Symbol:
Usp8
Name:
ubiquitin specific peptidase 8
RGD ID:
1304979
Description:
Predicted to enable K48-linked deubiquitinase activity; K63-linked deubiquitinase activity; and cysteine-type deubiquitinase activity. Involved in cellular response to dexamethasone stimulus; cellular response to nerve growth factor stimulus; and regulation of protein catabolic process at postsynapse, modulating synaptic transmission. Located in early endosome. Is active in glutamatergic synapse and postsynaptic density. Human ortholog(s) of this gene implicated in ACTH-secreting pituitary adenoma. Orthologous to human USP8 (ubiquitin specific peptidase 8); PARTICIPATES IN mitochondrial autophagy pathway; endocytosis pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC296121; ubiquitin carboxyl-terminal hydrolase 8; ubiquitin specific protease 8
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
USP8 (ubiquitin specific peptidase 8) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Usp8 (ubiquitin specific peptidase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Usp8 (ubiquitin specific peptidase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
USP8 (ubiquitin specific peptidase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
USP8 (ubiquitin specific peptidase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp8 (ubiquitin specific peptidase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
USP8 (ubiquitin specific peptidase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
USP8 (ubiquitin specific peptidase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Usp8 (ubiquitin specific peptidase 8) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
USP8 (ubiquitin specific peptidase 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Usp8 (ubiquitin specific peptidase 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp8 (ubiquitin specific peptidase 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
DOA4
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
usp-50
Alliance
DIOPT (OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
UBP5
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Usp8
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
usp8
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 134,413,832 - 134,463,040 (+) NCBI GRCr8 mRatBN7.2 3 113,962,136 - 114,009,683 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 113,962,164 - 114,009,666 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 117,845,850 - 117,893,311 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 126,441,377 - 126,488,837 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 124,101,758 - 124,149,218 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 119,173,818 - 119,222,499 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 119,173,818 - 119,222,484 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 125,699,400 - 125,747,055 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 114,237,065 - 114,284,543 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 114,103,490 - 114,189,451 (+) NCBI Celera 3 112,804,623 - 112,852,132 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp8 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of USP8 mRNA] CTD PMID:31150632 Usp8 Rat 1,2-dimethylhydrazine decreases expression ISO Usp8 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of USP8 mRNA CTD PMID:22206623 Usp8 Rat 17alpha-ethynylestradiol affects expression ISO Usp8 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of USP8 mRNA CTD PMID:17555576 Usp8 Rat 17beta-estradiol decreases expression ISO Usp8 (Mus musculus) 6480464 Estradiol results in decreased expression of USP8 mRNA CTD PMID:39298647 Usp8 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Usp8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of USP8 mRNA CTD PMID:21570461 Usp8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of USP8 mRNA CTD PMID:34747641 Usp8 Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of USP8 mRNA CTD PMID:23537331 Usp8 Rat 2-hydroxypropanoic acid decreases expression ISO USP8 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of USP8 mRNA CTD PMID:30851411 Usp8 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of USP8 protein CTD PMID:34915118 Usp8 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO USP8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of USP8 