Advanced Search (OLGA)

Gene: Cdc34 (cell division cycle 34, ubiquitin conjugating enzyme) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cdc34

Name:

cell division cycle 34, ubiquitin conjugating enzyme (Ensembl:cell division cycle 34, ubiqiutin conjugating enzyme)

RGD ID:

1305411

Description:

Predicted to enable ubiquitin conjugating enzyme activity. Involved in positive regulation of inclusion body assembly; positive regulation of neuron apoptotic process; and response to growth factor. Predicted to be located in cytosol and nuclear speck. Orthologous to human CDC34 (cell division cycle 34, ubiqiutin conjugating enzyme); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cell division cycle 34; cell division cycle 34 homolog; cell division cycle 34 homolog (S. cerevisiae); cell division cycle 34, ubiqiutin conjugating enzyme; LOC299602; MGC116225; serine protease; ubiquitin-conjugating enzyme Cdc34; ubiquitin-conjugating enzyme E2 R1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,668,209 - 10,674,206 (-)	NCBI		GRCr8
mRatBN7.2	7	10,017,588 - 10,023,586 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	10,017,588 - 10,023,186 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	12,898,439 - 12,903,841 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,776,519 - 14,781,920 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,635,935 - 12,641,338 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,899,957 - 12,905,339 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,899,958 - 12,905,339 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	13,068,993 - 13,074,382 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	11,534,543 - 11,539,941 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	11,536,995 - 11,537,397 (-)	NCBI
Celera	7	8,190,966 - 8,196,364 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc34	Rat	(-)-citrinin	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[Citrinin co-treated with ochratoxin A] results in decreased expression of CDC34 mRNA	CTD	PMID:30428381
Cdc34	Rat	(-)-citrinin	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	Citrinin results in decreased expression of CDC34 mRNA	CTD	PMID:30428381
Cdc34	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CDC34 mRNA	CTD	PMID:36331819
Cdc34	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of CDC34 mRNA	CTD	PMID:22206623
Cdc34	Rat	1,2-dimethylhydrazine	increases expression	ISO	Cdc34 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of CDC34 mRNA	CTD	PMID:22206623
Cdc34	Rat	17beta-estradiol	affects expression	ISO	Cdc34 (Mus musculus)	6480464	Estradiol affects the expression of CDC34 mRNA	CTD	PMID:15598610
Cdc34	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Cdc34 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of CDC34 mRNA	CTD	PMID:21354282
Cdc34	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of CDC34 mRNA	CTD	PMID:34747641
Cdc34	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Cdc34 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of CDC34 mRNA	CTD	PMID:21570461
Cdc34	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of CDC34 mRNA	CTD	PMID:21346803
Cdc34	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of CDC34 mRNA	CTD	PMID:21346803
Cdc34	Rat	2-hydroxypropanoic acid	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of CDC34 mRNA	CTD	PMID:30851411
Cdc34	Rat	2-methylcholine	affects expression	ISO	CDC34 (Homo sapiens)	6480464	beta-methylcholine affects the expression of CDC34 mRNA	CTD	PMID:21179406
Cdc34	Rat	2-palmitoylglycerol	increases expression	ISO	CDC34 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of CDC34 mRNA	CTD	PMID:37199045
Cdc34	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of CDC34 mRNA more ...	CTD	PMID:28628672
Cdc34	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Cdc34 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of CDC34 mRNA	CTD	PMID:18648102
Cdc34	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CDC34 mRNA	CTD	PMID:28628672
Cdc34	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CDC34 mRNA	CTD	PMID:36041667
Cdc34	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Cdc34 (Mus musculus)	6480464	bisphenol S results in increased expression of CDC34 mRNA	CTD	PMID:39298647
Cdc34	Rat	5-fluorouracil	affects response to substance	ISO	CDC34 (Homo sapiens)	6480464	CDC34 protein affects the susceptibility to Fluorouracil	CTD	PMID:16217747
Cdc34	Rat	acrolein	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	Acrolein results in decreased expression of CDC34 protein	CTD	PMID:24812010
Cdc34	Rat	acrolein	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CDC34 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of CDC34 mRNA	CTD	PMID:32699268
Cdc34	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of CDC34 mRNA	CTD	PMID:28959563
