Symbol:
Prpf8
Name:
pre-mRNA processing factor 8
RGD ID:
1305467
Description:
Predicted to enable K63-linked polyubiquitin modification-dependent protein binding activity; pre-mRNA intronic binding activity; and snRNA binding activity. Involved in cellular response to lipopolysaccharide and cellular response to tumor necrosis factor. Part of small nuclear ribonucleoprotein complex. Human ortholog(s) of this gene implicated in retinitis pigmentosa and retinitis pigmentosa 13. Orthologous to human PRPF8 (pre-mRNA processing factor 8); PARTICIPATES IN retinitis pigmentosa pathway; spliceosome pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC287530; pre-mRNA-processing-splicing factor 8; PRP8 pre-mRNA processing factor 8 homolog; PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRPF8 (pre-mRNA processing factor 8) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Prpf8 (pre-mRNA processing factor 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prpf8 (pre-mRNA processing factor 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRPF8 (pre-mRNA processing factor 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRPF8 (pre-mRNA processing factor 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prpf8 (pre-mRNA processing factor 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRPF8 (pre-mRNA processing factor 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRPF8 (pre-mRNA processing factor 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prpf8 (pre-mRNA processing factor 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PRPF8 (pre-mRNA processing factor 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prpf8 (pre-mRNA processing factor 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prpf8 (pre-mRNA processing factor 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PRP8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Prp8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
prp-8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prpf8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 60,829,778 - 60,852,887 (+) NCBI GRCr8 mRatBN7.2 10 60,331,494 - 60,354,606 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 60,331,494 - 60,354,606 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 64,978,414 - 65,001,760 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 64,483,841 - 64,507,188 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 59,946,410 - 59,969,757 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 63,635,239 - 63,658,360 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 63,635,219 - 63,658,361 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 64,348,558 - 64,371,667 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 62,786,225 - 62,830,939 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 62,821,711 - 62,844,405 (+) NCBI Celera 10 59,359,820 - 59,382,932 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prpf8 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Prpf8 (Mus musculus) 6480464 o and p'-DDT results in increased expression of PRPF8 mRNA CTD PMID:24096037 Prpf8 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of PRPF8 mRNA CTD PMID:24096037 Prpf8 Rat 1,2-dimethylhydrazine increases expression ISO Prpf8 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PRPF8 mRNA CTD PMID:22206623 Prpf8 Rat 17alpha-ethynylestradiol affects expression ISO Prpf8 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PRPF8 mRNA CTD PMID:17555576 Prpf8 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PRPF8 mRNA CTD PMID:17108234 and PMID:24096037 Prpf8 Rat 17alpha-ethynylestradiol increases expression ISO Prpf8 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PRPF8 mRNA CTD PMID:17942748 and PMID:24096037 Prpf8 Rat 17alpha-ethynylestradiol multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRPF8 mRNA CTD PMID:17942748 Prpf8 Rat 17beta-estradiol decreases expression ISO Prpf8 (Mus musculus) 6480464 Estradiol results in decreased expression of PRPF8 mRNA CTD PMID:39298647 Prpf8 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PRPF8 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Prpf8 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRPF8 mRNA CTD PMID:17942748 Prpf8 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRPF8 mRNA CTD PMID:33387578 