mRNA CTD PMID:28628672 Usp8 Rat Aroclor 1254 decreases expression ISO Usp8 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of USP8 mRNA CTD PMID:23650126 Usp8 Rat bafilomycin A1 multiple interactions ISO USP8 (Homo sapiens) 6480464 [Cysteine Proteinase Inhibitors results in decreased activity of USP8 protein] promotes the reaction [bafilomycin A1 results in increased cleavage of PARP1 protein] and bafilomycin A1 promotes the reaction [[Cysteine Proteinase Inhibitors results in decreased activity of USP8 protein] which results in increased cleavage of PARP1 protein] CTD PMID:35022897 Usp8 Rat benzo[a]pyrene increases expression ISO USP8 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of USP8 mRNA CTD PMID:17879257 Usp8 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Usp8 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of USP8 mRNA CTD PMID:33754040 Usp8 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP8 mRNA CTD PMID:25181051 more ... Usp8 Rat bisphenol A decreases expression ISO Usp8 (Mus musculus) 6480464 bisphenol A results in decreased expression of USP8 mRNA CTD PMID:33221593 Usp8 Rat bisphenol A affects methylation ISO Usp8 (Mus musculus) 6480464 bisphenol A affects the methylation of USP8 promoter CTD PMID:27334623 Usp8 Rat bisphenol F multiple interactions ISO USP8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of USP8 mRNA CTD PMID:28628672 Usp8 Rat caffeine decreases phosphorylation ISO USP8 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of USP8 protein CTD PMID:35688186 Usp8 Rat chloroquine multiple interactions ISO USP8 (Homo sapiens) 6480464 [Cysteine Proteinase Inhibitors results in decreased activity of USP8 protein] promotes the reaction [Chloroquine results in increased cleavage of PARP1 protein] and Chloroquine promotes the reaction [[Cysteine Proteinase Inhibitors results in decreased activity of USP8 protein] which results in increased cleavage of PARP1 protein] CTD PMID:35022897 Usp8 Rat choline multiple interactions ISO Usp8 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of USP8 gene CTD PMID:20938992 Usp8 Rat coumarin increases phosphorylation ISO USP8 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of USP8 protein CTD PMID:35688186 Usp8 Rat dexamethasone multiple interactions ISO USP8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of USP8 mRNA CTD PMID:28628672 Usp8 Rat Dibutyl phosphate affects expression ISO USP8 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of USP8 mRNA CTD PMID:37042841 Usp8 Rat dicrotophos decreases expression ISO USP8 (Homo sapiens) 6480464 dicrotophos results in decreased expression of USP8 mRNA CTD PMID:28302478 Usp8 Rat doxorubicin decreases expression ISO USP8 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of USP8 mRNA CTD PMID:29803840 Usp8 Rat ethanol affects splicing ISO Usp8 (Mus musculus) 6480464 Ethanol affects the splicing of USP8 mRNA CTD PMID:30319688 Usp8 Rat folic acid multiple interactions ISO Usp8 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of USP8 gene CTD PMID:20938992 Usp8 Rat FR900359 affects phosphorylation ISO USP8 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of USP8 protein CTD PMID:37730182 Usp8 Rat indometacin multiple interactions ISO USP8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of USP8 mRNA CTD PMID:28628672 Usp8 Rat L-methionine multiple interactions ISO Usp8 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of USP8 gene CTD PMID:20938992 Usp8 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of USP8 mRNA CTD PMID:30467583 Usp8 Rat methyl methanesulfonate increases expression ISO USP8 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of USP8 mRNA CTD PMID:23649840 Usp8 Rat nonanoic acid increases expression ISO Usp8 (Mus musculus) 6480464 pelargonic acid results in increased expression of USP8 mRNA CTD PMID:11379042 Usp8 Rat paracetamol affects expression ISO Usp8 (Mus musculus) 6480464 Acetaminophen affects the expression of USP8 mRNA CTD PMID:17562736 Usp8 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of USP8 mRNA CTD PMID:33387578 Usp8 Rat pifithrin-alpha hydrobromide multiple interactions ISO USP8 (Homo sapiens) 6480464 pifithrin inhibits the reaction [[Cysteine Proteinase Inhibitors results in decreased activity of USP8 protein] which results in increased cleavage of PARP1 protein] more ... CTD PMID:35022897 