Cdc34	Rat	aflatoxin B1	increases methylation	ISO	CDC34 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of CDC34 intron	CTD	PMID:30157460
Cdc34	Rat	alpha-pinene	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CDC34 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of CDC34 mRNA	CTD	PMID:32699268
Cdc34	Rat	aristolochic acid A	increases expression	ISO	CDC34 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of CDC34 mRNA	CTD	PMID:33212167
Cdc34	Rat	Aroclor 1254	increases expression	EXP		6480464	Chlorodiphenyl (54% Chlorine) results in increased expression of CDC34 mRNA	CTD	PMID:18178546
Cdc34	Rat	Aroclor 1254	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in increased expression of CDC34 mRNA	CTD	PMID:23650126
Cdc34	Rat	arsenous acid	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of CDC34 mRNA	CTD	PMID:20458559
Cdc34	Rat	arsenous acid	increases expression	ISO	CDC34 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of CDC34 mRNA	CTD	PMID:17530438
Cdc34	Rat	benzo[a]pyrene	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of CDC34 mRNA	CTD	PMID:16120219 and PMID:20106945
Cdc34	Rat	benzo[a]pyrene	decreases expression	ISO	Cdc34 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of CDC34 mRNA	CTD	PMID:22228805
Cdc34	Rat	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of CDC34 mRNA	CTD	PMID:21318169
Cdc34	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of CDC34 mRNA	CTD	PMID:33754040
Cdc34	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CDC34 mRNA	CTD	PMID:25181051 and PMID:32145629
Cdc34	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CDC34 mRNA	CTD	PMID:36041667
Cdc34	Rat	bisphenol A	increases expression	ISO	Cdc34 (Mus musculus)	6480464	bisphenol A results in increased expression of CDC34 mRNA	CTD	PMID:32156529
Cdc34	Rat	bisphenol A	decreases methylation	ISO	CDC34 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of CDC34 gene	CTD	PMID:31601247
Cdc34	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CDC34 mRNA	CTD	PMID:33296240
Cdc34	Rat	bisphenol A	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of CDC34 mRNA	CTD	PMID:28628672
Cdc34	Rat	bisphenol F	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CDC34 mRNA	CTD	PMID:28628672
Cdc34	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CDC34 mRNA	CTD	PMID:36041667
Cdc34	Rat	bortezomib	increases expression	ISO	CDC34 (Homo sapiens)	6480464	Bortezomib results in increased expression of CDC34 mRNA	CTD	PMID:20977926
Cdc34	Rat	bromobenzene	increases expression	EXP		6480464	bromobenzene results in increased expression of CDC34 mRNA	CTD	PMID:15056800
Cdc34	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of CDC34 promoter	CTD	PMID:22457795
Cdc34	Rat	carbon nanotube	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Nanotubes and Carbon results in increased expression of CDC34 mRNA	CTD	PMID:25620056
Cdc34	Rat	choline	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CDC34 gene	CTD	PMID:20938992
Cdc34	Rat	clofibrate	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of CDC34 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of CDC34 mRNA]	CTD	PMID:17585979
Cdc34	Rat	clofibrate	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Clofibrate results in increased expression of CDC34 mRNA	CTD	PMID:17585979
Cdc34	Rat	copper(II) chloride	affects expression	ISO	CDC34 (Homo sapiens)	6480464	cupric chloride affects the expression of CDC34 mRNA	CTD	PMID:17211630
Cdc34	Rat	cryptolepine	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	cryptolepine results in decreased expression of CDC34 mRNA	CTD	PMID:16120219
Cdc34	Rat	cyclosporin A	decreases methylation	ISO	CDC34 (Homo sapiens)	6480464	Cyclosporine results in decreased methylation of CDC34 promoter	CTD	PMID:27989131
Cdc34	Rat	cyproconazole	increases expression	ISO	Cdc34 (Mus musculus)	6480464	cyproconazole results in increased expression of CDC34 mRNA	CTD	PMID:22334560
Cdc34	Rat	dexamethasone	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of CDC34 mRNA more ...	CTD	PMID:28628672
Cdc34	Rat	diarsenic trioxide	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of CDC34 mRNA	CTD	PMID:20458559
Cdc34	Rat	diarsenic trioxide	increases expression	ISO	CDC34 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of CDC34 mRNA	CTD	PMID:17530438
Cdc34	Rat	diazinon	affects expression	EXP		6480464	Diazinon affects the expression of CDC34 mRNA	CTD	PMID:22546817
Cdc34	Rat	dieldrin	affects expression	EXP		6480464	Dieldrin affects the expression of CDC34 mRNA	CTD	PMID:22546817
Cdc34	Rat	dioxygen	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Oxygen deficiency results in increased expression of CDC34 mRNA	CTD	PMID:24205000
Cdc34	Rat	dioxygen	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CDC34 mRNA	CTD	PMID:30529165
Cdc34	Rat	diquat	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Diquat results in increased expression of CDC34 mRNA	CTD	PMID:36851058