Prpf8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prpf8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRPF8 mRNA CTD PMID:21570461 Prpf8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Prpf8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRPF8 mRNA CTD PMID:19770486 Prpf8 Rat 2-methylcholine affects expression ISO PRPF8 (Homo sapiens) 6480464 beta-methylcholine affects the expression of PRPF8 mRNA CTD PMID:21179406 Prpf8 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Prpf8 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Prpf8 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Prpf8 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PRPF8 mRNA CTD PMID:26251327 Prpf8 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PRPF8 mRNA CTD PMID:28628672 Prpf8 Rat 4,4'-sulfonyldiphenol decreases expression ISO Prpf8 (Mus musculus) 6480464 bisphenol S results in decreased expression of PRPF8 mRNA CTD PMID:39298647 Prpf8 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRPF8 mRNA CTD PMID:36041667 Prpf8 Rat all-trans-retinoic acid multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] results in increased expression of PRPF8 mRNA CTD PMID:15894607 Prpf8 Rat all-trans-retinoic acid increases expression ISO PRPF8 (Homo sapiens) 6480464 Tretinoin results in increased expression of PRPF8 mRNA CTD PMID:15894607 Prpf8 Rat arsane affects methylation ISO PRPF8 (Homo sapiens) 6480464 Arsenic affects the methylation of PRPF8 gene CTD PMID:32603190 Prpf8 Rat arsane multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PRPF8 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRPF8 mRNA CTD PMID:39836092 Prpf8 Rat arsenic atom affects methylation ISO PRPF8 (Homo sapiens) 6480464 Arsenic affects the methylation of PRPF8 gene CTD PMID:32603190 Prpf8 Rat arsenic atom multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PRPF8 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRPF8 mRNA CTD PMID:39836092 Prpf8 Rat arsenite(3-) multiple interactions ISO PRPF8 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PRPF8 mRNA] CTD PMID:32406909 Prpf8 Rat arsenous acid multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of PRPF8 mRNA CTD PMID:15894607 Prpf8 Rat benzene increases expression ISO PRPF8 (Homo sapiens) 6480464 Benzene results in increased expression of PRPF8 mRNA CTD PMID:19162166 Prpf8 Rat benzo[a]pyrene affects expression ISO Prpf8 (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of PRPF8 mRNA CTD PMID:22342234 Prpf8 Rat benzo[a]pyrene increases expression ISO Prpf8 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PRPF8 mRNA CTD PMID:22228805 Prpf8 Rat beta-lapachone increases expression ISO PRPF8 (Homo sapiens) 6480464 beta-lapachone results in increased expression of PRPF8 mRNA CTD PMID:38218311 Prpf8 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRPF8 protein CTD PMID:38995844 Prpf8 Rat bis(2-ethylhexyl) phthalate increases expression ISO Prpf8 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PRPF8 mRNA CTD PMID:34319233 Prpf8 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Prpf8 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PRPF8 mRNA CTD PMID:33754040 Prpf8 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRPF8 mRNA CTD PMID:25181051 Prpf8 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRPF8 mRNA CTD PMID:36041667 Prpf8 Rat bisphenol A decreases expression ISO PRPF8 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PRPF8 protein CTD PMID:31675489 Prpf8 Rat bisphenol A increases expression ISO PRPF8 (Homo sapiens) 6480464 bisphenol A results in increased expression of PRPF8 mRNA and bisphenol A results in increased expression of PRPF8 protein CTD PMID:33670352 and PMID:34186270 Prpf8 Rat bisphenol AF increases expression ISO PRPF8 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PRPF8 protein CTD PMID:34186270 Prpf8 Rat Bisphenol B increases expression ISO PRPF8 (Homo sapiens) 6480464 bisphenol B results in increased expression of PRPF8 protein CTD PMID:34186270 Prpf8 Rat bisphenol F multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PRPF8 mRNA CTD PMID:28628672 Prpf8 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PRPF8 mRNA CTD PMID:36041667 Prpf8 Rat Butylbenzyl phthalate multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRPF8 protein CTD PMID:38995844 Prpf8 Rat cadmium