Symbol:
Usp42
Name:
ubiquitin specific peptidase 42
RGD ID:
1305231
Description:
Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in protein deubiquitination; regulation of apoptotic process; and regulation of protein stability. Predicted to be active in cytosol and nucleus. Orthologous to human USP42 (ubiquitin specific peptidase 42); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; acrylamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
deubiquitinating enzyme 42; LOC288482; ubiquitin carboxyl-terminal hydrolase 42; ubiquitin specific protease 42; ubiquitin thioesterase 42; ubiquitin thiolesterase 42; ubiquitin-specific-processing protease 42
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 15,903,110 - 15,954,429 (+) NCBI GRCr8 mRatBN7.2 12 10,800,864 - 10,840,785 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 10,802,581 - 10,840,785 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 11,629,499 - 11,648,040 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 12,252,791 - 12,271,334 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 11,276,762 - 11,295,321 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 12,840,131 - 12,878,207 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 12,859,661 - 12,877,495 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 14,881,194 - 14,922,553 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 11,151,534 - 11,170,068 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 11,181,461 - 11,196,973 (+) NCBI Celera 12 12,619,047 - 12,637,594 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp42 Rat (1->4)-beta-D-glucan multiple interactions ISO Usp42 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP42 mRNA CTD PMID:36331819 Usp42 Rat 1,2-dimethylhydrazine increases expression ISO Usp42 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of USP42 mRNA CTD PMID:22206623 Usp42 Rat 17alpha-ethynylestradiol multiple interactions ISO Usp42 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of USP42 mRNA CTD PMID:17942748 Usp42 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Usp42 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of USP42 mRNA CTD PMID:17942748 Usp42 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP42 mRNA CTD PMID:34747641 Usp42 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Usp42 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of USP42 mRNA CTD PMID:25270620 Usp42 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of USP42 mRNA CTD PMID:21346803 Usp42 Rat 2-methylcholine affects expression ISO USP42 (Homo sapiens) 6480464 beta-methylcholine affects the expression of USP42 mRNA CTD PMID:21179406 Usp42 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO USP42 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of USP42 mRNA CTD PMID:28628672 Usp42 Rat 4,4'-sulfonyldiphenol multiple interactions ISO USP42 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of USP42 mRNA CTD PMID:28628672 Usp42 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of USP42 mRNA CTD PMID:28959563 Usp42 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of USP42 mRNA CTD PMID:38685447 Usp42 Rat aristolochic acid A decreases expression ISO USP42 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of USP42 mRNA CTD PMID:33212167 Usp42 Rat arsenite(3-) multiple interactions ISO USP42 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to USP42 mRNA] CTD PMID:32406909 Usp42 Rat benzo[a]pyrene increases methylation ISO USP42 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of USP42 promoter CTD PMID:27901495 Usp42 Rat benzo[a]pyrene affects methylation ISO USP42 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of USP42 3' UTR CTD PMID:27901495 Usp42 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of USP42 mRNA CTD PMID:25181051 Usp42 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP42 mRNA CTD PMID:30816183 more ... Usp42 Rat caffeine decreases phosphorylation ISO USP42 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of USP42 protein CTD PMID:35688186 Usp42 Rat chlorpyrifos decreases expression ISO Usp42 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of USP42 mRNA CTD PMID:37019170 Usp42 Rat cisplatin decreases expression ISO USP42 (Homo sapiens) 6480464 Cisplatin results in decreased expression