Cdc34	Rat	epoxiconazole	increases expression	ISO	Cdc34 (Mus musculus)	6480464	epoxiconazole results in increased expression of CDC34 mRNA	CTD	PMID:22334560
Cdc34	Rat	ethanol	decreases expression	EXP		6480464	Ethanol results in decreased expression of CDC34 mRNA	CTD	PMID:15353170
Cdc34	Rat	fenthion	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Fenthion results in increased expression of CDC34 mRNA	CTD	PMID:34813904
Cdc34	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of CDC34 mRNA	CTD	PMID:24136188
Cdc34	Rat	folic acid	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[1 more ...	CTD	PMID:20938992 and PMID:22206623
Cdc34	Rat	folic acid	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Folic Acid results in increased expression of CDC34 mRNA	CTD	PMID:25629700
Cdc34	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of CDC34 mRNA	CTD	PMID:22061828
Cdc34	Rat	indometacin	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of CDC34 mRNA more ...	CTD	PMID:28628672
Cdc34	Rat	inulin	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CDC34 mRNA	CTD	PMID:36331819
Cdc34	Rat	ivermectin	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	Ivermectin results in decreased expression of CDC34 protein	CTD	PMID:32959892
Cdc34	Rat	L-methionine	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CDC34 gene	CTD	PMID:20938992
Cdc34	Rat	Licochalcone B	increases expression	ISO	CDC34 (Homo sapiens)	6480464	licochalcone B results in increased expression of CDC34 mRNA	CTD	PMID:33647349
Cdc34	Rat	metformin	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[Paclitaxel co-treated with Metformin] results in decreased expression of CDC34 mRNA	CTD	PMID:29309887
Cdc34	Rat	methapyrilene	increases expression	EXP		6480464	Methapyrilene results in increased expression of CDC34 mRNA	CTD	PMID:16393664
Cdc34	Rat	methotrexate	affects response to substance	ISO	CDC34 (Homo sapiens)	6480464	CDC34 protein affects the susceptibility to Methotrexate	CTD	PMID:16217747
Cdc34	Rat	methylmercury chloride	increases expression	ISO	CDC34 (Homo sapiens)	6480464	methylmercuric chloride results in increased expression of CDC34 mRNA	CTD	PMID:28001369
Cdc34	Rat	N-methyl-4-phenylpyridinium	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	U 0126 affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of CDC34 mRNA]	CTD	PMID:12710931
Cdc34	Rat	N-nitrosodiethylamine	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of CDC34 gene	CTD	PMID:23968726
Cdc34	Rat	nickel sulfate	increases expression	ISO	CDC34 (Homo sapiens)	6480464	nickel sulfate results in increased expression of CDC34 mRNA	CTD	PMID:18651567
Cdc34	Rat	ochratoxin A	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[Citrinin co-treated with ochratoxin A] results in decreased expression of CDC34 mRNA	CTD	PMID:30428381
Cdc34	Rat	ochratoxin A	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	ochratoxin A results in decreased expression of CDC34 mRNA	CTD	PMID:30428381
Cdc34	Rat	ozone	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CDC34 mRNA more ...	CTD	PMID:32699268 and PMID:35430440
Cdc34	Rat	ozone	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CDC34 mRNA	CTD	PMID:34911549
Cdc34	Rat	paclitaxel	multiple interactions	ISO	CDC34 (Homo sapiens)	6480464	[Paclitaxel co-treated with Metformin] results in decreased expression of CDC34 mRNA	CTD	PMID:29309887
Cdc34	Rat	paracetamol	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of CDC34 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of CDC34 mRNA]	CTD	PMID:17585979
Cdc34	Rat	pentachlorophenol	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of CDC34 mRNA	CTD	PMID:23892564
Cdc34	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CDC34 mRNA more ...	CTD	PMID:36331819
Cdc34	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of CDC34 mRNA	CTD	PMID:19162173 and PMID:21318169
Cdc34	Rat	phenobarbital	affects expression	ISO	CDC34 (Homo sapiens)	6480464	Phenobarbital affects the expression of CDC34 mRNA	CTD	PMID:19159669
Cdc34	Rat	phenobarbital	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Phenobarbital results in increased expression of CDC34 mRNA	CTD	PMID:19270015
Cdc34	Rat	PhIP	increases expression	ISO	CDC34 (Homo sapiens)	6480464	2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of CDC34 mRNA	CTD	PMID:16120219
Cdc34	Rat	piperonyl butoxide	multiple interactions	ISO	Cdc34 (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of CDC34 gene	CTD	PMID:23968726
Cdc34	Rat	pirinixic acid	increases expression	ISO	Cdc34 (Mus musculus)	6480464	pirinixic acid results in increased expression of CDC34 mRNA	CTD	PMID:18301758 and PMID:23811191
Cdc34	Rat	propiconazole	increases expression	ISO	Cdc34 (Mus musculus)	6480464	propiconazole results in increased expression of CDC34 mRNA	CTD	PMID:22334560
Cdc34	Rat	rac-lactic acid	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of CDC34 mRNA	CTD	PMID:30851411
