Symbol:
Otud4
Name:
OTU deubiquitinase 4
RGD ID:
1305606
Description:
Predicted to enable K63-linked deubiquitinase activity; cysteine-type deubiquitinase activity; and molecular adaptor activity. Predicted to be involved in several processes, including DNA alkylation repair; negative regulation of signal transduction; and protein deubiquitination. Predicted to be located in cytosol. Orthologous to human OTUD4 (OTU deubiquitinase 4); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC307774; OTU domain containing 4; OTU domain-containing protein 4; RGD1305606; similar to mKIAA1046 protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
OTUD4 (OTU deubiquitinase 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Otud4 (OTU domain containing 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Otud4 (OTU deubiquitinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
OTUD4 (OTU deubiquitinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
OTUD4 (OTU deubiquitinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Otud4 (OTU deubiquitinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
OTUD4 (OTU deubiquitinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
OTUD4 (OTU deubiquitinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Otud4 (OTU deubiquitinase 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Otud4 (OTU domain containing 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
OTUD4 (OTU deubiquitinase 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
otud4 (OTU deubiquitinase 4)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
otu
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG3251
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
snca
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
otud4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 45,141,043 - 45,184,136 (-) NCBI GRCr8 mRatBN7.2 19 28,236,713 - 28,279,815 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 28,236,713 - 28,279,815 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 35,097,012 - 35,140,127 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 35,751,086 - 35,794,201 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 37,985,978 - 38,029,120 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 31,895,753 - 31,942,509 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 31,899,087 - 31,942,180 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 42,799,728 - 42,846,155 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 30,124,849 - 30,167,942 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 30,129,291 - 30,172,543 (-) NCBI Celera 19 27,744,764 - 27,787,846 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Otud4 Rat 1,2-dimethylhydrazine multiple interactions ISO Otud4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of OTUD4 mRNA] CTD PMID:22206623 Otud4 Rat 1,2-dimethylhydrazine decreases expression ISO Otud4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of OTUD4 mRNA CTD PMID:22206623 Otud4 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of OTUD4 mRNA CTD PMID:29097150 Otud4 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of OTUD4 mRNA CTD PMID:32145629 Otud4 Rat 17beta-estradiol increases expression ISO OTUD4 (Homo sapiens) 6480464 Estradiol results in increased expression of OTUD4 mRNA CTD PMID:31614463 Otud4 Rat 17beta-estradiol decreases expression ISO Otud4 (Mus musculus) 6480464 Estradiol results in decreased expression of OTUD4 mRNA CTD PMID:39298647 Otud4 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Otud4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Otud4 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Otud4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Otud4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of OTUD4 mRNA CTD PMID:33387578 Otud4 Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression ISO Otud4 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of OTUD4 mRNA CTD PMID:17982090 Otud4 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of OTUD4 mRNA CTD PMID:21346803 Otud4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of OTUD4 mRNA CTD PMID:21346803 Otud4 Rat 4,4'-sulfonyldiphenol increases expression ISO Otud4 (Mus musculus) 6480464 bisphenol S results in increased expression of OTUD4 mRNA CTD PMID:39298647 Otud4 Rat 4,4'-sulfonyldiphenol decreases methylation ISO OTUD4 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of OTUD4 gene CTD PMID:31601247 Otud4 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of OTUD4 mRNA CTD PMID:31881176 Otud4 Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of OTUD4 protein CTD PMID:33236894 Otud4 Rat aflatoxin B1 increases methylation ISO OTUD4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of OTUD4 gene CTD PMID:27153756 Otud4 Rat aristolochic acid A decreases expression ISO OTUD4 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of OTUD4 mRNA CTD PMID:33212167 Otud4 Rat benzo[a]pyrene decreases methylation ISO Otud4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of OTUD4 exon and Benzo(a)pyrene results in decreased methylation of OTUD4 intron CTD PMID:27901495 Otud4 Rat benzo[a]pyrene diol epoxide I decreases expression ISO OTUD4 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Otud4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Otud4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of OTUD4 