dichloride increases expression ISO PRPF8 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PRPF8 mRNA CTD PMID:38382870 Prpf8 Rat chlorpyrifos decreases expression ISO Prpf8 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PRPF8 mRNA CTD PMID:37019170 Prpf8 Rat choline multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PRPF8 gene CTD PMID:20938992 Prpf8 Rat cisplatin decreases expression ISO PRPF8 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PRPF8 mRNA CTD PMID:27594783 Prpf8 Rat crocidolite asbestos increases expression ISO PRPF8 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of PRPF8 mRNA CTD PMID:29523930 Prpf8 Rat dexamethasone multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PRPF8 mRNA CTD PMID:28628672 Prpf8 Rat diarsenic trioxide multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of PRPF8 mRNA CTD PMID:15894607 Prpf8 Rat Dibutyl phosphate affects expression ISO PRPF8 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PRPF8 mRNA CTD PMID:37042841 Prpf8 Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of PRPF8 mRNA CTD PMID:30934153 Prpf8 Rat dibutyl phthalate multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate] affects the expression of PRPF8 protein CTD PMID:38995844 Prpf8 Rat dicrotophos increases expression ISO PRPF8 (Homo sapiens) 6480464 dicrotophos results in increased expression of PRPF8 mRNA CTD PMID:28302478 Prpf8 Rat disodium selenite increases expression ISO PRPF8 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PRPF8 mRNA CTD PMID:18175754 Prpf8 Rat elemental selenium increases expression ISO PRPF8 (Homo sapiens) 6480464 Selenium results in increased expression of PRPF8 mRNA CTD PMID:19244175 Prpf8 Rat ethanol affects splicing ISO Prpf8 (Mus musculus) 6480464 Ethanol affects the splicing of PRPF8 mRNA CTD PMID:30319688 Prpf8 Rat folic acid multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PRPF8 gene CTD PMID:20938992 Prpf8 Rat fumonisin B1 decreases expression ISO Prpf8 (Mus musculus) 6480464 fumonisin B1 results in decreased expression of PRPF8 mRNA CTD PMID:16221962 Prpf8 Rat genistein decreases expression ISO PRPF8 (Homo sapiens) 6480464 Genistein results in decreased expression of PRPF8 mRNA CTD PMID:16705744 Prpf8 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PRPF8 mRNA CTD PMID:22061828 Prpf8 Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of PRPF8 mRNA CTD PMID:26302742 Prpf8 Rat indometacin multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of PRPF8 mRNA CTD PMID:28628672 Prpf8 Rat ivermectin decreases expression ISO PRPF8 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRPF8 protein CTD PMID:32959892 Prpf8 Rat L-methionine multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PRPF8 gene CTD PMID:20938992 Prpf8 Rat manganese atom multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PRPF8 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PRPF8 mRNA CTD PMID:39836092 Prpf8 Rat manganese(0) multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PRPF8 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PRPF8 mRNA CTD PMID:39836092 Prpf8 Rat manganese(II) chloride multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PRPF8 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PRPF8 mRNA CTD PMID:39836092 Prpf8 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PRPF8 mRNA CTD PMID:30467583 Prpf8 Rat miconazole increases expression ISO Prpf8 (Mus musculus) 6480464 Miconazole results in increased expression of PRPF8 mRNA CTD PMID:27462272 Prpf8 Rat N-methyl-4-phenylpyridinium increases expression ISO Prpf8 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PRPF8 protein CTD PMID:26558463 Prpf8 Rat N-nitrosodiethylamine multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of PRPF8 gene CTD PMID:23968726 Prpf8 Rat niclosamide decreases expression ISO PRPF8 (Homo sapiens) 6480464 Niclosamide results in decreased expression of PRPF8 mRNA CTD PMID:36318118 Prpf8 Rat nitrates multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRPF8 mRNA CTD PMID:35964746 Prpf8 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PRPF8 mRNA CTD PMID:33387578 Prpf8 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prpf8 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of PRPF8 mRNA CTD PMID:36331819 Prpf8 Rat phenobarbital increases expression ISO Prpf8 (Mus musculus) 6480464 Phenobarbital results in increased expression of PRPF8 mRNA CTD PMID:31836555 Prpf8 Rat piperonyl butoxide multiple interactions ISO Prpf8 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of PRPF8 gene CTD PMID:23968726 Prpf8 Rat resveratrol decreases expression ISO Prpf8 (Mus musculus) 6480464 resveratrol results in decreased expression of PRPF8 protein CTD PMID:25505154 Prpf8 Rat selenium atom increases expression ISO PRPF8 (Homo sapiens) 6480464 Selenium results in increased expression of PRPF8 mRNA CTD PMID:19244175 Prpf8 Rat sevoflurane increases expression ISO Prpf8 (Mus musculus) 6480464 Sevoflurane results in increased expression of PRPF8 protein CTD PMID:35249202 Prpf8 Rat sodium arsenite decreases expression ISO PRPF8 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRPF8 mRNA CTD PMID:38568856 Prpf8 Rat sodium arsenite increases expression ISO Prpf8 (Mus musculus) 6480464 sodium arsenite results in increased expression of PRPF8 mRNA CTD PMID:36209798 Prpf8 Rat sodium arsenite multiple interactions ISO PRPF8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PRPF8 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PRPF8 mRNA CTD PMID:39836092 Prpf8 Rat tamoxifen affects expression ISO Prpf8 (Mus musculus) 6480464 Tamoxifen affects the expression of PRPF8 mRNA CTD PMID:17555576 Prpf8 Rat temozolomide increases expression ISO PRPF8 (Homo sapiens) 6480464 Temozolomide results in increased expression of PRPF8 mRNA CTD PMID:31758290 Prpf8 Rat thapsigargin increases expression ISO Prpf8 (Mus musculus) 6480464 Thapsigargin results in increased expression of PRPF8 protein CTD PMID:24648495 Prpf8 Rat thiram decreases expression ISO PRPF8 (Homo sapiens) 6480464 Thiram results in decreased expression of PRPF8 mRNA CTD PMID:38568856 Prpf8 Rat titanium dioxide increases methylation ISO Prpf8 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PRPF8 promoter CTD PMID:35295148 Prpf8 Rat tolcapone affects binding EXP 6480464 tolcapone binds to PRPF8 protein CTD PMID:19783845 Prpf8 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PRPF8 mRNA CTD PMID:33387578 Prpf8 Rat trimellitic anhydride increases expression ISO Prpf8 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PRPF8 mRNA CTD PMID:19042947 Prpf8 Rat triphenyl phosphate affects expression ISO PRPF8 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRPF8 mRNA CTD PMID:37042841 Prpf8 Rat triptonide decreases expression ISO Prpf8 (Mus musculus) 6480464 triptonide results in decreased expression of PRPF8 mRNA CTD PMID:33045310 Prpf8 Rat tungsten decreases expression ISO Prpf8 (Mus musculus) 6480464 Tungsten results in decreased expression of PRPF8 mRNA CTD PMID:30912803 Prpf8 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PRPF8 mRNA CTD PMID:23555832 Prpf8 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PRPF8 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzene (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) crocidolite asbestos (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) disodium selenite (ISO) elemental selenium (ISO) ethanol (ISO) folic acid (ISO) fumonisin B1 (ISO) genistein (ISO) gentamycin (EXP) glyphosate (EXP) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (EXP) miconazole (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) niclosamide (ISO) nitrates (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) piperonyl butoxide (ISO) resveratrol (ISO) selenium atom (ISO) sevoflurane (ISO) sodium arsenite (ISO) tamoxifen (ISO) temozolomide (ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (ISO) tolcapone (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) vinclozolin (EXP)
1.
Genes and mutations causing retinitis pigmentosa.
Daiger SP, etal., Clin Genet. 2013 Aug;84(2):132-41. doi: 10.1111/cge.12203. Epub 2013 Jun 19.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
A novel 40S multi-snRNP complex isolated from rat liver nuclei.
Guialis A, etal., Nucleic Acids Res. 1991 Jan 25;19(2):287-96.
4.
Lipopolysaccharide stimulates phosphorylation of eukaryotic initiation factor-4F in macrophages and tumor necrosis factor participates in this event.
Haas DW, etal., Second Messengers Phosphoproteins. 1992-1993;14(3):163-71.
5.
Mutations in the pre-mRNA splicing factor gene PRPC8 in autosomal dominant retinitis pigmentosa (RP13).