Cdc34	Rat	sodium arsenite	increases expression	ISO	CDC34 (Homo sapiens)	6480464	sodium arsenite results in increased expression of CDC34 mRNA	CTD	PMID:38568856
Cdc34	Rat	sodium arsenite	decreases expression	ISO	CDC34 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of CDC34 protein	CTD	PMID:30528433
Cdc34	Rat	sodium dichromate	increases expression	ISO	Cdc34 (Mus musculus)	6480464	sodium bichromate results in increased expression of CDC34 mRNA	CTD	PMID:22155349
Cdc34	Rat	sunitinib	increases expression	ISO	CDC34 (Homo sapiens)	6480464	Sunitinib results in increased expression of CDC34 mRNA	CTD	PMID:31533062
Cdc34	Rat	tamoxifen	increases expression	ISO	Cdc34 (Mus musculus)	6480464	Tamoxifen results in increased expression of CDC34 mRNA	CTD	PMID:17555576
Cdc34	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of CDC34 mRNA	CTD	PMID:31150632
Cdc34	Rat	thiram	increases expression	ISO	CDC34 (Homo sapiens)	6480464	Thiram results in increased expression of CDC34 mRNA	CTD	PMID:38568856
Cdc34	Rat	titanium dioxide	increases methylation	ISO	Cdc34 (Mus musculus)	6480464	titanium dioxide results in increased methylation of CDC34 promoter	CTD	PMID:35295148
Cdc34	Rat	trichloroethene	affects expression	ISO	Cdc34 (Mus musculus)	6480464	Trichloroethylene affects the expression of CDC34 mRNA	CTD	PMID:21135412
Cdc34	Rat	trimellitic anhydride	increases expression	ISO	Cdc34 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of CDC34 mRNA	CTD	PMID:19042947
Cdc34	Rat	triphenyl phosphate	affects expression	ISO	CDC34 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of CDC34 mRNA	CTD	PMID:37042841
Cdc34	Rat	triptonide	increases expression	ISO	Cdc34 (Mus musculus)	6480464	triptonide results in increased expression of CDC34 mRNA	CTD	PMID:33045310
Cdc34	Rat	trovafloxacin	increases expression	ISO	Cdc34 (Mus musculus)	6480464	trovafloxacin results in increased expression of CDC34 mRNA	CTD	PMID:35537566
Cdc34	Rat	urethane	increases expression	ISO	CDC34 (Homo sapiens)	6480464	Urethane results in increased expression of CDC34 mRNA	CTD	PMID:28818685
Cdc34	Rat	valproic acid	increases expression	ISO	CDC34 (Homo sapiens)	6480464	Valproic Acid results in increased expression of CDC34 mRNA	CTD	PMID:29154799
Cdc34	Rat	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of CDC34 mRNA	CTD	PMID:21318169
Cdc34	Rat	valproic acid	increases methylation	ISO	CDC34 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of CDC34 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc34	Rat	cellular response to interferon-beta	involved_in	ISO	CDC34 (Homo sapiens)	1624291	PMID:24882218	RGD	PMID:24882218
Cdc34	Rat	positive regulation of inclusion body assembly		IMP		2316159		RGD
Cdc34	Rat	positive regulation of neuron apoptotic process		IMP		2316159		RGD
Cdc34	Rat	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	ISO	CDC34 (Homo sapiens)	1624291	PMID:10373550 and PMID:20347421	RGD	PMID:10373550 and PMID:20347421
Cdc34	Rat	protein K48-linked ubiquitination	involved_in	ISO	CDC34 (Homo sapiens)	1624291	PMID:20061386	RGD	PMID:20061386
Cdc34	Rat	protein polyubiquitination	involved_in	ISO	CDC34 (Homo sapiens)	1624291	PMID:20347421	RGD	PMID:20347421
Cdc34	Rat	protein polyubiquitination	involved_in	IBA	MGI:1914378 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdc34	Rat	protein ubiquitination	involved_in	ISO	CDC34 (Homo sapiens)	1624291	PMID:10373550	RGD	PMID:10373550
Cdc34	Rat	response to growth factor		IEP		2316158		RGD
Cdc34	Rat	ubiquitin-dependent protein catabolic process	involved_in	IBA	PANTHER:PTN000629793 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc34	Rat	cytosol	located_in	ISO	CDC34 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Cdc34	Rat	nuclear speck	located_in	ISO	CDC34 (Homo sapiens)	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc34	Rat	ATP binding	enables	IEA	UniRule:UR000141827	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Cdc34	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cdc34	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cdc34	Rat	protein binding	enables	ISO	CDC34 (Homo sapiens)	1624291	UniProtKB:O00560 more ...	RGD	PMID:10373550 more ...
Cdc34	Rat	protein binding	enables	ISO	Cdc34 (Mus musculus)	1624291	UniProtKB:Q9D995 and PMID:32640224	RGD	PMID:32640224
Cdc34	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cdc34	Rat	ubiquitin conjugating enzyme activity	enables	ISO	CDC34 (Homo sapiens)	1624291	PMID:20061386	RGD	PMID:20061386
Cdc34	Rat	ubiquitin conjugating enzyme activity	enables	ISO	Cdc34 (Mus musculus)	1624291	PMID:10230407	RGD	PMID:10230407
Cdc34	Rat	ubiquitin conjugating enzyme activity	enables	IBA	MGI:102657 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdc34	Rat	ubiquitin-protein transferase activity	enables	ISO	CDC34 (Homo sapiens)	1624291	PMID:10373550 more ...	RGD	PMID:10373550 more ...