mRNA CTD PMID:33754040 Otud4 Rat bisphenol A decreases expression ISO Otud4 (Mus musculus) 6480464 bisphenol A results in decreased expression of OTUD4 mRNA CTD PMID:26063408 Otud4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of OTUD4 mRNA CTD PMID:32145629 Otud4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of OTUD4 mRNA CTD PMID:25181051 more ... Otud4 Rat butanal decreases expression ISO OTUD4 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of OTUD4 mRNA CTD PMID:26079696 Otud4 Rat cadmium dichloride decreases expression ISO OTUD4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of OTUD4 mRNA CTD PMID:38568856 Otud4 Rat caffeine affects phosphorylation ISO OTUD4 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of OTUD4 protein CTD PMID:35688186 Otud4 Rat CGP 52608 multiple interactions ISO OTUD4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to OTUD4 gene] CTD PMID:28238834 Otud4 Rat chromium(6+) affects expression ISO Otud4 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of OTUD4 mRNA CTD PMID:28472532 Otud4 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of OTUD4 mRNA CTD PMID:24386269 Otud4 Rat copper(II) sulfate increases expression ISO OTUD4 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of OTUD4 mRNA CTD PMID:19549813 Otud4 Rat CU-O LINKAGE decreases expression ISO OTUD4 (Homo sapiens) 6480464 cupric oxide results in decreased expression of OTUD4 mRNA CTD PMID:22077320 Otud4 Rat dorsomorphin multiple interactions ISO OTUD4 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OTUD4 mRNA CTD PMID:27188386 Otud4 Rat enzyme inhibitor multiple interactions ISO OTUD4 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of OTUD4 protein CTD PMID:23301498 Otud4 Rat folic acid decreases expression ISO OTUD4 (Homo sapiens) 6480464 Folic Acid results in decreased expression of OTUD4 mRNA CTD PMID:21867686 Otud4 Rat folic acid multiple interactions ISO Otud4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of OTUD4 mRNA] CTD PMID:22206623 Otud4 Rat FR900359 affects phosphorylation ISO OTUD4 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of OTUD4 protein CTD PMID:37730182 Otud4 Rat geldanamycin increases expression ISO OTUD4 (Homo sapiens) 6480464 geldanamycin results in increased expression of OTUD4 mRNA CTD PMID:26705709 Otud4 Rat hypochlorous acid increases expression ISO Otud4 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of OTUD4 mRNA CTD PMID:19376150 Otud4 Rat leflunomide increases expression ISO Otud4 (Mus musculus) 6480464 leflunomide results in increased expression of OTUD4 mRNA CTD PMID:19751817 Otud4 Rat paracetamol affects expression ISO Otud4 (Mus musculus) 6480464 Acetaminophen affects the expression of OTUD4 mRNA CTD PMID:17562736 Otud4 Rat paracetamol decreases expression ISO OTUD4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of OTUD4 mRNA CTD PMID:22230336 Otud4 Rat PCB138 multiple interactions ISO Otud4 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Otud4 Rat pentanal decreases expression ISO OTUD4 (Homo sapiens) 6480464 pentanal results in decreased expression of OTUD4 mRNA CTD PMID:26079696 Otud4 Rat phorone affects expression EXP 6480464 phorone affects the expression of OTUD4 mRNA CTD PMID:18198479 Otud4 Rat potassium dichromate decreases expression ISO Otud4 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of OTUD4 mRNA CTD PMID:23608068 Otud4 Rat resveratrol multiple interactions ISO OTUD4 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of OTUD4 mRNA CTD PMID:23557933 Otud4 Rat SB 431542 multiple interactions ISO OTUD4 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OTUD4 mRNA CTD PMID:27188386 Otud4 Rat sodium arsenate increases expression ISO Otud4 (Mus musculus) 6480464 sodium arsenate results in increased expression of OTUD4 mRNA CTD PMID:21795629 Otud4 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of OTUD4 mRNA CTD PMID:25993096 Otud4 Rat succimer multiple interactions ISO Otud4 (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of OTUD4 mRNA CTD PMID:26378955 Otud4 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of OTUD4 mRNA CTD PMID:31150632 Otud4 Rat thimerosal decreases expression ISO OTUD4 (Homo sapiens) 6480464 Thimerosal results in decreased expression of OTUD4 mRNA CTD PMID:27188386 Otud4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of OTUD4 mRNA CTD PMID:23411599 and PMID:34492290 Otud4 Rat titanium dioxide decreases methylation ISO Otud4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of OTUD4 gene and titanium dioxide results in decreased methylation of OTUD4 promoter CTD PMID:35295148 Otud4 Rat torcetrapib increases expression ISO OTUD4 (Homo sapiens) 6480464 torcetrapib results in increased expression of OTUD4 mRNA CTD PMID:23228038 Otud4 Rat trichostatin A decreases expression ISO OTUD4 (Homo sapiens) 6480464 trichostatin A results in decreased expression of OTUD4 mRNA CTD PMID:26272509 Otud4 Rat trichostatin A multiple interactions ISO OTUD4 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of OTUD4 mRNA CTD PMID:27188386 Otud4 Rat triphenyl phosphate affects expression ISO OTUD4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of OTUD4 mRNA CTD PMID:37042841 Otud4 Rat triptonide decreases expression ISO Otud4 (Mus musculus) 6480464 triptonide results in decreased expression of OTUD4 mRNA CTD PMID:33045310 Otud4 Rat troglitazone