Symbol:
Usp20
Name:
ubiquitin specific peptidase 20
RGD ID:
1305621
Description:
Predicted to enable G protein-coupled receptor binding activity; cysteine-type deubiquitinase activity; and cysteine-type endopeptidase activity. Predicted to be involved in several processes, including antiviral innate immune response; protein deubiquitination; and regulation of signal transduction. Predicted to be located in centrosome. Orthologous to human USP20 (ubiquitin specific peptidase 20); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC311856; ubiquitin carboxyl-terminal hydrolase 20; ubiquitin specific protease 20
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 34,670,613 - 34,704,156 (+) NCBI GRCr8 mRatBN7.2 3 14,272,737 - 14,306,409 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 14,272,908 - 14,306,409 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 17,345,478 - 17,378,966 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 25,930,477 - 25,963,967 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 24,177,762 - 24,211,223 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 9,822,586 - 9,856,057 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 9,822,580 - 9,856,057 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 15,181,259 - 15,214,732 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 10,048,393 - 10,080,966 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 9,943,606 - 9,977,231 (+) NCBI Celera 3 9,031,454 - 9,063,927 (+) NCBI Celera Cytogenetic Map 3 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp20 Rat (1->4)-beta-D-glucan multiple interactions ISO Usp20 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of USP20 mRNA CTD PMID:36331819 Usp20 Rat 1,2-dimethylhydrazine multiple interactions ISO Usp20 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP20 mRNA CTD PMID:22206623 Usp20 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp20 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP20 mRNA CTD PMID:21570461 Usp20 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP20 mRNA CTD PMID:33387578 Usp20 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of USP20 mRNA CTD PMID:21346803 Usp20 Rat 2-hydroxypropanoic acid decreases expression ISO USP20 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of USP20 mRNA CTD PMID:30851411 Usp20 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Usp20 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of USP20 mRNA CTD PMID:20188158 Usp20 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Usp20 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of USP20 mRNA CTD PMID:26251327 Usp20 Rat all-trans-retinoic acid increases expression ISO USP20 (Homo sapiens) 6480464 Tretinoin results in increased expression of USP20 mRNA CTD PMID:23724009 Usp20 Rat aristolochic acid A increases expression ISO USP20 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of USP20 mRNA CTD PMID:33212167 Usp20 Rat arsane affects methylation ISO USP20 (Homo sapiens) 6480464 Arsenic affects the methylation of USP20 gene CTD PMID:25304211 Usp20 Rat arsenic atom affects methylation ISO USP20 (Homo sapiens) 6480464 Arsenic affects the methylation of USP20 gene CTD PMID:25304211 Usp20 Rat benzo[a]pyrene increases expression ISO Usp20 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of USP20 mRNA CTD PMID:22228805 Usp20 Rat benzo[a]pyrene affects methylation ISO USP20 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of USP20 intron CTD PMID:30157460 Usp20 Rat benzo[e]pyrene decreases methylation ISO USP20 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of USP20 intron CTD PMID:30157460 Usp20 Rat bis(2-ethylhexyl) phthalate increases expression ISO Usp20 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of USP20 mRNA CTD PMID:21318169 Usp20 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP20 mRNA CTD PMID:25181051 Usp20 Rat cadmium dichloride increases expression ISO USP20 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of USP20 mRNA CTD PMID:38568856 Usp20 Rat carbon nanotube decreases expression ISO Usp20 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of USP20 mRNA CTD PMID:25554681 Usp20 Rat CGP 52608 multiple interactions ISO USP20 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP20 gene] CTD PMID:28238834 Usp20 Rat coumarin affects phosphorylation ISO USP20 (Homo sapiens) 6480464 coumarin affects the phosphorylation of USP20 protein CTD PMID:35688186 Usp20 Rat Dibutyl phosphate affects expression ISO USP20 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP20 mRNA CTD PMID:37042841 Usp20 Rat ethanol multiple interactions ISO Usp20 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of USP20 mRNA CTD PMID:30319688 Usp20 Rat fenthion decreases expression ISO Usp20 (Mus musculus) 6480464 Fenthion results in decreased expression of USP20 mRNA CTD PMID:34813904 Usp20 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of USP20 mRNA CTD PMID:24136188 Usp20 Rat folic acid multiple interactions ISO Usp20 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP20 mRNA CTD PMID:22206623 Usp20 Rat genistein decreases expression ISO USP20 (Homo sapiens) 6480464 Genistein results in decreased expression of USP20 mRNA CTD PMID:16705744 Usp20 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP20 mRNA CTD PMID:33387578 Usp20 Rat hydrogen cyanide decreases expression ISO Usp20 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of USP20 mRNA CTD PMID:33914522 Usp20 Rat leflunomide decreases expression ISO USP20 (Homo sapiens) 6480464 leflunomide results in decreased expression of USP20 mRNA CTD PMID:28988120 Usp20 Rat methamphetamine increases expression ISO Usp20 (Mus musculus) 6480464 Methamphetamine results in increased expression of USP20 mRNA CTD PMID:26307267 Usp20 Rat methapyrilene decreases methylation ISO USP20 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of USP20 intron CTD PMID:30157460 Usp20 Rat methidathion decreases expression ISO Usp20 (Mus musculus) 6480464 methidathion results in decreased expression of USP20 mRNA CTD PMID:34813904 Usp20 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of USP20 mRNA CTD PMID:33387578 Usp20 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp20 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of USP20 mRNA CTD PMID:36331819 Usp20 Rat phenobarbital multiple interactions ISO Usp20 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of