of USP42 mRNA CTD PMID:27594783 Usp42 Rat copper(II) sulfate increases expression ISO USP42 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of USP42 mRNA CTD PMID:19549813 Usp42 Rat coumarin decreases phosphorylation ISO USP42 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of USP42 protein CTD PMID:35688186 Usp42 Rat cyclosporin A increases expression ISO USP42 (Homo sapiens) 6480464 Cyclosporine results in increased expression of USP42 mRNA CTD PMID:20106945 and PMID:25562108 Usp42 Rat dexamethasone multiple interactions ISO USP42 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of USP42 mRNA CTD PMID:28628672 Usp42 Rat dorsomorphin multiple interactions ISO USP42 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Usp42 Rat doxorubicin decreases expression ISO USP42 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of USP42 mRNA CTD PMID:29803840 Usp42 Rat formaldehyde decreases expression ISO USP42 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of USP42 mRNA CTD PMID:20655997 Usp42 Rat FR900359 affects phosphorylation ISO USP42 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of USP42 protein CTD PMID:37730182 Usp42 Rat indometacin multiple interactions ISO USP42 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of USP42 mRNA CTD PMID:28628672 Usp42 Rat lead diacetate increases expression ISO Usp42 (Mus musculus) 6480464 lead acetate results in increased expression of USP42 mRNA CTD PMID:20542052 Usp42 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of USP42 mRNA CTD PMID:33484710 Usp42 Rat paracetamol affects expression ISO Usp42 (Mus musculus) 6480464 Acetaminophen affects the expression of USP42 mRNA CTD PMID:17562736 Usp42 Rat paracetamol decreases expression ISO USP42 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of USP42 mRNA CTD PMID:21420995 Usp42 Rat pentachlorophenol increases expression ISO Usp42 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of USP42 mRNA CTD PMID:23892564 Usp42 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Usp42 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of USP42 mRNA CTD PMID:36331819 Usp42 Rat pirinixic acid decreases expression ISO Usp42 (Mus musculus) 6480464 pirinixic acid results in decreased expression of USP42 mRNA CTD PMID:21318169 Usp42 Rat pirinixic acid multiple interactions ISO Usp42 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in decreased expression of USP42 mRNA] CTD PMID:21318169 Usp42 Rat SB 431542 multiple interactions ISO USP42 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Usp42 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of USP42 mRNA CTD PMID:21297353 Usp42 Rat temozolomide increases expression ISO USP42 (Homo sapiens) 6480464 Temozolomide results in increased expression of USP42 mRNA CTD PMID:31758290 Usp42 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of USP42 mRNA CTD PMID:34492290 Usp42 Rat thiram increases expression ISO USP42 (Homo sapiens) 6480464 Thiram results in increased expression of USP42 mRNA CTD PMID:38568856 Usp42 Rat titanium dioxide decreases methylation ISO Usp42 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP42 promoter CTD PMID:35295148 Usp42 Rat torcetrapib increases expression ISO USP42 (Homo sapiens) 6480464 torcetrapib results in increased expression of USP42 mRNA CTD PMID:23228038 Usp42 Rat trichostatin A decreases expression ISO USP42 (Homo sapiens) 6480464 trichostatin A results in decreased expression of USP42 mRNA CTD PMID:26272509 Usp42 Rat trichostatin A multiple interactions ISO USP42 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of USP42 mRNA CTD PMID:27188386 Usp42 Rat triphenyl phosphate affects expression ISO USP42 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of USP42 mRNA CTD PMID:37042841 Usp42 Rat triticonazole decreases expression EXP 6480464 triticonazole results in decreased expression of USP42 mRNA CTD PMID:36084822 Usp42 Rat tungsten decreases expression ISO Usp42 (Mus musculus) 6480464 Tungsten results in decreased expression of USP42 mRNA CTD PMID:30912803 Usp42 Rat urethane increases expression ISO USP42 (Homo sapiens) 6480464 Urethane results in increased expression of USP42 mRNA CTD PMID:28818685 Usp42 Rat valproic acid increases methylation ISO USP42 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of USP42 gene CTD PMID:29154799 Usp42 Rat valproic acid affects expression ISO USP42 (Homo sapiens) 6480464 Valproic Acid affects the expression of USP42 mRNA CTD PMID:25979313 Usp42 Rat valproic acid decreases expression ISO USP42 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of USP42 mRNA CTD PMID:23179753 more ... Usp42 Rat valproic acid multiple interactions ISO USP42 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of USP42 mRNA CTD PMID:27188386