decreases expression ISO Otud4 (Mus musculus) 6480464 troglitazone results in decreased expression of OTUD4 mRNA CTD PMID:28973697 Otud4 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of OTUD4 mRNA CTD PMID:18042343 Otud4 Rat vorinostat decreases expression ISO OTUD4 (Homo sapiens) 6480464 vorinostat results in decreased expression of OTUD4 mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aconitine (EXP) aflatoxin B1 (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) chromium(6+) (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) CU-O LINKAGE (ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) folic acid (ISO) FR900359 (ISO) geldanamycin (ISO) hypochlorous acid (ISO) leflunomide (ISO) paracetamol (ISO) PCB138 (ISO) pentanal (ISO) phorone (EXP) potassium dichromate (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium dichromate (EXP) succimer (ISO) tetrachloromethane (EXP) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) torcetrapib (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) vinclozolin (EXP) vorinostat (ISO)
Otud4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 45,141,043 - 45,184,136 (-) NCBI GRCr8 mRatBN7.2 19 28,236,713 - 28,279,815 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 28,236,713 - 28,279,815 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 35,097,012 - 35,140,127 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 35,751,086 - 35,794,201 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 37,985,978 - 38,029,120 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 31,895,753 - 31,942,509 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 31,899,087 - 31,942,180 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 42,799,728 - 42,846,155 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 30,124,849 - 30,167,942 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 30,129,291 - 30,172,543 (-) NCBI Celera 19 27,744,764 - 27,787,846 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
OTUD4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 145,133,650 - 145,180,589 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 145,110,838 - 145,180,589 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 146,054,802 - 146,101,741 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 146,274,252 - 146,320,282 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 143,382,143 - 143,428,339 (-) NCBI Celera Cytogenetic Map 4 q31.21 NCBI HuRef 4 141,786,122 - 141,832,147 (-) NCBI HuRef CHM1_1 4 146,031,068 - 146,077,284 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 148,451,040 - 148,497,987 (-) NCBI T2T-CHM13v2.0
Otud4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 80,366,305 - 80,404,384 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 80,366,247 - 80,404,353 (+) Ensembl GRCm39 Ensembl GRCm38 8 79,639,676 - 79,677,755 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 79,639,618 - 79,677,724 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 82,163,575 - 82,201,654 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 82,535,748 - 82,573,827 (+) NCBI MGSCv36 mm8 Celera 8 83,915,553 - 83,953,642 (+) NCBI Celera Cytogenetic Map 8 C1 NCBI cM Map 8 37.74 NCBI
Otud4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 1,062,998 - 1,115,415 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 1,062,998 - 1,108,711 (-) NCBI ChiLan1.0 ChiLan1.0
OTUD4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 143,014,271 - 143,065,786 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 143,379,154 - 143,430,674 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 137,480,809 - 137,527,651 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 149,141,513 - 149,187,333 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 149,135,900 - 149,182,476 (-) Ensembl panpan1.1 panPan2
OTUD4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 43,816,656 - 43,861,813 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 43,818,196 - 43,861,784 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 44,208,727 - 44,253,896 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 44,485,491 - 44,530,755 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 44,488,609 - 44,531,432 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 43,758,510 - 43,803,683 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 43,845,139 - 43,890,348 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 44,109,586 - 44,154,745 (-) NCBI UU_Cfam_GSD_1.0
Otud4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 46,475,249 - 46,513,834 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936535 3,912,606 - 3,951,503 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936535 3,911,904 - 3,950,675 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
OTUD4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 83,240,754 - 83,288,234 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 83,240,759 - 83,288,237 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 88,519,444 - 88,558,932 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
OTUD4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 91,709,184 - 91,756,437 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 91,708,767 - 91,756,793 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 71,349,422 - 71,397,341 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Otud4
.