Usp8 Rat rac-lactic acid decreases expression ISO USP8 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of USP8 mRNA CTD PMID:30851411 Usp8 Rat raloxifene decreases expression ISO Usp8 (Mus musculus) 6480464 Raloxifene Hydrochloride results in decreased expression of USP8 mRNA CTD PMID:33269387 Usp8 Rat resveratrol multiple interactions ISO USP8 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of USP8 mRNA CTD PMID:23557933 Usp8 Rat sodium arsenate decreases expression ISO Usp8 (Mus musculus) 6480464 sodium arsenate results in decreased expression of USP8 mRNA CTD PMID:21795629 Usp8 Rat sodium arsenate increases expression ISO Usp8 (Mus musculus) 6480464 sodium arsenate results in increased expression of USP8 mRNA CTD PMID:21795629 Usp8 Rat sodium arsenite increases expression ISO USP8 (Homo sapiens) 6480464 sodium arsenite results in increased expression of USP8 mRNA CTD PMID:12016162 and PMID:38568856 Usp8 Rat tamoxifen affects expression ISO Usp8 (Mus musculus) 6480464 Tamoxifen affects the expression of USP8 mRNA CTD PMID:17555576 Usp8 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of USP8 mRNA CTD PMID:31150632 Usp8 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of USP8 mRNA] CTD PMID:31150632 Usp8 Rat titanium dioxide decreases methylation ISO Usp8 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP8 gene CTD PMID:35295148 Usp8 Rat toluene 2,4-diisocyanate decreases expression ISO Usp8 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in decreased expression of USP8 mRNA CTD PMID:11379042 Usp8 Rat triptonide decreases expression ISO Usp8 (Mus musculus) 6480464 triptonide results in decreased expression of USP8 mRNA CTD PMID:33045310 Usp8 Rat tungsten decreases expression ISO Usp8 (Mus musculus) 6480464 Tungsten results in decreased expression of USP8 mRNA CTD PMID:30912803 Usp8 Rat valproic acid affects expression ISO USP8 (Homo sapiens) 6480464 Valproic Acid affects the expression of USP8 mRNA CTD PMID:25979313
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) Aroclor 1254 (ISO) bafilomycin A1 (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) caffeine (ISO) chloroquine (ISO) choline (ISO) coumarin (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) doxorubicin (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) indometacin (ISO) L-methionine (ISO) methapyrilene (EXP) methyl methanesulfonate (ISO) nonanoic acid (ISO) paracetamol (EXP,ISO) pifithrin-alpha hydrobromide (ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (ISO) sodium arsenate (ISO) sodium arsenite (ISO) tamoxifen (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO)
Biological Process
cellular response to dexamethasone stimulus (IEP) cellular response to nerve growth factor stimulus (IDA) endosome organization (IBA,IEA,ISO) mitotic cytokinesis (IEA,ISO) negative regulation of lysosomal protein catabolic process (IEA,ISO) positive regulation of amyloid fibril formation (IEA,ISO) positive regulation of canonical Wnt signaling pathway (IEA,ISO) protein deubiquitination (IEA,ISO) protein K48-linked deubiquitination (IEA,ISO) protein K63-linked deubiquitination (IEA,ISO) proteolysis (IEA) Ras protein signal transduction (IBA,IEA,ISO) regulation of protein catabolic process at postsynapse, modulating synaptic transmission (IDA,IEP,IMP) regulation of protein localization (IEA,ISO) regulation of protein stability (IEA,ISO)
Cellular Component
acrosomal membrane (IEA,ISO) cytoplasm (IEA,ISO) cytosol (IBA,IEA,ISO) early endosome (IDA,IEA,ISO) endosome membrane (IEA,ISO) glutamatergic synapse (IDA,IEP,IMP) midbody (IBA,IEA,ISO) postsynaptic density (IBA,IDA,IEP)
1.
The deubiquitinating enzyme UBPy/USP8 interacts with TrkA and inhibits neuronal differentiation in PC12 cells.
Ceriani M, etal., Exp Cell Res. 2015 Apr 10;333(1):49-59. doi: 10.1016/j.yexcr.2015.01.019. Epub 2015 Feb 4.
2.
The three 'P's of mitophagy: PARKIN, PINK1, and post-translational modifications.
Durcan TM and Fon EA, Genes Dev. 2015 May 15;29(10):989-99. doi: 10.1101/gad.262758.115.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Comprehensive gene review and curation
RGD comprehensive gene curation
10.
Synaptic strength is bidirectionally controlled by opposing activity-dependent regulation of Nedd4-1 and USP8.
Scudder SL, etal., J Neurosci. 2014 Dec 10;34(50):16637-49. doi: 10.1523/JNEUROSCI.2452-14.2014.
11.
Dexamethasone regulates expression of BRUCE/Apollon and the proliferation of neural progenitor cells.
Sippel M, etal., FEBS Lett. 2009 Jul 7;583(13):2213-7. doi: 10.1016/j.febslet.2009.06.018. Epub 2009 Jun 13.
Usp8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 134,413,832 - 134,463,040 (+) NCBI GRCr8 mRatBN7.2 3 113,962,136 - 114,009,683 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 113,962,164 - 114,009,666 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 117,845,850 - 117,893,311 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 126,441,377 - 126,488,837 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 124,101,758 - 124,149,218 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 119,173,818 - 119,222,499 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 119,173,818 - 119,222,484 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 125,699,400 - 125,747,055 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 114,237,065 - 114,284,543 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 114,103,490 - 114,189,451 (+) NCBI Celera 3 112,804,623 - 112,852,132 (+) NCBI Celera Cytogenetic Map 3 q36 NCBI
USP8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 50,424,405 - 50,514,421 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 50,424,380 - 50,514,421 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 50,716,602 - 50,806,618 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 48,503,871 - 48,579,265 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 48,503,870 - 48,579,263 NCBI Celera 15 27,609,144 - 27,685,855 (+) NCBI Celera Cytogenetic Map 15 q21.2 NCBI HuRef 15 27,547,372 - 27,623,683 (+) NCBI HuRef CHM1_1 15 50,834,671 - 50,911,286 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 48,232,513 - 48,322,500 (+) NCBI T2T-CHM13v2.0
Usp8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 126,549,280 - 126,601,234 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 126,549,248 - 126,601,217 (+) Ensembl GRCm39 Ensembl GRCm38 2 126,707,201 - 126,759,314 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 126,707,328 - 126,759,297 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 126,533,099 - 126,585,033 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 126,398,804 - 126,450,738 (+) NCBI MGSCv36 mm8 Celera 2 127,946,958 - 127,999,152 (+) NCBI Celera Cytogenetic Map 2 F1 NCBI cM Map 2 61.76 NCBI
Usp8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 3,840,007 - 3,891,284 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 3,839,308 - 3,903,595 (-) NCBI ChiLan1.0 ChiLan1.0
USP8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 39,669,333 - 39,746,278 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 43,850,502 - 43,939,848 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 29,374,945 - 29,451,235 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 47,699,282 - 47,790,624 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 47,713,997 - 47,790,624 (+) Ensembl panpan1.1 panPan2
USP8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 16,341,970 - 16,408,246 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 16,342,009 - 16,408,012 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 16,268,046 - 16,334,339 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 16,485,884 - 16,552,179 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 16,485,928 - 16,552,172 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 16,408,382 - 16,474,666 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 16,525,850 - 16,592,342 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 16,632,281 - 16,698,545 (+) NCBI UU_Cfam_GSD_1.0
Usp8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 94,615,145 - 94,673,337 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 12,463,120 - 12,520,674 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 12,463,189 - 12,524,148 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP8 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 121,306,032 - 121,413,223 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 121,306,031 - 121,376,154 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 134,747,956 - 134,815,830 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 32,829,627 - 32,906,493 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 32,829,523 - 32,866,073 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 108,247,584 - 108,324,662 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp8
.
Predicted Target Of
Count of predictions: 410 Count of miRNA genes: 215 Interacting mature miRNAs: 253 Transcripts: ENSRNOT00000015124 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 1582216 Bw65 Body weight QTL 65 6.3 body mass (VT:0001259) body weight (CMO:0000012) 3 102200529 115665732 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582219 Bw63 Body weight QTL 63 3.8 0.001 body mass (VT:0001259) body weight (CMO:0000012) 3 96127817 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 2302273 Gluco35 Glucose level QTL 35 5.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 80800231 114297550 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
RH139756
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 113,962,427 - 113,962,613 (+) MAPPER mRatBN7.2 Rnor_6.0 3 119,174,087 - 119,174,272 NCBI Rnor6.0 Rnor_5.0 3 125,699,669 - 125,699,854 UniSTS Rnor5.0 RGSC_v3.4 3 114,237,334 - 114,237,519 UniSTS RGSC3.4 Celera 3 112,804,892 - 112,805,077 UniSTS RH 3.4 Map 3 988.5 UniSTS Cytogenetic Map 3 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015124 ⟹ ENSRNOP00000015124
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 113,962,164 - 114,009,665 (+) Ensembl Rnor_6.0 Ensembl 3 119,173,818 - 119,222,484 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000120063 ⟹ ENSRNOP00000086524
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 113,962,164 - 114,009,666 (+) Ensembl
RefSeq Acc Id:
NM_001106502 ⟹ NP_001099972
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 134,415,526 - 134,463,025 (+) NCBI mRatBN7.2 3 113,962,159 - 114,009,661 (+) NCBI Rnor_6.0 3 119,173,818 - 119,222,484 (+) NCBI Rnor_5.0 3 125,699,400 - 125,747,055 (+) NCBI RGSC_v3.4 3 114,237,065 - 114,284,543 (+) RGD Celera 3 112,804,623 - 112,852,132 (+) RGD
Sequence:
CCGTCGCACGCAATGCGAATCGGGAAGAGGGGATGATCTGCGCTGCTTTGCGTCTGAGAACGGAGGCTCGTTCTCCTTCTGGTGGTGGGCGATGGGCGTCAGGCGAGAAGGCCGGCGTTAGCGGAGCG
hide sequence
RefSeq Acc Id:
XM_006234916 ⟹ XP_006234978
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 134,413,832 - 134,463,040 (+) NCBI mRatBN7.2 3 113,962,140 - 114,009,683 (+) NCBI Rnor_6.0 3 119,173,823 - 119,222,499 (+) NCBI Rnor_5.0 3 125,699,400 - 125,747,055 (+) NCBI
Sequence:
GCACGCAATGCGAATCGGGAAGAGGGGATGATCTGCGCTGCTTTGCGTCTGAGAACGGAGGCTCGTTCTCCTTCTGGTGGTGGGCGATGGGCGTCAGGCGAGAAGGCCGGCGTTAGCGGAGCGCGGGC
hide sequence
RefSeq Acc Id:
XM_063283328 ⟹ XP_063139398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 134,413,832 - 134,456,180 (+) NCBI
RefSeq Acc Id:
NP_001099972 ⟸ NM_001106502
- UniProtKB:
D3ZN39 (UniProtKB/TrEMBL), A6HPZ0 (UniProtKB/TrEMBL), A0A8I6A1E0 (UniProtKB/TrEMBL)
- Sequence:
MPAVASVPKELYLSSSLKDLNKKTEVKPEKTSTKNYIHSAQKIFKAAEECRLDRDEERAYVLYMKYVAVYNLIKKRPDFKQQQDYYLSILGPANIKKAIEEAERLSESLKLRYEEAEVRKQLEEKDRR
hide sequence
RefSeq Acc Id:
XP_006234978 ⟸ XM_006234916
- Peptide Label:
isoform X1
- Sequence:
MPAVASVPKELYLSSSLKDLNKKTEVKPEKTSTKNYIHSAQKIFKAAEECRLDRDEERAYVLYM
hide sequence
Ensembl Acc Id:
ENSRNOP00000015124 ⟸ ENSRNOT00000015124
Ensembl Acc Id:
ENSRNOP00000086524 ⟸ ENSRNOT00000120063
RefSeq Acc Id:
XP_063139398 ⟸ XM_063283328
- Peptide Label:
isoform X2
RGD ID: 13692391 Promoter ID: EPDNEW_R2916 Type: initiation region Name: Usp8_1 Description: ubiquitin specific peptidase 8 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 119,173,852 - 119,173,912 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Usp8
ubiquitin specific peptidase 8
Usp8_predicted
ubiquitin specific protease 8 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Usp8_predicted
ubiquitin specific protease 8 (predicted)
Symbol and Name status set to approved
70820 APPROVED