USP20 mRNA] CTD PMID:19482888 Usp20 Rat phenobarbital increases expression ISO Usp20 (Mus musculus) 6480464 Phenobarbital results in increased expression of USP20 mRNA CTD PMID:19482888 Usp20 Rat pirinixic acid multiple interactions ISO Usp20 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of USP20 mRNA] CTD PMID:21318169 Usp20 Rat pirinixic acid increases expression ISO Usp20 (Mus musculus) 6480464 pirinixic acid results in increased expression of USP20 mRNA CTD PMID:18301758 more ... Usp20 Rat potassium chromate increases expression ISO USP20 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of USP20 mRNA CTD PMID:22714537 Usp20 Rat potassium cyanide decreases expression ISO Usp20 (Mus musculus) 6480464 Potassium Cyanide results in decreased expression of USP20 mRNA CTD PMID:33914522 Usp20 Rat rac-lactic acid decreases expression ISO USP20 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of USP20 mRNA CTD PMID:30851411 Usp20 Rat raloxifene decreases expression ISO Usp20 (Mus musculus) 6480464 Raloxifene Hydrochloride results in decreased expression of USP20 mRNA CTD PMID:33269387 Usp20 Rat silicon dioxide decreases expression ISO USP20 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of USP20 mRNA CTD PMID:25895662 Usp20 Rat sodium arsenite increases expression ISO USP20 (Homo sapiens) 6480464 sodium arsenite results in increased expression of USP20 mRNA CTD PMID:38568856 Usp20 Rat tetrachloromethane decreases expression ISO Usp20 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of USP20 mRNA CTD PMID:25270620 Usp20 Rat titanium dioxide decreases methylation ISO Usp20 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP20 gene CTD PMID:35295148 Usp20 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of USP20 mRNA CTD PMID:33387578 Usp20 Rat triptonide increases expression ISO Usp20 (Mus musculus) 6480464 triptonide results in increased expression of USP20 mRNA CTD PMID:33045310 Usp20 Rat urethane increases expression ISO USP20 (Homo sapiens) 6480464 Urethane results in increased expression of USP20 mRNA CTD PMID:28818685
Usp20 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 34,670,613 - 34,704,156 (+) NCBI GRCr8 mRatBN7.2 3 14,272,737 - 14,306,409 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 14,272,908 - 14,306,409 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 17,345,478 - 17,378,966 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 25,930,477 - 25,963,967 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 24,177,762 - 24,211,223 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 9,822,586 - 9,856,057 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 9,822,580 - 9,856,057 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 15,181,259 - 15,214,732 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 10,048,393 - 10,080,966 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 9,943,606 - 9,977,231 (+) NCBI Celera 3 9,031,454 - 9,063,927 (+) NCBI Celera Cytogenetic Map 3 p12 NCBI
USP20 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 129,835,458 - 129,881,828 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 129,834,698 - 129,881,828 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 132,597,737 - 132,644,107 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 131,637,570 - 131,683,928 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 129,677,302 - 129,723,661 NCBI Celera 9 103,248,726 - 103,295,216 (+) NCBI Celera Cytogenetic Map 9 q34.11 NCBI HuRef 9 102,196,523 - 102,243,074 (+) NCBI HuRef CHM1_1 9 132,746,720 - 132,793,117 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 142,040,029 - 142,086,556 (+) NCBI T2T-CHM13v2.0
Usp20 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 30,872,291 - 30,912,667 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 30,872,291 - 30,913,598 (+) Ensembl GRCm39 Ensembl GRCm38 2 30,982,279 - 31,022,655 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 30,982,279 - 31,023,586 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 30,837,799 - 30,878,175 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 30,818,051 - 30,845,595 (+) NCBI MGSCv36 mm8 Celera 2 30,688,074 - 30,728,467 (+) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 21.77 NCBI
Usp20 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955513 42,809 - 70,906 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955513 43,601 - 70,714 (+) NCBI ChiLan1.0 ChiLan1.0
USP20 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 9,467,330 - 9,513,818 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 9,469,674 - 9,516,162 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 100,962,851 - 101,009,326 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 129,620,132 - 129,666,713 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 129,621,642 - 129,666,713 (+) Ensembl panpan1.1 panPan2
USP20 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 53,966,180 - 54,009,312 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 53,966,183 - 54,009,317 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 53,163,042 - 53,206,314 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 54,863,745 - 54,906,951 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 54,863,743 - 54,906,925 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 53,641,038 - 53,684,206 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 53,963,134 - 54,006,310 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 54,056,181 - 54,099,449 (-) NCBI UU_Cfam_GSD_1.0
Usp20 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 197,261,923 - 197,300,812 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 17,044,073 - 17,069,104 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 17,030,397 - 17,069,165 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP20 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 269,995,520 - 270,086,780 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 269,995,532 - 270,037,499 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 303,892,891 - 303,935,534 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP20 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 8,256,835 - 8,301,063 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 8,258,365 - 8,301,020 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666079 7,139,293 - 7,185,490 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp20
.