Predicted Target Of
Count of predictions: 25 Count of miRNA genes: 25 Interacting mature miRNAs: 25 Transcripts: ENSRNOT00000024924 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 61328 Eae8 Experimental allergic encephalomyelitis QTL 8 4 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 19 24816041 33061905 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 1549835 Tcas7 Tongue tumor susceptibility QTL 7 0.001 tongue integrity trait (VT:0010553) squamous cell carcinoma of the head and neck tumor number (CMO:0001876) 19 24817978 39654489 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1354633 Bw28 Body weight QTL 28 6.04 body mass (VT:0001259) body weight (CMO:0000012) 19 27530207 37947399 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 1354607 Gmadr1 Adrenal mass QTL 1 5.83 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 19 27530207 37947399 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 1354600 Salc2 Saline consumption QTL 2 9.91 0.001 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 19 27530207 37947399 Rat
AI449692
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 28,236,821 - 28,237,050 (+) MAPPER mRatBN7.2 Rnor_6.0 19 31,899,196 - 31,899,424 NCBI Rnor6.0 Rnor_5.0 19 42,803,171 - 42,803,399 UniSTS Rnor5.0 RGSC_v3.4 19 30,124,958 - 30,125,186 UniSTS RGSC3.4 Celera 19 27,744,873 - 27,745,101 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024924 ⟹ ENSRNOP00000024924
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 28,236,713 - 28,279,815 (-) Ensembl Rnor_6.0 Ensembl 19 31,899,087 - 31,942,180 (-) Ensembl
RefSeq Acc Id:
NM_001191700 ⟹ NP_001178629
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 45,141,043 - 45,184,136 (-) NCBI mRatBN7.2 19 28,236,713 - 28,279,815 (-) NCBI Rnor_6.0 19 31,899,087 - 31,942,180 (-) NCBI Rnor_5.0 19 42,799,728 - 42,846,155 (-) NCBI Celera 19 27,744,764 - 27,787,846 (-) NCBI
Sequence:
GCGGCCGCGTGCGGATGGCCATGCACTAGGCTGGGCTCCCCTATGCTCCGGGAGAGCGCCGGCCACCGCCTCGGGCCGCCGCCGCCTCTTCCTGCCGCCGCTCGCAGTGTCCGCGTCGGAGCCGGAGC
hide sequence
RefSeq Acc Id:
NP_001178629 ⟸ NM_001191700
- UniProtKB:
F1M7Q7 (UniProtKB/TrEMBL)
- Sequence:
MEAAVGAPDGVDQGGAGPLEDATPMDAYLRKLGLYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIRYLRDNREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFVIYQEPNVSPS
hide sequence
Ensembl Acc Id:
ENSRNOP00000024924 ⟸ ENSRNOT00000024924
RGD ID: 13701051 Promoter ID: EPDNEW_R11574 Type: single initiation site Name: Otud4_1 Description: OTU deubiquitinase 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 31,942,095 - 31,942,155 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-03-13
Otud4
OTU deubiquitinase 4
Otud4
OTU domain containing 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Otud4
OTU domain containing 4
RGD1305606
similar to mKIAA1046 protein
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1305606
similar to mKIAA1046 protein
RGD1305606_predicted
similar to mKIAA1046 protein (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1305606_predicted
similar to mKIAA1046 protein (predicted)
LOC307774_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC307774_predicted
similar to mKIAA1046 protein (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