McKie AB, etal., Hum Mol Genet. 2001 Jul 15;10(15):1555-62.
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Comprehensive gene review and curation
RGD comprehensive gene curation
11.
Structural analyses of the pre-mRNA splicing machinery.
Zhang L, etal., Protein Sci. 2013 Jun;22(6):677-92. doi: 10.1002/pro.2266. Epub 2013 May 8.
Prpf8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 60,829,778 - 60,852,887 (+) NCBI GRCr8 mRatBN7.2 10 60,331,494 - 60,354,606 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 60,331,494 - 60,354,606 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 64,978,414 - 65,001,760 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 64,483,841 - 64,507,188 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 59,946,410 - 59,969,757 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 63,635,239 - 63,658,360 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 63,635,219 - 63,658,361 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 64,348,558 - 64,371,667 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 62,786,225 - 62,830,939 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 62,821,711 - 62,844,405 (+) NCBI Celera 10 59,359,820 - 59,382,932 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
PRPF8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 1,650,629 - 1,684,867 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 1,650,629 - 1,684,867 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 1,553,923 - 1,588,161 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 1,500,673 - 1,534,926 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 1,500,673 - 1,534,850 NCBI Celera 17 1,569,279 - 1,603,532 (-) NCBI Celera Cytogenetic Map 17 p13.3 NCBI HuRef 17 1,453,297 - 1,487,547 (-) NCBI HuRef CHM1_1 17 1,562,693 - 1,596,948 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 1,539,419 - 1,573,935 (-) NCBI T2T-CHM13v2.0
Prpf8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 75,377,603 - 75,400,273 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 75,377,642 - 75,400,275 (+) Ensembl GRCm39 Ensembl GRCm38 11 75,486,777 - 75,509,447 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 75,486,816 - 75,509,449 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 75,300,279 - 75,322,949 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 75,303,285 - 75,325,578 (+) NCBI MGSCv36 mm8 Celera 11 82,995,186 - 83,017,855 (+) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 45.92 NCBI
Prpf8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 1,499,634 - 1,530,670 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 1,499,634 - 1,530,670 (+) NCBI ChiLan1.0 ChiLan1.0
PRPF8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 9,223,458 - 9,257,176 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 11,189,660 - 11,223,215 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 1,635,991 - 1,669,703 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 1,532,579 - 1,565,254 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 1,532,579 - 1,565,254 (-) Ensembl panpan1.1 panPan2
PRPF8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 45,797,882 - 45,827,365 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 45,797,959 - 45,828,071 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 44,948,795 - 44,978,151 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 46,624,977 - 46,654,363 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 46,624,983 - 46,654,304 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 45,395,072 - 45,424,429 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 45,689,610 - 45,718,976 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 45,744,054 - 45,773,421 (-) NCBI UU_Cfam_GSD_1.0
Prpf8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 44,902,077 - 44,936,620 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 7,780,022 - 7,814,575 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 7,780,022 - 7,814,575 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRPF8 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 47,861,043 - 47,895,190 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 47,861,041 - 47,895,286 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 49,746,647 - 49,777,073 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRPF8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 1,321,568 - 1,352,775 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 1,321,416 - 1,352,466 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 20,627,886 - 20,660,154 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prpf8
.