Usp42 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 15,903,110 - 15,954,429 (+) NCBI GRCr8 mRatBN7.2 12 10,800,864 - 10,840,785 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 10,802,581 - 10,840,785 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 11,629,499 - 11,648,040 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 12,252,791 - 12,271,334 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 11,276,762 - 11,295,321 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 12,840,131 - 12,878,207 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 12,859,661 - 12,877,495 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 14,881,194 - 14,922,553 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 11,151,534 - 11,170,068 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 11,181,461 - 11,196,973 (+) NCBI Celera 12 12,619,047 - 12,637,594 (+) NCBI Celera Cytogenetic Map 12 p11 NCBI
USP42 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 6,081,241 - 6,161,564 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 6,104,949 - 6,161,564 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 6,144,580 - 6,201,195 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 6,111,076 - 6,167,720 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 6,533,917 - 6,590,564 (-) NCBI Celera Cytogenetic Map 7 p22.1 NCBI HuRef 7 6,022,858 - 6,073,300 (+) NCBI HuRef CHM1_1 7 6,144,305 - 6,200,795 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 6,197,991 - 6,280,940 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 6,190,906 - 6,247,551 (+) NCBI
Usp42 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 143,696,077 - 143,741,600 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 143,696,080 - 143,718,035 (-) Ensembl GRCm39 Ensembl GRCm38 5 143,710,325 - 143,759,753 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 143,710,325 - 143,732,280 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 144,471,194 - 144,493,149 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 143,966,583 - 143,987,842 (-) NCBI MGSCv36 mm8 Celera 5 140,752,888 - 140,775,236 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 82.5 NCBI
USP42 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 11,512,164 - 11,568,825 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 59,836,873 - 59,893,529 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 7,283,212 - 7,339,854 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 6,301,881 - 6,357,763 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 6,307,329 - 6,357,763 (+) Ensembl panpan1.1 panPan2
USP42 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 11,504,491 - 11,554,720 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 11,508,685 - 11,557,185 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 13,108,684 - 13,180,539 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 11,483,126 - 11,555,275 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 11,505,058 - 11,555,271 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 11,359,785 - 11,431,771 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 11,339,096 - 11,411,004 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 11,565,774 - 11,637,658 (+) NCBI UU_Cfam_GSD_1.0
Usp42
USP42 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 5,006,241 - 5,048,282 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 5,002,406 - 5,048,327 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 5,091,988 - 5,128,036 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP42 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 15,292,782 - 15,366,029 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 15,314,782 - 15,363,986 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666102 717,775 - 774,863 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp42
.
