISO	DPEP2 (Homo sapiens)	6480464	[bisphenol S co-treated with Fulvestrant] results in decreased methylation of DPEP2 gene	CTD	PMID:31601247
Dpep2	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of DPEP2 mRNA	CTD	PMID:22061828 and PMID:33387578
Dpep2	Rat	glucose	increases expression	ISO	Dpep2 (Mus musculus)	6480464	Glucose results in increased expression of DPEP2 mRNA	CTD	PMID:31525975
Dpep2	Rat	GSK-J4	decreases expression	ISO	DPEP2 (Homo sapiens)	6480464	GSK-J4 results in decreased expression of DPEP2 mRNA	CTD	PMID:29301935
Dpep2	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of DPEP2 mRNA	CTD	PMID:35283115
Dpep2	Rat	manganese(II) chloride	increases expression	EXP		6480464	manganese chloride results in increased expression of DPEP2 mRNA	CTD	PMID:28801915
Dpep2	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	Dpep2 (Mus musculus)	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of DPEP2 mRNA	CTD	PMID:22401849
Dpep2	Rat	N-methyl-4-phenylpyridinium	increases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased expression of DPEP2 mRNA	CTD	PMID:28801915
Dpep2	Rat	nickel atom	increases expression	ISO	DPEP2 (Homo sapiens)	6480464	Nickel results in increased expression of DPEP2 mRNA	CTD	PMID:25583101
Dpep2	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of DPEP2 mRNA	CTD	PMID:25729387
Dpep2	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of DPEP2 mRNA	CTD	PMID:25729387
Dpep2	Rat	ozone	multiple interactions	ISO	DPEP2 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of DPEP2 mRNA	CTD	PMID:35430440
Dpep2	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of DPEP2 mRNA	CTD	PMID:33387578
Dpep2	Rat	sodium arsenite	increases expression	ISO	DPEP2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of DPEP2 mRNA	CTD	PMID:38568856
Dpep2	Rat	sodium arsenite	decreases expression	ISO	Dpep2 (Mus musculus)	6480464	sodium arsenite results in decreased expression of DPEP2 mRNA	CTD	PMID:37682722
Dpep2	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DPEP2 mRNA	CTD	PMID:32741896
Dpep2	Rat	thiram	increases expression	ISO	DPEP2 (Homo sapiens)	6480464	Thiram results in increased expression of DPEP2 mRNA	CTD	PMID:38568856
Dpep2	Rat	titanium dioxide	multiple interactions	ISO	Dpep2 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DPEP2 mRNA	CTD	PMID:29950665
Dpep2	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of DPEP2 mRNA	CTD	PMID:25729387
Dpep2	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of DPEP2 mRNA	CTD	PMID:25729387
Dpep2	Rat	tributylstannane	multiple interactions	EXP		6480464	[bisphenol A co-treated with tributyltin] results in decreased expression of DPEP2 mRNA	CTD	PMID:31129395
Dpep2	Rat	triphenyl phosphate	affects expression	ISO	DPEP2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of DPEP2 mRNA	CTD	PMID:37042841
Dpep2	Rat	triptonide	increases expression	ISO	Dpep2 (Mus musculus)	6480464	triptonide results in increased expression of DPEP2 mRNA	CTD	PMID:33045310
Dpep2	Rat	urethane	increases expression	ISO	DPEP2 (Homo sapiens)	6480464	Urethane results in increased expression of DPEP2 mRNA	CTD	PMID:28818685