Predicted Target Of
Count of predictions: 31 Count of miRNA genes: 30 Interacting mature miRNAs: 30 Transcripts: ENSRNOT00000005016 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 2298495 Eae23 Experimental allergic encephalomyelitis QTL 23 16.93 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 10 55273696 60677262 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH127343
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 10 q24 UniSTS
RH132395
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 60,807,713 - 60,807,921 (+) Marker Load Pipeline mRatBN7.2 10 60,309,421 - 60,309,629 (+) MAPPER mRatBN7.2 Rnor_6.0 10 62,301,975 - 62,302,182 NCBI Rnor6.0 Rnor_5.0 10 62,016,025 - 62,016,232 UniSTS Rnor5.0 RGSC_v3.4 10 62,785,106 - 62,785,313 UniSTS RGSC3.4 Celera 10 59,337,859 - 59,338,066 UniSTS Cytogenetic Map 10 q24 UniSTS
PRPF8
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 60,351,480 - 60,352,626 (+) MAPPER mRatBN7.2 Rnor_6.0 10 63,655,235 - 63,656,380 NCBI Rnor6.0 Rnor_5.0 10 64,350,538 - 64,351,683 UniSTS Rnor5.0 RGSC_v3.4 10 62,827,814 - 62,828,959 UniSTS RGSC3.4 Celera 10 59,379,807 - 59,380,952 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005016 ⟹ ENSRNOP00000005016
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 60,331,494 - 60,354,606 (+) Ensembl Rnor_6.0 Ensembl 10 63,635,251 - 63,658,360 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081813 ⟹ ENSRNOP00000073574
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 60,331,494 - 60,354,606 (+) Ensembl Rnor_6.0 Ensembl 10 63,635,219 - 63,658,361 (+) Ensembl
RefSeq Acc Id:
NM_001191590 ⟹ NP_001178519
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 60,829,778 - 60,852,887 (+) NCBI mRatBN7.2 10 60,331,494 - 60,354,606 (+) NCBI Rnor_6.0 10 63,635,251 - 63,658,360 (+) NCBI Rnor_5.0 10 64,348,558 - 64,371,667 (-) NCBI Celera 10 59,359,820 - 59,382,932 (+) NCBI
Sequence:
ACGCGGAGCGGACGTCGTCTTTCCGCCATTGCTCTGCGAGCCCTGCCGCTACCTAAGTGAGGGACGACAGATTCTCCCGGCATGGCCGGAGTGTTTCCTTACAGAGGGCCGGGTAACCCGGTGCCCGG
hide sequence
RefSeq Acc Id:
XM_006246892 ⟹ XP_006246954
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 60,830,014 - 60,852,887 (+) NCBI mRatBN7.2 10 60,331,499 - 60,354,600 (+) NCBI Rnor_6.0 10 63,635,239 - 63,658,360 (+) NCBI Rnor_5.0 10 64,348,558 - 64,371,667 (-) NCBI
Sequence:
CTGGAGTTGGGAACGCGGAGCGGACGTCGTCTTTCCGCCATTGCTCTGCGAGCCCTGCCGCTACCTAAGTGAGGGACGACAGGTGGGTGGCGGGCGTCTGAGGCTGGGCTGCAAGGCTGTCGAGTGGG
hide sequence
RefSeq Acc Id:
NP_001178519 ⟸ NM_001191590
- UniProtKB:
G3V6H2 (UniProtKB/TrEMBL), A6HGR5 (UniProtKB/TrEMBL), A0A0G2K5V6 (UniProtKB/TrEMBL)
- Sequence:
MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISF
hide sequence
RefSeq Acc Id:
XP_006246954 ⟸ XM_006246892
- Peptide Label:
isoform X1
- UniProtKB:
G3V6H2 (UniProtKB/TrEMBL), A6HGR5 (UniProtKB/TrEMBL), A0A0G2K5V6 (UniProtKB/TrEMBL)
- Sequence:
MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPE
hide sequence
Ensembl Acc Id:
ENSRNOP00000005016 ⟸ ENSRNOT00000005016
Ensembl Acc Id:
ENSRNOP00000073574 ⟸ ENSRNOT00000081813
RGD ID: 13697437 Promoter ID: EPDNEW_R7961 Type: initiation region Name: Prpf8_1 Description: pre-mRNA processing factor 8 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 63,635,264 - 63,635,324 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-07-09
Prpf8
pre-mRNA processing factor 8
Prpf8
PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-24
Prpf8
PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae)
Prpf8
pre-mRNA processing factor 8
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Prpf8
pre-mRNA processing factor 8
Prpf8_predicted
pre-mRNA processing factor 8 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Prpf8_predicted
pre-mRNA processing factor 8 (predicted)
Symbol and Name status set to approved
70820 APPROVED