Predicted Target Of
Count of predictions: 264 Count of miRNA genes: 182 Interacting mature miRNAs: 210 Transcripts: ENSRNOT00000010786 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1558647 Cm46 Cardiac mass QTL 46 5.4 0.0000055 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 1358357 Srcrtb1 Stress Responsive Cort Basal QTL 1 6.36 0.002 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 8658162 27494778 Rat 6893355 Bw101 Body weight QTL 101 0.4 0.38 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 1558654 Bw56 Body weight QTL 56 4.5 0.0000171 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 1298526 Arunc3 Aerobic running capacity QTL 3 2.2 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 8227194 33703538 Rat 8693641 Alc30 Alcohol consumption QTL 30 2 0.739 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 3 10434306 24512004 Rat 1558650 Cm48 Cardiac mass QTL 48 4 0.0001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 3 10778823 30356773 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 1558657 Cm43 Cardiac mass QTL 43 6.6 3e-08 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 70203 Gcr2 Gastric cancer resistance QTL 2 2.6 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 3 8658162 27494778 Rat 6893363 Bw105 Body weight QTL 105 2.6 0.0036 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat
RH135207
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 34,701,368 - 34,702,019 (+) Marker Load Pipeline mRatBN7.2 3 14,303,621 - 14,304,272 (+) MAPPER mRatBN7.2 Rnor_6.0 3 9,853,270 - 9,853,920 NCBI Rnor6.0 Rnor_5.0 3 15,211,945 - 15,212,595 UniSTS Rnor5.0 RGSC_v3.4 3 10,079,079 - 10,079,729 UniSTS RGSC3.4 Celera 3 9,061,225 - 9,061,875 UniSTS RH 3.4 Map 3 47.3 UniSTS Cytogenetic Map 3 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010786 ⟹ ENSRNOP00000010786
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 14,272,938 - 14,306,409 (+) Ensembl Rnor_6.0 Ensembl 3 9,822,580 - 9,856,057 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093562
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 9,852,901 - 9,853,527 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093705
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 9,835,593 - 9,849,949 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 9,852,865 - 9,853,988 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093718 ⟹ ENSRNOP00000076274
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 14,272,908 - 14,300,293 (+) Ensembl Rnor_6.0 Ensembl 3 9,822,648 - 9,839,247 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114450 ⟹ ENSRNOP00000091833
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 14,279,744 - 14,304,487 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114728 ⟹ ENSRNOP00000091528
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 14,272,938 - 14,306,409 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116274 ⟹ ENSRNOP00000097493
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 14,272,974 - 14,304,515 (+) Ensembl
RefSeq Acc Id:
NM_001107827 ⟹ NP_001101297
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,670,685 - 34,704,156 (+) NCBI mRatBN7.2 3 14,272,938 - 14,306,409 (+) NCBI Rnor_6.0 3 9,822,586 - 9,856,057 (+) NCBI Rnor_5.0 3 15,181,259 - 15,214,732 (+) NCBI RGSC_v3.4 3 10,048,393 - 10,080,966 (+) RGD Celera 3 9,031,454 - 9,063,927 (+) NCBI
Sequence:
CACAAGACTATGCGCATCGCCGCGGTGGGCGCGCTTGACTGACAGGCGGCGCGGTTGCGACGGCAGGTGCCTTGTCGGAGGCTTTACTGCCGAGCCCCTTGTCAGCCGGTCACTGTCCACAGAAAATG
hide sequence
RefSeq Acc Id:
XM_006233916 ⟹ XP_006233978
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,676,809 - 34,703,347 (+) NCBI mRatBN7.2 3 14,279,048 - 14,306,409 (+) NCBI Rnor_6.0 3 9,827,961 - 9,856,052 (+) NCBI Rnor_5.0 3 15,181,259 - 15,214,732 (+) NCBI