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc34	Rat	ubiquitin/proteasome degradation pathway		IEA		6907045		KEGG	rno:04120

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Differential regulation of components of the ubiquitin-proteasome pathway during lens cell differentiation.	Guo W, etal., Invest Ophthalmol Vis Sci. 2004 Apr;45(4):1194-201.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Proteasomal inhibition-induced inclusion formation and death in cortical neurons require transcription and ubiquitination.	Rideout HJ and Stefanis L, Mol Cell Neurosci. 2002 Oct;21(2):223-38.

PMID:7607701	PMID:8889548	PMID:10230407	PMID:10373550	PMID:12477932	PMID:15632090	PMID:20061386	PMID:20347421	PMID:24882218

Cdc34
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,668,209 - 10,674,206 (-)	NCBI		GRCr8
mRatBN7.2	7	10,017,588 - 10,023,586 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	10,017,588 - 10,023,186 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	12,898,439 - 12,903,841 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,776,519 - 14,781,920 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,635,935 - 12,641,338 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,899,957 - 12,905,339 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,899,958 - 12,905,339 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	13,068,993 - 13,074,382 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	11,534,543 - 11,539,941 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	11,536,995 - 11,537,397 (-)	NCBI
Celera	7	8,190,966 - 8,196,364 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

CDC34
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	531,760 - 542,087 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	531,760 - 542,092 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	531,760 - 542,087 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	482,733 - 493,087 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	482,732 - 493,086	NCBI
Celera	19	275,911 - 286,006 (-)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	302,243 - 312,073 (+)	NCBI		HuRef
CHM1_1	19	531,321 - 541,181 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	485,161 - 495,858 (+)	NCBI		T2T-CHM13v2.0

Cdc34
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	79,518,029 - 79,524,232 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	79,518,029 - 79,524,232 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	79,682,193 - 79,688,398 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	79,682,195 - 79,688,398 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	79,144,940 - 79,151,143 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	79,085,324 - 79,091,527 (+)	NCBI		MGSCv36	mm8
Celera	10	80,696,643 - 80,702,713 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Cdc34
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	7,170,419 - 7,178,093 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	7,170,419 - 7,178,093 (-)	NCBI	ChiLan1.0	ChiLan1.0