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dpep2	Rat	leukotriene D4 catabolic process	involved_in	ISS	UniProtKB:Q9H4A9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dpep2	Rat	leukotriene D4 catabolic process	involved_in	IEA	UniProtKB:Q9H4A9 and ensembl:ENSP00000377430	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dpep2	Rat	leukotriene D4 catabolic process	involved_in	ISO	DPEP2 (Homo sapiens)	1624291	PMID:32325220	RGD	PMID:32325220
Dpep2	Rat	leukotriene metabolic process	involved_in	ISS	UniProtKB:Q8C255	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dpep2	Rat	leukotriene metabolic process	involved_in	ISO	Dpep2 (Mus musculus)	1624291	PMID:12738806	RGD	PMID:12738806
Dpep2	Rat	lipid metabolic process	involved_in	IEA	UniProtKB-KW:KW-0443	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dpep2	Rat	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dpep2	Rat	proteolysis	involved_in	IEA	InterPro:IPR000180 and InterPro:IPR008257	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dpep2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dpep2	Rat	membrane	located_in	IEA	UniRule:UR000100391	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Dpep2	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dpep2	Rat	membrane	located_in	ISO	Dpep2 (Mus musculus)	1624291	PMID:12738806	RGD	PMID:12738806
Dpep2	Rat	membrane	located_in	ISS	UniProtKB:Q8C255	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dpep2	Rat	side of membrane	located_in	IEA	UniProtKB-KW:KW-0336	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dpep2	Rat	dipeptidase activity	enables	ISO	Dpep2 (Mus musculus)	1624291	PMID:12738806	RGD	PMID:12738806
Dpep2	Rat	dipeptidase activity	enables	IEA	EC:3.4.13.19	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Dpep2	Rat	dipeptidase activity	enables	IEA	UniProtKB:Q9H4A9 and ensembl:ENSP00000377430	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dpep2	Rat	dipeptidase activity	enables	IEA	ARBA:ARBA00026909	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Dpep2	Rat	dipeptidase activity	enables	IEA	UniProtKB-KW:KW-0224	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dpep2	Rat	dipeptidase activity	enables	ISO	DPEP2 (Homo sapiens)	1624291	PMID:32325220	RGD	PMID:32325220
Dpep2	Rat	dipeptidase activity	enables	ISS	UniProtKB:Q9H4A9	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dpep2	Rat	dipeptidase activity	enables	ISS	UniProtKB:Q8C255	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Dpep2	Rat	exopeptidase activity	enables	ISO	Dpep2 (Mus musculus)	1624291	PMID:12738806	RGD	PMID:12738806
Dpep2	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dpep2	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dpep2	Rat	metal ion binding	enables	IEA	UniRule:UR000100391	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Dpep2	Rat	metallodipeptidase activity	enables	IEA	InterPro:IPR000180 and InterPro:IPR008257	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Dpep2	Rat	metallopeptidase activity	enables	IEA	UniProtKB-KW:KW-0482	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dpep2	Rat	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:12738806	PMID:15489334

Dpep2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,795,322 - 50,806,320 (-)	NCBI		GRCr8
mRatBN7.2	19	33,883,557 - 33,896,487 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,885,478 - 33,891,954 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	40,701,008 - 40,707,443 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	41,354,322 - 41,360,757 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	43,653,038 - 43,659,469 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,964,098 - 37,975,154 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,964,105 - 37,970,537 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,831,084 - 48,851,920 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,832,224 - 35,838,659 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,837,105 - 35,843,540 (-)	NCBI
Celera	19	33,313,021 - 33,319,456 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

DPEP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	67,987,390 - 68,000,619 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	67,987,394 - 68,000,586 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	68,021,293 - 68,034,522 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	66,578,798 - 66,590,857 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	66,578,800 - 66,590,857	NCBI
Celera	16	52,529,750 - 52,541,821 (-)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	53,894,885 - 53,907,048 (-)	NCBI		HuRef
CHM1_1	16	69,429,363 - 69,441,488 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	73,783,178 - 73,796,408 (-)	NCBI		T2T-CHM13v2.0

Dpep2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	106,711,577 - 106,732,658 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	106,711,577 - 106,723,055 (-)	Ensembl		GRCm39 Ensembl
GRCm39 Ensembl	8	106,711,576 - 106,718,391 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	105,984,945 - 106,006,026 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	105,984,944 - 105,991,759 (-)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	8	105,984,945 - 105,996,423 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	108,508,957 - 108,520,323 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	108,874,186 - 108,885,552 (-)	NCBI		MGSCv36	mm8
Celera	8	110,213,109 - 110,224,474 (-)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.07	NCBI