Predicted Target Of
Count of predictions: 165 Count of miRNA genes: 135 Interacting mature miRNAs: 145 Transcripts: ENSRNOT00000001404 Prediction methods: Miranda Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1331739 Hrtrt14 Heart rate QTL 14 3.56232 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 12 9318216 12829686 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat
D5Ertd591e
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 10,839,452 - 10,839,665 (+) MAPPER mRatBN7.2 Rnor_6.0 12 12,876,875 - 12,877,087 NCBI Rnor6.0 Rnor_5.0 12 14,921,221 - 14,921,433 UniSTS Rnor5.0 RGSC_v3.4 12 11,168,736 - 11,168,948 UniSTS RGSC3.4 Celera 12 12,636,262 - 12,636,474 UniSTS Cytogenetic Map 12 p11 UniSTS
RH137516
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 15,949,505 - 15,950,427 (+) Marker Load Pipeline mRatBN7.2 12 10,835,861 - 10,836,783 (+) MAPPER mRatBN7.2 Rnor_6.0 12 12,873,284 - 12,874,205 NCBI Rnor6.0 Rnor_5.0 12 14,917,630 - 14,918,551 UniSTS Rnor5.0 RGSC_v3.4 12 11,165,145 - 11,166,066 UniSTS RGSC3.4 Celera 12 12,632,671 - 12,633,592 UniSTS Cytogenetic Map 12 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001404 ⟹ ENSRNOP00000001404
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 10,818,139 - 10,837,150 (+) Ensembl Rnor_6.0 Ensembl 12 12,859,661 - 12,877,495 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095083 ⟹ ENSRNOP00000093270
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 10,802,581 - 10,840,785 (+) Ensembl
RefSeq Acc Id:
NM_001105909 ⟹ NP_001099379
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 15,935,895 - 15,954,429 (+) NCBI mRatBN7.2 12 10,822,250 - 10,840,785 (+) NCBI Rnor_6.0 12 12,859,673 - 12,878,207 (+) NCBI Rnor_5.0 12 14,881,194 - 14,922,553 (+) NCBI RGSC_v3.4 12 11,151,534 - 11,170,068 (+) RGD Celera 12 12,619,047 - 12,637,594 (+) RGD
Sequence:
ATGACCATAGTTGACAAAACTGAACCTTCAGACCCATCAACCTGTCAGAACCAGCCTGGCAGTTCTGAGGCGGTCTCACCTGAAGACATGGACACAGGCTCTGCCAGCTGGGGTGCCGTGTCTTCCAT
hide sequence
RefSeq Acc Id:
XM_017598289 ⟹ XP_017453778
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 15,903,110 - 15,953,733 (+) NCBI mRatBN7.2 12 10,800,864 - 10,840,089 (+) NCBI Rnor_6.0 12 12,840,132 - 12,877,753 (+) NCBI
Sequence:
ACAAAGTGTCCTATGTTGGTTACAATACTGCATGAAAATGAGCGTATGCATGGGACATAGACAGGACAAAGAAAACACACCAAGGTTTCACACACAGTAAGTGAGCAGTACACAAACTGGGCAAGAGG
hide sequence
RefSeq Acc Id:
XM_063271139 ⟹ XP_063127209
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 15,916,753 - 15,953,733 (+) NCBI
RefSeq Acc Id:
NP_001099379 ⟸ NM_001105909
- UniProtKB:
D3ZU96 (UniProtKB/Swiss-Prot), A0A8L2UH81 (UniProtKB/TrEMBL)
- Sequence:
MTIVDKTEPSDPSTCQNQPGSSEAVSPEDMDTGSASWGAVSSISDVSNHTLSLGPVPGAVVYNNSSVPEKSKPSPPKDQVLGDGIAPPQKVLFPSEKICLKWQQSHRVGAGLQNLGNTCFANAALQCL
hide sequence
RefSeq Acc Id:
XP_017453778 ⟸ XM_017598289
- Peptide Label:
isoform X1
- UniProtKB:
D3ZU96 (UniProtKB/Swiss-Prot), A0A8L2UH81 (UniProtKB/TrEMBL)
- Sequence:
MTIVDKTEPSDPSTCQNQPGSSEAVSPEDMDTGSASWGAVSSISDVSNHTLSLGPVPGAVVYNN
hide sequence
Ensembl Acc Id:
ENSRNOP00000001404 ⟸ ENSRNOT00000001404
Ensembl Acc Id:
ENSRNOP00000093270 ⟸ ENSRNOT00000095083
RefSeq Acc Id:
XP_063127209 ⟸ XM_063271139
- Peptide Label:
isoform X1
- UniProtKB:
D3ZU96 (UniProtKB/Swiss-Prot), A0A8L2UH81 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Usp42
ubiquitin specific peptidase 42
Usp42_predicted
ubiquitin specific protease 42 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Usp42_predicted
ubiquitin specific protease 42 (predicted)
Symbol and Name status set to approved
70820 APPROVED