CDC34
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	4,859,316 - 4,869,429 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	4,098,001 - 4,108,029 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	592,856 - 602,811 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	480,279 - 512,173 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	502,766 - 512,173 (+)	Ensembl	panpan1.1		panPan2

CDC34
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	57,960,506 - 57,967,388 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	57,960,833 - 57,967,371 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	57,763,280 - 57,770,160 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	58,704,017 - 58,710,922 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	20	57,757,620 - 57,764,520 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	58,237,526 - 58,244,396 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	58,440,773 - 58,447,653 (-)	NCBI		UU_Cfam_GSD_1.0

Cdc34
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	217,667,522 - 217,674,997 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	161,455 - 165,656 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	160,066 - 167,259 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDC34
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	77,761,593 - 77,768,395 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	77,761,587 - 77,768,332 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CDC34
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	262,818 - 280,041 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	262,860 - 281,513 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666081	8,799,464 - 8,808,156 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cdc34
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	7,935,550 - 7,942,957 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	7,935,544 - 7,942,627 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cdc34
9 total Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
7	13069399	13069400	C	T	snv	BUF/MNa (KyushuU), F344/Jcl (KyushuU), RCS/Kyo (KyushuU)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	69
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000011023
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

AI327276

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	10,017,754 - 10,017,858 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	12,900,124 - 12,900,227	NCBI	Rnor6.0
Rnor_5.0	7	13,069,160 - 13,069,263	UniSTS	Rnor5.0
RGSC_v3.4	7	11,534,710 - 11,534,813	UniSTS	RGSC3.4
Celera	7	8,191,133 - 8,191,236	UniSTS
Cytogenetic Map	7	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001013103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG375350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB611861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L38482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000088330 ⟹ ENSRNOP00000074000

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	10,017,588 - 10,023,186 (-)	Ensembl
Rnor_6.0 Ensembl	7	12,899,958 - 12,905,339 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116036 ⟹ ENSRNOP00000095465

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	10,017,926 - 10,023,186 (-)	Ensembl

RefSeq Acc Id:

NM_001013103 ⟹ NP_001013121

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,668,209 - 10,673,607 (-)	NCBI
mRatBN7.2	7	10,017,588 - 10,022,987 (-)	NCBI
Rnor_6.0	7	12,899,957 - 12,905,339 (-)	NCBI
Rnor_5.0	7	13,068,993 - 13,074,382 (-)	NCBI
RGSC_v3.4	7	11,534,543 - 11,539,941 (-)	RGD
Celera	7	8,190,966 - 8,196,364 (-)	RGD

Sequence:

show sequence

GCCGCCGCCGTCACCGCCATGGCCCGGCCGCTGGTGCCCAGCTCGCAGAAGGCGCTGCTGCTGGAGCTGAAGGGGCTGCAGGAGGAGCCGGTGGAGGGCTTCCGGGTGACGCTGGTGGACGAGGGCGA
CCTGTACAACTGGGAGGTGGCCATCTTCGGACCCCCCAACACCTACTATGAGGGCGGCTACTTCAAGGCTCGCCTCAAGTTCCCCATCGACTACCCATATTCCCCACCAGCCTTCCGGTTCCTCACCA
AGATGTGGCACCCAAACATCTATGAGACAGGGGACGTATGCATCTCCATCCTCCATCCCCCAGTTGATGACCCACAGAGTGGGGAGCTACCCTCAGAGCGGTGGAACCCCACGCAGAATGTCAGGACC
ATCCTCCTGAGTGTGATCTCCCTGCTGAATGAGCCCAACACCTTCTCGCCTGCCAACGTGGACGCCTCGGTGATGTACAGAAAATGGAAGGAGAGCAAGGGGAAGGACCGCGAGTACACGGACATCAT
CCGGAAGCAGGTCCTGGGGACCAAGGTGGACGCAGAGCGCGATGGCGTGAAGGTGCCCACCACGCTGGCCGAGTACTGCGTGAAGACCAAGGCGCCGGCGCCCGACGAGGGCTCAGACCTCTTCTACG
ACGACTACTATGAGGACGGTGAAGTGGAGGAGGCCGACAGCTGCTTTGGGGATGAAGAGGATGACTCTGGCACCGAGGAGTCCTGACCCACGTCCCTGAAATAAACTTACAAATTTTACCTCAGCAGG
ACCCGTGTGGGCCTCAGGCGACAGACTACCTCACCGAGGTTCAATGTGGGCTCCCATCCCATGATCCTTAGGTCCTCTTACCCTGTATTCCCCATGGGTTTTCCTCGGCTTTGGAGAAGAGCTGTGGT
GCAGGGCAGACACCCCACTCAGCCTTCAGAGGATGACAAGCCTGGGAGGCTGGGAACCGACTGCCCAGGGGAGCCAGAGACTCCAGCCCAAAGAGGGCCAGCCCCACAGTCTCCTCTCTGCTTTTGGT
GTGTGTGAAATCCAAATAAAATAGCTTTCTGAGAAGCTGAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039078634 ⟹ XP_038934562

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,668,214 - 10,674,206 (-)	NCBI
mRatBN7.2	7	10,017,588 - 10,023,586 (-)	NCBI


Protein RefSeqs	NP_001013121	(Get FASTA)	NCBI Sequence Viewer
	XP_038934562	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA98928	(Get FASTA)	NCBI Sequence Viewer
	EDL89409	(Get FASTA)	NCBI Sequence Viewer
	EDL89410	(Get FASTA)	NCBI Sequence Viewer
	EDL89411	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074000.1
	ENSRNOP00000095465
	ENSRNOP00000095465.1

RefSeq Acc Id:

NP_001013121 ⟸ NM_001013103

- UniProtKB:

D4A453 (UniProtKB/TrEMBL), A6K8Z0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVI
SLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEADSCFGDEEDDSGTEES

hide sequence

Ensembl Acc Id:

ENSRNOP00000074000 ⟸ ENSRNOT00000088330

RefSeq Acc Id:	XP_038934562 ⟸ XM_039078634
- Peptide Label:	isoform X1
- UniProtKB:	A6K8Y9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000095465 ⟸ ENSRNOT00000116036

Protein Domains

UBC core

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A453-F1-model_v2	AlphaFold	D4A453	1-235	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34881	BioCyc
Ensembl Genes	ENSRNOG00000060530	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000088330.2	UniProtKB/TrEMBL
	ENSRNOT00000116036	ENTREZGENE
	ENSRNOT00000116036.1	UniProtKB/TrEMBL
Gene3D-CATH	3.10.110.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7458604	IMAGE-MGC_LOAD
InterPro	Ub_conjugating_enzyme	UniProtKB/TrEMBL
	UBQ-conjugat/RWD-like	UniProtKB/TrEMBL
	UBQ-conjugat_E2	UniProtKB/TrEMBL
	UBQ-conjugating_AS	UniProtKB/TrEMBL
KEGG Report	rno:299602	UniProtKB/TrEMBL
MGC_CLONE	MGC:116225	IMAGE-MGC_LOAD
NCBI Gene	299602	ENTREZGENE
PANTHER	UBIQUITIN-CONJUGATING ENZYME E2	UniProtKB/TrEMBL
Pfam	UQ_con	UniProtKB/TrEMBL
PharmGKB	CDC34	RGD
PhenoGen	Cdc34	PhenoGen
PROSITE	UBIQUITIN_CONJUGAT_1	UniProtKB/TrEMBL
	UBIQUITIN_CONJUGAT_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000060530	RatGTEx
SMART	UBCc	UniProtKB/TrEMBL
Superfamily-SCOP	UBQ-conjugat/RWD-like	UniProtKB/TrEMBL
UniProt	A0A8I6AJQ8_RAT	UniProtKB/TrEMBL
	A6K8Y9	ENTREZGENE, UniProtKB/TrEMBL
	A6K8Z0	ENTREZGENE, UniProtKB/TrEMBL
	D4A453	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-01-24	Cdc34	cell division cycle 34, ubiquitin conjugating enzyme	Cdc34	cell division cycle 34, ubiqiutin conjugating enzyme	Name changed	629549	APPROVED
2020-04-28	Cdc34	cell division cycle 34, ubiqiutin conjugating enzyme	Cdc34	cell division cycle 34	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-01-31	Cdc34	cell division cycle 34	Cdc34	cell division cycle 34 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Cdc34	cell division cycle 34 homolog (S. cerevisiae)	Cdc34_predicted	cell division cycle 34 homolog (S. cerevisiae) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Cdc34_predicted	cell division cycle 34 homolog (S. cerevisiae) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Annotations - KEGG (archival)