DPEP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	77,510,359 - 77,526,862 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	83,421,784 - 83,438,196 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	48,328,281 - 48,341,510 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	67,715,805 - 67,729,164 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	67,715,805 - 67,729,164 (-)	Ensembl	panpan1.1		panPan2

LOC489748
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	81,517,919 - 81,522,098 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	81,518,072 - 81,522,075 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	81,508,182 - 81,512,060 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	81,953,364 - 81,957,393 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	81,953,204 - 81,957,389 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	81,779,586 - 81,783,615 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	81,461,884 - 81,465,762 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	82,104,060 - 82,107,938 (+)	NCBI		UU_Cfam_GSD_1.0

DPEP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	28,593,546 - 28,599,051 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	28,593,542 - 28,599,076 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	26,020,128 - 26,025,817 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DPEP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	59,439,237 - 59,447,400 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	59,440,951 - 59,447,698 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	22,172,991 - 22,187,738 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Dpep2
68 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	35
Interacting mature miRNAs:	36
Transcripts:	ENSRNOT00000034722
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	27530207	37947399	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	27530207	37947399	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	27530207	37947399	Rat

RH141644

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	33,885,597 - 33,885,778 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,964,222 - 37,964,402	NCBI	Rnor6.0
Rnor_5.0	19	48,831,208 - 48,831,388	UniSTS	Rnor5.0
RGSC_v3.4	19	35,832,344 - 35,832,524	UniSTS	RGSC3.4
Celera	19	33,313,141 - 33,313,321	UniSTS
RH 3.4 Map	19	317.7	UniSTS
Cytogenetic Map	19	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	112	91	90	59	25	59	6	218	97	92	45	60	31


RefSeq Transcripts	NM_001011928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000034722 ⟹ ENSRNOP00000031955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,885,478 - 33,891,954 (-)	Ensembl
Rnor_6.0 Ensembl	19	37,964,105 - 37,970,537 (-)	Ensembl

RefSeq Acc Id:

NM_001011928 ⟹ NP_001011928

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,795,322 - 50,801,757 (-)	NCBI
mRatBN7.2	19	33,885,478 - 33,891,913 (-)	NCBI
Rnor_6.0	19	37,964,102 - 37,970,537 (-)	NCBI
Rnor_5.0	19	48,831,084 - 48,851,920 (-)	NCBI
RGSC_v3.4	19	35,832,224 - 35,838,659 (-)	RGD
Celera	19	33,313,021 - 33,319,456 (-)	RGD

Sequence:

show sequence

GTGCCTGGTCTGAGGAACTCATACATCTGACCCAGCTTCCACAGTAAGGTTTTCGCGACCCTCATCCGTGCCGGTTTGCTCTGCACTGAGCAAGATGTCACTCAAGGGCCTCGAGGGTCATTGGGTGC
TTAGCCAAGTGTTCCTGTTGGTGGTGGTGCTGCTGCTGTTAGGGCCCTCAGAACCTCTAATAAGGGCCCAGACAAAACCAGGCATCGCTGATGCTTCCACTGCACCAAGCCCCCTCAGAACACTCACC
AAGCCTGCCATCTTCAGCATTCCAACCACTCCTGGCAACCCCAATTTCCCAGACCTGCGAGATCGCACCAGAGCCCTGATGCAGGACTTCCCGCTTATAGATGGCCACAATGACCTGCCTCTTGTTCT
GAGGCAATTTTACCAGAATGGACTACAAGATACTAACCTGAGAAACTTCACCCATGGCCAGACCAGCCTGAATAGGCTTAAAGATGGCTTTGTGGGAGCCCAGTTCTGGTCTGCTTACGTGCCGTGCC
AGACCCAGGACCGGGATGCCCTGCGTCTCACACTGGAGCAGATCGACCTCATTCGCCGTATGTGTGCCTCTTATTCTGAGCTGGAACTTGTGACCTCAGTTCAAGCTCTGAACAGCACCCAGAAATTG
GCCTGCCTCATTGGTGTGGAGGGTGGCCATTCACTAGACAATAGCCTCGCTGTGCTTCGAAGTTTCTACCTGCTGGGGGTGCGTTACCTGACACTCACACACACCTGCAACACACCCTGGGCAGAGAG
CTCATCTAAGGACGTCCACTCATTCTACAGCAGTGTCAAAGGACTGACCAGCTTTGGTGAGAAGGTGGTGGCAGAAATGAATCGCTTAGGGATGATGATTGATTTGTCCCATGTCTCAGACGCTACAG
CCCGGCAGGCTTTGGAAGTATCACAAGCACCTGTGATCTTTTCCCACTCGGCTGCCAGAGCCGTGTGCCCAAATGCTCGGAATCTCCCTGATGATATCCTGCAGCTCCTGAAGAAGAATGGTGGCATC
GTGATGGTGACCTTTGCTGTAGGAGTGTTACCCTGCAACCCATTAGCCAATGTATCCACTGTGGCAGATCACTTTGATCACATCAGGACAGTCATTGGATCCGAGTTCATCGGAGTTGGTGGAGATTA
TGACGGTACCAAGCAGTTCCCTCAGGGGCTGGAGGATGTGTCTACATACCCAGTGCTCATAGAGGAGTTGCTGAGACGAGGCTGGGGTGAACAAGAGCTTCAAGGTGTCCTTCGAGGGAACCTGCTTC
GGGTCTTCAGACAGGTGGAACAGGTACGAGAGAAAAACAAATGGCAGAGTCCCCTGGAAGACATGATTCCAGAGGAGCAGCTGGACAGTGCTTGTCACTCAGTCTTACCTCATCGGAGACAGTATCCA
GAAAAGGACCCACCAGAGACTCCAGACTCTCATACACACAAGTTATCACCCAAGATGCCGTACTCAAAATCCTCTCCCCTCAGAGCCTCAAGCCTTACCATTATGGCCACCTTTTTAGGCCTTCTCAT
ATGACTTTTAGAGGACACCCAGTCCTCTCAGATATCATTCCGGCACCCCAAGAGCCCCTCCACTTTATTTCCTGCAAGTAAATGCTTTGGGTGTAGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_008772487 ⟹ XP_008770709

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,795,322 - 50,806,320 (-)	NCBI
mRatBN7.2	19	33,883,557 - 33,896,487 (-)	NCBI
Rnor_6.0	19	37,964,098 - 37,975,154 (-)	NCBI

Sequence:

show sequence

CGCCCGTGCCTCCCACAGCTCCTTCTTCCCCCGGATACTACCACGTCCTCTACAAAGGGCACGCACAAGCCCAGATGGCCTGGCATGGAGAGACATACTGTCTGATTGGAGGCTACCGTGTCTATGGG
GATGCACCGCTTCCCACACCTGTGAAGGTTGAGGAAGAGAAGCCAGCGCCCAGGAGGGCTCCCAAGAGACAGCGAGTTCAGGAAGAGTCAGATCAAGATCTAGGGTGTCCCAGTGCAAAAATTCCTCG
TCTTAAACTGAAGCATGGTGGCAAAGGGTTTTCGCGACCCTCATCCGTGCCGGTTTGCTCTGCACTGAGCAAGATGTCACTCAAGGGCCTCGAGGGTCATTGGGTGCTTAGCCAAGTGTTCCTGTTGG
TGGTGGTGCTGCTGCTGTTAGGGCCCTCAGAACCTCTAATAAGGGCCCAGACAAAACCAGGCATCGCTGATGCTTCCACTGCACCAAGCCCCCTCAGAACACTCACCAAGCCTGCCATCTTCAGCATT
CCAACCACTCCTGGCAACCCCAATTTCCCAGACCTGCGAGATCGCACCAGAGCCCTGATGCAGGACTTCCCGCTTATAGATGGCCACAATGACCTGCCTCTTGTTCTGAGGCAATTTTACCAGAATGG
ACTACAAGATACTAACCTGAGAAACTTCACCCATGGCCAGACCAGCCTGAATAGGCTTAAAGATGGCTTTGTGGGAGCCCAGTTCTGGTCTGCTTACGTGCCGTGCCAGACCCAGGACCGGGATGCCC
TGCGTCTCACACTGGAGCAGATCGACCTCATTCGCCGTATGTGTGCCTCTTATTCTGAGCTGGAACTTGTGACCTCAGTTCAAGCTCTGAACAGCACCCAGAAATTGGCCTGCCTCATTGGTGTGGAG
GGTGGCCATTCACTAGACAATAGCCTCGCTGTGCTTCGAAGTTTCTACCTGCTGGGGGTGCGTTACCTGACACTCACACACACCTGCAACACACCCTGGGCAGAGAGCTCATCTAAGGACGTCCACTC
ATTCTACAGCAGTGTCAAAGGACTGACCAGCTTTGGTGAGAAGGTGGTGGCAGAAATGAATCGCTTAGGGATGATGATTGATTTGTCCCATGTCTCAGACGCTACAGCCCGGCAGGCTTTGGAAGTAT
CACAAGCACCTGTGATCTTTTCCCACTCGGCTGCCAGAGCCGTGTGCCCAAATGCTCGGAATCTCCCTGATGATATCCTGCAGCTCCTGAAGAAGAATGGTGGCATCGTGATGGTGACCTTTGCTGTA
GGAGTGTTACCCTGCAACCCATTAGCCAATGTATCCACTGTGGCAGATCACTTTGATCACATCAGGACAGTCATTGGATCCGAGTTCATCGGAGTTGGTGGAGATTATGACGGTACCAAGCAGTTCCC
TCAGGGGCTGGAGGATGTGTCTACATACCCAGTGCTCATAGAGGAGTTGCTGAGACGAGGCTGGGGTGAACAAGAGCTTCAAGGTGTCCTTCGAGGGAACCTGCTTCGGGTCTTCAGACAGGTGGAAC
AGGTACGAGAGAAAAACAAATGGCAGAGTCCCCTGGAAGACATGATTCCAGAGGAGCAGCTGGACAGTGCTTGTCACTCAGTCTTACCTCATCGGAGACAGTATCCAGAAAAGGACCCACCAGAGACT
CCAGACTCTCATACACACAAGTTATCACCCAAGATGCCGTACTCAAAATCCTCTCCCCTCAGAGCCTCAAGCCTTACCATTATGGCCACCTTTTTAGGCCTTCTCATATGACTTTTAGAGGACACCCA
GTCCTCTCAGATATCATTCCGGCACCCCAAGAGCCCCTCCACTTTATTTCCTGCAAGTAAATGCTTTGGGTGTAGAAACAGA

hide sequence

RefSeq Acc Id:

XM_039097628 ⟹ XP_038953556

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,795,322 - 50,801,853 (-)	NCBI
mRatBN7.2	19	33,885,474 - 33,892,008 (-)	NCBI

RefSeq Acc Id:

XR_005496638

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,795,514 - 50,801,868 (-)	NCBI
mRatBN7.2	19	33,885,482 - 33,892,021 (-)	NCBI

RefSeq Acc Id:

XR_005496639

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,796,606 - 50,801,868 (-)	NCBI
mRatBN7.2	19	33,886,757 - 33,892,021 (-)	NCBI