Sequence:
ATTAATCCGGCTGGCCTGGAATTTGCAATGTAGACCAGGCTGCCGTTGAAGTCACAAAGAATCT
hide sequence
RefSeq Acc Id:
XM_017591848 ⟹ XP_017447337
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,676,811 - 34,703,347 (+) NCBI mRatBN7.2 3 14,279,048 - 14,306,409 (+) NCBI Rnor_6.0 3 9,827,961 - 9,856,052 (+) NCBI
Sequence:
ATTAATCCGGCTGGCCTGGAATTTGCAATGTAGACCAGGCTGCCGTTGAAGTCACAAAGAATCTACCAGCCTCTACTTCCCAAATGCTGGGATTAAAGCATGTGCCGCTATGCCCAGTTTTACACAGT
hide sequence
RefSeq Acc Id:
XM_039105245 ⟹ XP_038961173
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,670,758 - 34,703,347 (+) NCBI mRatBN7.2 3 14,273,358 - 14,306,369 (+) NCBI
RefSeq Acc Id:
XM_039105246 ⟹ XP_038961174
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,670,613 - 34,703,347 (+) NCBI mRatBN7.2 3 14,272,737 - 14,306,369 (+) NCBI
RefSeq Acc Id:
XM_039105247 ⟹ XP_038961175
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,670,614 - 34,703,347 (+) NCBI mRatBN7.2 3 14,272,737 - 14,306,369 (+) NCBI
RefSeq Acc Id:
XM_063283962 ⟹ XP_063140032
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,675,607 - 34,703,347 (+) NCBI
RefSeq Acc Id:
XM_063283963 ⟹ XP_063140033
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 34,670,614 - 34,703,347 (+) NCBI
RefSeq Acc Id:
NP_001101297 ⟸ NM_001107827
- UniProtKB:
D3ZLQ8 (UniProtKB/TrEMBL), A6JU13 (UniProtKB/TrEMBL), A0A8I6AC85 (UniProtKB/TrEMBL)
- Sequence:
MGDARDICPHLDSIGEVTKEDLLLKSKGTCQSCGVAGPNLWACLQVTCPYVGCGESFADHSSIHAQVKRHNLTVNLTTLRVWCYACEREVFLEQRLAVHLPSSSARLSEQDSPPPCHPLKAVPIAVAD
hide sequence
RefSeq Acc Id:
XP_006233978 ⟸ XM_006233916
- Peptide Label:
isoform X1
- UniProtKB:
D3ZLQ8 (UniProtKB/TrEMBL), A6JU13 (UniProtKB/TrEMBL), A0A8I6AC85 (UniProtKB/TrEMBL)
- Sequence:
MGDARDICPHLDSIGEVTKEDLLLKSKGTCQSCGVAGPNLWACLQVTCPYVGCGESFADHSSIH
hide sequence
RefSeq Acc Id:
XP_017447337 ⟸ XM_017591848
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AC85 (UniProtKB/TrEMBL)
- Sequence:
MKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLISEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPMVAAVAALTDARDSDSSDTDERRD
hide sequence
Ensembl Acc Id:
ENSRNOP00000076274 ⟸ ENSRNOT00000093718
Ensembl Acc Id:
ENSRNOP00000010786 ⟸ ENSRNOT00000010786
RefSeq Acc Id:
XP_038961174 ⟸ XM_039105246
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6ARX9 (UniProtKB/TrEMBL), A0A8I6AC85 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961175 ⟸ XM_039105247
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AC85 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038961173 ⟸ XM_039105245
- Peptide Label:
isoform X1
- UniProtKB:
D3ZLQ8 (UniProtKB/TrEMBL), A6JU13 (UniProtKB/TrEMBL), A0A8I6AC85 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000091528 ⟸ ENSRNOT00000114728
Ensembl Acc Id:
ENSRNOP00000091833 ⟸ ENSRNOT00000114450
Ensembl Acc Id:
ENSRNOP00000097493 ⟸ ENSRNOT00000116274
RefSeq Acc Id:
XP_063140033 ⟸ XM_063283963
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AC85 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063140032 ⟸ XM_063283962
- Peptide Label:
isoform X1
- UniProtKB:
A6JU13 (UniProtKB/TrEMBL), D3ZLQ8 (UniProtKB/TrEMBL), A0A8I6AC85 (UniProtKB/TrEMBL)
RGD ID: 13691972 Promoter ID: EPDNEW_R2497 Type: multiple initiation site Name: Usp20_1 Description: ubiquitin specific peptidase 20 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 9,822,622 - 9,822,682 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Usp20
ubiquitin specific peptidase 20
Usp20_predicted
ubiquitin specific protease 20 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Usp20_predicted
ubiquitin specific protease 20 (predicted)
Symbol and Name status set to approved
70820 APPROVED