Protein RefSeqs	NP_001011928	(Get FASTA)	NCBI Sequence Viewer
	XP_008770709	(Get FASTA)	NCBI Sequence Viewer
	XP_038953556	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88195	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000031955
GenBank Protein	Q5M872	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001011928 ⟸ NM_001011928
- Peptide Label:	precursor
- UniProtKB:	Q5M872 (UniProtKB/Swiss-Prot), A0A8L2QGJ8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSLKGLEGHWVLSQVFLLVVVLLLLGPSEPLIRAQTKPGIADASTAPSPLRTLTKPAIFSIPTTPGNPNFPDLRDRTRALMQDFPLIDGHNDLPLVLRQFYQNGLQDTNLRNFTHGQTSLNRLKDGFV GAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSVQALNSTQKLACLIGVEGGHSLDNSLAVLRSFYLLGVRYLTLTHTCNTPWAESSSKDVHSFYSSVKGLTSFGEKVVAEMNRLGM MIDLSHVSDATARQALEVSQAPVIFSHSAARAVCPNARNLPDDILQLLKKNGGIVMVTFAVGVLPCNPLANVSTVADHFDHIRTVIGSEFIGVGGDYDGTKQFPQGLEDVSTYPVLIEELLRRGWGEQ ELQGVLRGNLLRVFRQVEQVREKNKWQSPLEDMIPEEQLDSACHSVLPHRRQYPEKDPPETPDSHTHKLSPKMPYSKSSPLRASSLTIMATFLGLLI hide sequence

RefSeq Acc Id:	XP_008770709 ⟸ XM_008772487
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2QGJ8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAWHGETYCLIGGYRVYGDAPLPTPVKVEEEKPAPRRAPKRQRVQEESDQDLGCPSAKIPRLKLKHGGKGFSRPSSVPVCSALSKMSLKGLEGHWVLSQVFLLVVVLLLLGPSEPLIRAQTKPGIADA STAPSPLRTLTKPAIFSIPTTPGNPNFPDLRDRTRALMQDFPLIDGHNDLPLVLRQFYQNGLQDTNLRNFTHGQTSLNRLKDGFVGAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVT SVQALNSTQKLACLIGVEGGHSLDNSLAVLRSFYLLGVRYLTLTHTCNTPWAESSSKDVHSFYSSVKGLTSFGEKVVAEMNRLGMMIDLSHVSDATARQALEVSQAPVIFSHSAARAVCPNARNLPDD ILQLLKKNGGIVMVTFAVGVLPCNPLANVSTVADHFDHIRTVIGSEFIGVGGDYDGTKQFPQGLEDVSTYPVLIEELLRRGWGEQELQGVLRGNLLRVFRQVEQVREKNKWQSPLEDMIPEEQLDSAC HSVLPHRRQYPEKDPPETPDSHTHKLSPKMPYSKSSPLRASSLTIMATFLGLLI hide sequence

Ensembl Acc Id:

ENSRNOP00000031955 ⟸ ENSRNOT00000034722

RefSeq Acc Id:	XP_038953556 ⟸ XM_039097628
- Peptide Label:	isoform X1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M872-F1-model_v2	AlphaFold	Q5M872	1-481	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701098

Promoter ID:

EPDNEW_R11622

Type:

multiple initiation site

Name:

Dpep2_1

Description:

dipeptidase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	37,970,567 - 37,970,627	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-5794	BioCyc
Ensembl Genes	ENSRNOG00000023303	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000034722	ENTREZGENE
Gene3D-CATH	Metal-dependent hydrolases	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7374282	IMAGE-MGC_LOAD
InterPro	Dipep_AS	UniProtKB/Swiss-Prot
	Metal_Hydrolase	UniProtKB/Swiss-Prot
	Pept_M19	UniProtKB/Swiss-Prot
KEGG Report	rno:291984	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108872	IMAGE-MGC_LOAD
NCBI Gene	291984	ENTREZGENE
PANTHER	DIPEPTIDASE 2	UniProtKB/Swiss-Prot
	PTHR10443	UniProtKB/Swiss-Prot
Pfam	Peptidase_M19	UniProtKB/Swiss-Prot
PhenoGen	Dpep2	PhenoGen
PROSITE	RENAL_DIPEPTIDASE_1	UniProtKB/Swiss-Prot
	RENAL_DIPEPTIDASE_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000023303	RatGTEx
Superfamily-SCOP	SSF51556	UniProtKB/Swiss-Prot
UniProt	A0A8L2QGJ8	ENTREZGENE, UniProtKB/TrEMBL
	DPEP2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Dpep2	dipeptidase 2	Dpep2_predicted	dipeptidase 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Dpep2_predicted	dipeptidase 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar