Symbol:
Actg1 (Ensembl: Actg1l1)
Name:
actin, gamma 1 (Ensembl:actin, gamma 1 like 1)
RGD ID:
1304556
Description:
A structural constituent of postsynaptic actin cytoskeleton. Involved in response to calcium ion and response to mechanical stimulus. Is active in postsynaptic actin cytoskeleton and presynaptic actin cytoskeleton. Human ortholog(s) of this gene implicated in Baraitser-Winter syndrome 2 and autosomal dominant nonsyndromic deafness 20. Orthologous to human ACTG1 (actin gamma 1); PARTICIPATES IN auditory mechanotransduction pathway; arrhythmogenic right ventricular cardiomyopathy pathway; dilated cardiomyopathy pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Actg; actin, cytoplasmic 2; actin, gamma, cytoplasmic; actin, gamma, cytoplasmic 1; gamma-actin; LOC287876
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACTG1 (actin gamma 1)
HGNC
Ensembl, HomoloGene, NCBI, OMA, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):
Actg1 (actin, gamma, cytoplasmic 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Actg1 (actin gamma 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACTG1 (actin gamma 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACTG1 (actin gamma 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Actg1 (actin gamma 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACTG1 (actin gamma 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACTG1 (actin gamma 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Actg1 (actin gamma 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ACTB (actin beta)
HGNC
OrthoDB, Panther
Homo sapiens (human):
ACTBL2 (actin beta like 2)
HGNC
OrthoDB
Homo sapiens (human):
POTEE (POTE ankyrin domain family member E)
HGNC
Panther
Homo sapiens (human):
POTEKP (POTE ankyrin domain family member K, pseudogene)
HGNC
Panther
Homo sapiens (human):
POTEF (POTE ankyrin domain family member F)
HGNC
Panther
Homo sapiens (human):
POTEJ (POTE ankyrin domain family member J)
HGNC
Panther
Homo sapiens (human):
POTEI (POTE ankyrin domain family member I)
HGNC
Panther
Alliance orthologs 3
Homo sapiens (human):
ACTG1 (actin gamma 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Actg1 (actin, gamma, cytoplasmic 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
actb1 (actin, beta 1)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB)
Danio rerio (zebrafish):
actb2 (actin, beta 2)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
ACT1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
act-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Act42A
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Act57B
Alliance
DIOPT (Hieranoid|OrthoFinder|PhylomeDB)
Drosophila melanogaster (fruit fly):
Act5C
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Act87E
Alliance
DIOPT (Hieranoid|OrthoFinder|PhylomeDB)
Caenorhabditis elegans (roundworm):
act-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
act-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Caenorhabditis elegans (roundworm):
act-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
actg1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,118,106 - 106,120,951 (-) NCBI GRCr8 mRatBN7.2 10 105,619,738 - 105,622,587 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 72,977,767 - 72,979,694 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 10 105,619,737 - 105,624,232 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 110,724,157 - 110,726,999 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,187,175 - 110,190,017 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 105,540,227 - 105,543,072 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 109,518,429 - 109,521,288 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 75,643,054 - 75,644,954 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 109,519,134 - 109,520,846 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,113,705 - 109,116,103 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 109,773,489 - 109,776,334 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 109,787,992 - 109,790,826 (-) NCBI Celera 10 104,164,981 - 104,167,826 (-) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Actg1 Rat autosomal dominant nonsyndromic deafness 20 ISO RGD:1312061 8554872 ClinVar Annotator: match by term: ACTG1-related disorder | ClinVar Annotator: match by term: Deafness, autosomal more ... ClinVar PMID:12519370|PMID:13680526|PMID:14684684|PMID:16773128|PMID:17576681|PMID:18414213|PMID:19419963|PMID:19477959|PMID:19548389|PMID:20301607|PMID:22200607|PMID:22366783|PMID:23506231|PMID:24033266|PMID:25052316|PMID:25741868|PMID:25792668|PMID:26188271|PMID:26467025|PMID:27240540|PMID:28000701|PMID:28492532|PMID:29196752|PMID:29357087|PMID:29620237|PMID:29671837|PMID:29907799|PMID:29986705|PMID:30008475|PMID:30311386|PMID:30622556|PMID:31116477|PMID:31231230|PMID:32028042|PMID:32341388|PMID:33584783|PMID:33604570|PMID:34440452|PMID:34448047|PMID:35710456|PMID:35802133|PMID:36194208|PMID:36633841|PMID:5654493|PMID:9536098 Actg1 Rat Baraitser-Winter syndrome ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Baraitser-Winter syndrome ClinVar PMID:31231230|PMID:32028042 Actg1 Rat Baraitser-Winter syndrome 1 ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Baraitser-Winter syndrome 1 | ClinVar Annotator: match by term: CEREBROOCULOFACIAL more ... ClinVar PMID:25741868|PMID:31231230|PMID:32028042 Actg1 Rat Baraitser-Winter syndrome 2 ISO RGD:1312061 8554872 ClinVar Annotator: match by term: ACTG1-related condition | ClinVar Annotator: match by term: Baraitser-Winter Syndrome more ... ClinVar PMID:13680526|PMID:14684684|PMID:16773128|PMID:17576681|PMID:18414213|PMID:19419963|PMID:19477959|PMID:19548389|PMID:20301607|PMID:22366783|PMID:23506231|PMID:24033266|PMID:25052316|PMID:25741868|PMID:25792668|PMID:26188271|PMID:26467025|PMID:27240540|PMID:27625340|PMID:28000701|PMID:28492532|PMID:29196752|PMID:29357087|PMID:29620237|PMID:29671837|PMID:29758562|PMID:29986705|PMID:30008475|PMID:30143558|PMID:30311386|PMID:30622556|PMID:31116477|PMID:32341388|PMID:3351890|PMID:33584783|PMID:33604570|PMID:34440452|PMID:34448047|PMID:35710456|PMID:36194208|PMID:9536098 Actg1 Rat CAKUT ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Congenital anomalies of the kidney and urinary tract ClinVar PMID:13680526|PMID:18414213|PMID:22366783|PMID:25052316|PMID:26188271|PMID:27625340|PMID:30143558|PMID:3351890 Actg1 Rat genetic disease ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:13680526|PMID:16773128|PMID:18414213|PMID:22366783|PMID:24033266|PMID:25052316|PMID:25741868|PMID:26188271|PMID:27240540|PMID:27625340|PMID:28492532|PMID:30143558|PMID:3351890 Actg1 Rat Hearing Loss ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Hearing impairment ClinVar PMID:19477959|PMID:20301607|PMID:24033266|PMID:25741868|PMID:25792668|PMID:28492532|PMID:30311386 Actg1 Rat intellectual disability ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Intellectual disability ClinVar PMID:25741868|PMID:28492532 Actg1 Rat lissencephaly ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Lissencephaly ClinVar PMID:22366783|PMID:25741868|PMID:27240540|PMID:28492532|PMID:29671837 Actg1 Rat microcephaly ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Microcephaly ClinVar PMID:25741868 Actg1 Rat nonsyndromic deafness ISO RGD:1312061 8554872 ClinVar Annotator: match by term: Non-syndromic genetic deafness ClinVar PMID:13680526|PMID:19477959|PMID:30311386
Only show annotations with direct experimental evidence (0 objects hidden)
Actg1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ACTG1 mRNA] CTD PMID:31150632 Actg1 Rat 1,2-dichloroethane increases expression ISO RGD:1549970 6480464 ethylene dichloride results in increased expression of ACTG1 mRNA CTD PMID:28189721|PMID:28960355 Actg1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1549970 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of ACTG1 mRNA] CTD PMID:22206623 Actg1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1549970 6480464 1,2-Dimethylhydrazine results in increased expression of ACTG1 mRNA CTD PMID:22206623 Actg1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ACTG1 mRNA CTD PMID:30723492 Actg1 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1549970 6480464 Ethinyl Estradiol results in increased expression of ACTG1 mRNA CTD PMID:14976129 Actg1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ACTG1 mRNA CTD PMID:12082028 Actg1 Rat 17beta-estradiol multiple interactions ISO RGD:1312061 6480464 3,3'-diindolylmethane promotes the reaction [Estradiol results in decreased expression of ACTG1 mRNA]; Tetrachlorodibenzodioxin promotes the more ... CTD PMID:11179685 Actg1 Rat 17beta-estradiol increases expression ISO RGD:1549970 6480464 Estradiol results in increased expression of ACTG1 mRNA CTD PMID:39298647 Actg1 Rat 17beta-estradiol decreases expression ISO RGD:1312061 6480464 Estradiol results in decreased expression of ACTG1 mRNA CTD PMID:11179685 Actg1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO RGD:1312061 6480464 Metribolone results in increased expression of ACTG1 protein CTD PMID:17152098 Actg1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1549970 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of ACTG1 mRNA CTD PMID:30294300 Actg1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1549970 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of ACTG1 mRNA CTD PMID:31388691 Actg1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1312061 6480464 Tetrachlorodibenzodioxin promotes the reaction [Estradiol results in decreased expression of ACTG1 mRNA] CTD PMID:11179685 Actg1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ACTG1 mRNA CTD PMID:34747641 Actg1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ACTG1 protein CTD PMID:19201780 Actg1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACTG1 mRNA; Tetrachlorodibenzodioxin results in decreased expression of ACTG1 more ... CTD PMID:16054898|PMID:16548065|PMID:33387578 Actg1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1549970 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of ACTG1 mRNA CTD PMID:38648751 Actg1 Rat 2,6-di-tert-butyl-4-methylphenol increases expression EXP 6480464 Butylated Hydroxytoluene results in increased expression of ACTG1 mRNA CTD PMID:12082028 Actg1 Rat 2-hydroxypropanoic acid increases expression ISO RGD:1312061 6480464 Lactic Acid results in increased expression of ACTG1 mRNA CTD PMID:30851411 Actg1 Rat 2-methylcholine affects expression ISO RGD:1312061 6480464 beta-methylcholine affects the expression of ACTG1 mRNA CTD PMID:21179406 Actg1 Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine decreases expression EXP 6480464 Puromycin Aminonucleoside results in decreased expression of ACTG1 protein CTD PMID:19264907 Actg1 Rat 3,3'-diindolylmethane multiple interactions ISO RGD:1312061 6480464 3,3'-diindolylmethane promotes the reaction [Estradiol results in decreased expression of ACTG1 mRNA] CTD PMID:11179685 Actg1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1549970 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of ACTG1 mRNA CTD PMID:20188158 Actg1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1549970 6480464 bisphenol S results in increased expression of ACTG1 mRNA CTD PMID:39298647 Actg1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ACTG1 mRNA CTD PMID:24780913|PMID:30047161|PMID:36843608 Actg1 Rat acrolein multiple interactions ISO RGD:1312061 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Actg1 Rat acrylamide decreases expression ISO RGD:1312061 6480464 Acrylamide results in decreased expression of ACTG1 mRNA CTD PMID:32763439 Actg1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ACTG1 mRNA CTD PMID:33354967 Actg1 Rat aldehydo-D-glucose multiple interactions EXP 6480464 ACTG1 protein results in decreased susceptibility to [Oxygen deficiency co-treated with Glucose deficiency] CTD PMID:21124846 Actg1 Rat all-trans-retinoic acid affects expression ISO RGD:1549970 6480464 Tretinoin affects the expression of ACTG1 protein CTD PMID:15789344 Actg1 Rat all-trans-retinoic acid decreases expression ISO RGD:1312061 6480464 Tretinoin results in decreased expression of ACTG1 mRNA CTD PMID:23724009 Actg1 Rat alpha-pinene multiple interactions ISO RGD:1312061 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Actg1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ACTG1 mRNA CTD PMID:30047161 Actg1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ACTG1 mRNA CTD PMID:30779732 Actg1 Rat arsenite(3-) multiple interactions ISO RGD:1312061 6480464 [sodium arsenite results in increased abundance of arsenite] which results in decreased expression of ACTG1 more ... CTD PMID:32076005 Actg1 Rat arsenous acid decreases expression ISO RGD:1312061 6480464 Arsenic Trioxide results in decreased expression of ACTG1 mRNA CTD PMID:20458559 Actg1 Rat benzo[a]pyrene decreases expression ISO RGD:1312061 6480464 Benzo(a)pyrene results in decreased expression of ACTG1 mRNA CTD PMID:20064835 Actg1 Rat benzo[a]pyrene increases methylation ISO RGD:1312061 6480464 Benzo(a)pyrene results in increased methylation of ACTG1 3' UTR CTD PMID:27901495 Actg1 Rat Benzo[k]fluoranthene decreases expression ISO RGD:1549970 6480464 benzo(k)fluoranthene results in decreased expression of ACTG1 mRNA CTD PMID:26377693 Actg1 Rat beta-lapachone decreases expression ISO RGD:1312061 6480464 beta-lapachone results in decreased expression of ACTG1 mRNA CTD PMID:38218311 Actg1 Rat beta-lapachone increases expression ISO RGD:1312061 6480464 beta-lapachone results in increased expression of ACTG1 mRNA CTD PMID:38218311 Actg1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of ACTG1 mRNA CTD PMID:16648578 Actg1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1549970 6480464 Diethylhexyl Phthalate results in increased expression of ACTG1 mRNA CTD PMID:19850644 Actg1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1549970 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased expression of ACTG1 more ... CTD PMID:19850644|PMID:38730545 Actg1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACTG1 mRNA CTD PMID:25181051 Actg1 Rat bisphenol A increases expression ISO RGD:1312061 6480464 bisphenol A results in increased expression of ACTG1 protein CTD PMID:37567409 Actg1 Rat bisphenol A increases expression ISO RGD:1549970 6480464 bisphenol A results in increased expression of ACTG1 mRNA CTD PMID:35479511 Actg1 Rat bisphenol A decreases expression ISO RGD:1312061 6480464 bisphenol A results in decreased expression of ACTG1 protein CTD PMID:31675489 Actg1 Rat bisphenol A decreases expression ISO RGD:1549970 6480464 bisphenol A results in decreased expression of ACTG1 mRNA CTD PMID:33221593 Actg1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACTG1 mRNA CTD PMID:30903817 Actg1 Rat bisphenol A affects expression ISO RGD:1312061 6480464 bisphenol A affects the expression of ACTG1 mRNA CTD PMID:30903817 Actg1 Rat bisphenol F increases expression ISO RGD:1549970 6480464 bisphenol F results in increased expression of ACTG1 mRNA CTD PMID:38685157 Actg1 Rat bleomycin A2 increases expression ISO RGD:1549970 6480464 Bleomycin results in increased expression of ACTG1 mRNA CTD PMID:36087614 Actg1 Rat bufalin increases expression ISO RGD:1312061 6480464 bufalin results in increased expression of ACTG1 protein CTD PMID:23091618 Actg1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of ACTG1 mRNA CTD PMID:24136188 Actg1 Rat cadmium dichloride increases expression ISO RGD:1312061 6480464 Cadmium Chloride results in increased expression of ACTG1 mRNA CTD PMID:38568856 Actg1 Rat carbon nanotube decreases expression ISO RGD:1549970 6480464 Nanotubes, Carbon results in decreased expression of ACTG1 mRNA CTD PMID:25620056 Actg1 Rat carbon nanotube increases expression ISO RGD:1549970 6480464 Nanotubes, Carbon analog results in increased expression of ACTG1 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Actg1 Rat chromium(6+) multiple interactions ISO RGD:1312061 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ... CTD PMID:38479592 Actg1 Rat cisplatin multiple interactions ISO RGD:1312061 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ACTG1 mRNA CTD PMID:27392435 Actg1 Rat cisplatin decreases expression ISO RGD:1312061 6480464 Cisplatin results in decreased expression of ACTG1 mRNA CTD PMID:27392435 Actg1 Rat clobetasol increases expression ISO RGD:1549970 6480464 Clobetasol results in increased expression of ACTG1 mRNA CTD PMID:27462272 Actg1 Rat clofibrate multiple interactions ISO RGD:1549970 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ACTG1 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Actg1 Rat copper atom affects binding ISO RGD:1312061 6480464 ACTG1 protein binds to Copper CTD PMID:15359738 Actg1 Rat copper atom multiple interactions ISO RGD:1312061 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ACTG1 mRNA CTD PMID:30911355 Actg1 Rat copper(0) affects binding ISO RGD:1312061 6480464 ACTG1 protein binds to Copper CTD PMID:15359738 Actg1 Rat copper(0) multiple interactions ISO RGD:1312061 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ACTG1 mRNA CTD PMID:30911355 Actg1 Rat copper(II) sulfate increases expression ISO RGD:1312061 6480464 Copper Sulfate results in increased expression of ACTG1 mRNA CTD PMID:19549813 Actg1 Rat cyclosporin A increases expression ISO RGD:1312061 6480464 Cyclosporine results in increased expression of ACTG1 mRNA CTD PMID:25562108 Actg1 Rat cytochalasin D multiple interactions ISO RGD:1312061 6480464 Cytochalasin D inhibits the reaction [UPF1 protein binds to ACTG1 protein]; Cytochalasin D inhibits the more ... CTD PMID:28743738 Actg1 Rat D-glucose multiple interactions EXP 6480464 ACTG1 protein results in decreased susceptibility to [Oxygen deficiency co-treated with Glucose deficiency] CTD PMID:21124846 Actg1 Rat DDE increases expression ISO RGD:1312061 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of ACTG1 mRNA CTD PMID:38568856 Actg1 Rat diallyl trisulfide decreases expression ISO RGD:1312061 6480464 diallyl trisulfide results in decreased expression of ACTG1 protein CTD PMID:19550292 Actg1 Rat diarsenic trioxide decreases expression ISO RGD:1312061 6480464 Arsenic Trioxide results in decreased expression of ACTG1 mRNA CTD PMID:20458559 Actg1 Rat Dibutyl phosphate affects expression ISO RGD:1312061 6480464 di-n-butylphosphoric acid affects the expression of ACTG1 mRNA CTD PMID:37042841 Actg1 Rat dibutyl phthalate increases expression ISO RGD:1549970 6480464 Dibutyl Phthalate results in increased expression of ACTG1 mRNA CTD PMID:17361019|PMID:21266533 Actg1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ACTG1 mRNA CTD PMID:21266533 Actg1 Rat dichloroacetic acid increases expression ISO RGD:1549970 6480464 Dichloroacetic Acid results in increased expression of ACTG1 mRNA CTD PMID:28962523 Actg1 Rat dicrotophos increases expression ISO RGD:1312061 6480464 dicrotophos results in increased expression of ACTG1 mRNA CTD PMID:28302478 Actg1 Rat dihydroartemisinin affects binding ISO RGD:1312061 6480464 artenimol analog binds to ACTG1 protein CTD PMID:26340163 Actg1 Rat dioxygen multiple interactions EXP 6480464 ACTG1 protein results in decreased susceptibility to [Oxygen deficiency co-treated with Glucose deficiency] CTD PMID:21124846 Actg1 Rat diuron decreases expression ISO RGD:1312061 6480464 Diuron results in decreased expression of ACTG1 mRNA CTD PMID:35967413 Actg1 Rat dopamine increases expression EXP 6480464 Dopamine results in increased expression of ACTG1 mRNA CTD PMID:21983523 Actg1 Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of ACTG1 protein CTD PMID:28818578 Actg1 Rat doxorubicin increases expression ISO RGD:1312061 6480464 Doxorubicin results in increased expression of ACTG1 mRNA CTD PMID:29803840 Actg1 Rat elemental selenium increases expression ISO RGD:1312061 6480464 Selenium results in increased expression of ACTG1 mRNA CTD PMID:19244175 Actg1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ACTG1 mRNA CTD PMID:31464424 Actg1 Rat enzyme inhibitor multiple interactions ISO RGD:1312061 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Actg1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of ACTG1 protein CTD PMID:23702218 Actg1 Rat ethanol multiple interactions ISO RGD:1549970 6480464 Ethanol affects the expression of and affects the splicing of ACTG1 mRNA CTD PMID:30319688 Actg1 Rat ethanol affects expression ISO RGD:1549970 6480464 Ethanol affects the expression of ACTG1 mRNA CTD PMID:30319688 Actg1 Rat Evodiamine increases expression ISO RGD:1312061 6480464 evodiamine results in increased expression of ACTG1 mRNA CTD PMID:32057900 Actg1 Rat fenoldopam increases expression EXP 6480464 Fenoldopam results in increased expression of ACTG1 mRNA CTD PMID:21983523 Actg1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ACTG1 mRNA CTD PMID:24136188 Actg1 Rat folic acid multiple interactions ISO RGD:1549970 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of ACTG1 mRNA] CTD PMID:22206623 Actg1 Rat formaldehyde increases expression ISO RGD:1312061 6480464 Formaldehyde results in increased expression of ACTG1 mRNA CTD PMID:18045764 Actg1 Rat fumonisin B1 increases expression ISO RGD:1549970 6480464 fumonisin B1 results in increased expression of ACTG1 mRNA CTD PMID:16221962 Actg1 Rat genistein decreases expression ISO RGD:1312061 6480464 Genistein results in decreased expression of ACTG1 mRNA CTD PMID:22228119 Actg1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ACTG1 mRNA CTD PMID:22061828 Actg1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of ACTG1 mRNA CTD PMID:24136188 Actg1 Rat glucose multiple interactions EXP 6480464 ACTG1 protein results in decreased susceptibility to [Oxygen deficiency co-treated with Glucose deficiency] CTD PMID:21124846 Actg1 Rat GW 4064 multiple interactions ISO RGD:1549970 6480464 GW 4064 promotes the reaction [NR1H4 protein binds to ACTG1 gene] CTD PMID:20091679 Actg1 Rat ivermectin decreases expression ISO RGD:1312061 6480464 Ivermectin results in decreased expression of ACTG1 protein CTD PMID:32959892 Actg1 Rat jaspamide multiple interactions ISO RGD:1312061 6480464 jasplakinolide inhibits the reaction [UPF1 protein binds to ACTG1 protein]; jasplakinolide inhibits the reaction [UPF2 more ... CTD PMID:28743738 Actg1 Rat leflunomide increases expression ISO RGD:1312061 6480464 leflunomide results in increased expression of ACTG1 mRNA CTD PMID:28988120 Actg1 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of ACTG1 mRNA CTD PMID:24136188 Actg1 Rat mancozeb increases expression ISO RGD:1549970 6480464 mancozeb results in increased expression of ACTG1 protein CTD PMID:21375462 Actg1 Rat metacetamol increases expression ISO RGD:1549970 6480464 3-hydroxyacetanilide results in increased expression of ACTG1 mRNA CTD PMID:18544908 Actg1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of ACTG1 protein CTD PMID:19826936 Actg1 Rat methidathion increases expression ISO RGD:1549970 6480464 methidathion results in increased expression of ACTG1 mRNA CTD PMID:34813904 Actg1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ACTG1 mRNA CTD PMID:30047161 Actg1 Rat methotrexate affects expression ISO RGD:1549970 6480464 Methotrexate affects the expression of ACTG1 mRNA CTD PMID:18502557 Actg1 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of ACTG1 protein CTD PMID:22430071 Actg1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1549970 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased expression of ACTG1 more ... CTD PMID:38730545 Actg1 Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:1549970 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ACTG1 protein CTD PMID:26558463 Actg1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of ACTG1 mRNA CTD PMID:19638242 Actg1 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of ACTG1 protein CTD PMID:19716841 Actg1 Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of ACTG1 protein CTD PMID:19716841 Actg1 Rat nitrates multiple interactions ISO RGD:1549970 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ACTG1 more ... CTD PMID:35964746 Actg1 Rat ozone multiple interactions ISO RGD:1312061 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Actg1 Rat paracetamol multiple interactions ISO RGD:1549970 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ACTG1 mRNA; MAP3K5 protein affects the reaction more ... CTD PMID:17585979|PMID:18700144 Actg1 Rat paracetamol affects expression ISO RGD:1549970 6480464 Acetaminophen affects the expression of ACTG1 mRNA CTD PMID:17562736 Actg1 Rat paracetamol increases expression ISO RGD:1549970 6480464 Acetaminophen results in increased expression of ACTG1 mRNA CTD PMID:11264010|PMID:18544908 Actg1 Rat paracetamol decreases expression ISO RGD:1312061 6480464 Acetaminophen results in decreased expression of ACTG1 protein CTD PMID:22230336 Actg1 Rat pentachlorophenol increases expression ISO RGD:1549970 6480464 Pentachlorophenol results in increased expression of ACTG1 mRNA CTD PMID:23892564 Actg1 Rat perfluorododecanoic acid decreases expression EXP 6480464 perfluorododecanoic acid results in decreased expression of ACTG1 protein CTD PMID:26168851 Actg1 Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of ACTG1 mRNA CTD PMID:31324951 Actg1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of ACTG1 mRNA CTD PMID:19162173 Actg1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ACTG1 mRNA CTD PMID:12082028 Actg1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of ACTG1 mRNA CTD PMID:15215175 Actg1 Rat pirinixic acid increases expression ISO RGD:1549970 6480464 pirinixic acid results in increased expression of ACTG1 mRNA CTD PMID:16221962|PMID:18445702 Actg1 Rat potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of ACTG1 protein CTD PMID:18563748 Actg1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of ACTG1 mRNA CTD PMID:19162173|PMID:30047161 Actg1 Rat rac-lactic acid increases expression ISO RGD:1312061 6480464 Lactic Acid results in increased expression of ACTG1 mRNA CTD PMID:30851411 Actg1 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of ACTG1 protein CTD PMID:30951809 Actg1 Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of ACTG1 mRNA CTD PMID:28374803 Actg1 Rat Salinomycin decreases expression ISO RGD:1312061 6480464 salinomycin results in decreased expression of ACTG1 mRNA CTD PMID:19682730 Actg1 Rat selenium atom increases expression ISO RGD:1312061 6480464 Selenium results in increased expression of ACTG1 mRNA CTD PMID:19244175 Actg1 Rat sodium arsenite multiple interactions ISO RGD:1312061 6480464 [sodium arsenite results in increased abundance of arsenite] which results in decreased expression of ACTG1 more ... CTD PMID:32076005|PMID:33939924 Actg1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ACTG1 mRNA CTD PMID:35314868 Actg1 Rat sodium arsenite increases expression ISO RGD:1312061 6480464 sodium arsenite results in increased expression of ACTG1 mRNA CTD PMID:38568856 Actg1 Rat sodium fluoride decreases expression ISO RGD:1549970 6480464 Sodium Fluoride results in decreased expression of ACTG1 protein CTD PMID:27548804 Actg1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ACTG1 mRNA CTD PMID:30047161 Actg1 Rat tamoxifen affects expression ISO RGD:1549970 6480464 Tamoxifen affects the expression of ACTG1 mRNA CTD PMID:20937368 Actg1 Rat tetrachloromethane increases expression ISO RGD:1549970 6480464 Carbon Tetrachloride results in increased expression of ACTG1 mRNA CTD PMID:17084009 Actg1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ACTG1 mRNA] CTD PMID:31150632 Actg1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ACTG1 mRNA CTD PMID:31150632 Actg1 Rat thapsigargin decreases expression ISO RGD:1312061 6480464 Thapsigargin results in decreased expression of ACTG1 mRNA CTD PMID:22378314 Actg1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ACTG1 mRNA CTD PMID:34492290 Actg1 Rat thiram increases expression ISO RGD:1312061 6480464 Thiram results in increased expression of ACTG1 mRNA CTD PMID:38568856 Actg1 Rat titanium dioxide decreases expression ISO RGD:1549970 6480464 titanium dioxide results in decreased expression of ACTG1 mRNA CTD PMID:23557971 Actg1 Rat titanium dioxide decreases methylation ISO RGD:1549970 6480464 titanium dioxide results in decreased methylation of ACTG1 promoter alternative form CTD PMID:35295148 Actg1 Rat trimellitic anhydride increases expression ISO RGD:1549970 6480464 trimellitic anhydride results in increased expression of ACTG1 mRNA CTD PMID:19042947 Actg1 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of ACTG1 mRNA CTD PMID:30589522 Actg1 Rat triptonide decreases expression ISO RGD:1549970 6480464 triptonide results in decreased expression of ACTG1 mRNA CTD PMID:33045310 Actg1 Rat troglitazone decreases expression ISO RGD:1312061 6480464 troglitazone results in decreased expression of ACTG1 mRNA CTD PMID:19140230 Actg1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of ACTG1 mRNA CTD PMID:24136188 Actg1 Rat tunicamycin decreases expression ISO RGD:1312061 6480464 Tunicamycin results in decreased expression of ACTG1 mRNA CTD PMID:22378314 Actg1 Rat valproic acid affects expression ISO RGD:1549970 6480464 Valproic Acid affects the expression of ACTG1 mRNA CTD PMID:17292431 Actg1 Rat yohimbine increases expression EXP 6480464 Yohimbine results in increased expression of ACTG1 mRNA CTD PMID:21983523 Actg1 Rat zinc sulfate affects expression ISO RGD:1312061 6480464 Zinc Sulfate affects the expression of ACTG1 protein CTD PMID:25162517
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Actg1 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Actg1 Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Actg1 Rat identical protein binding enables ISO RGD:1312061 1624291 UniProtKB:P63261 PMID:16189514, PMID:21516116, PMID:25416956, PMID:25910212 RGD PMID:16189514|PMID:21516116|PMID:25416956|PMID:25910212 Actg1 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Actg1 Rat profilin binding enables ISO RGD:1312061 1624291 PMID:28493397 RGD PMID:28493397 Actg1 Rat protein binding enables ISO RGD:1312061 1624291 UniProtKB:O60826|UniProtKB:P23528|UniProtKB:P40123|UniProtKB:P40692|UniProtKB:P42858|UniProtKB:P47756|UniProtKB:P60709|UniProtKB:P60981|UniProtKB:Q08426|UniProtKB:Q12792|UniProtKB:Q16543|UniProtKB:Q1KLZ0|UniProtKB:Q549N0|UniProtKB:Q96HA8|UniProtKB:Q9Y281 PMID:16189514, PMID:20706999, PMID:21516116, PMID:25416956, PMID:25910212, PMID:25959826, PMID:28493397, PMID:29892012, PMID:30886144, PMID:31515488, PMID:32296183, PMID:32814053, PMID:35271311 RGD PMID:16189514|PMID:20706999|PMID:21516116|PMID:25416956|PMID:25910212|PMID:25959826|PMID:28493397|PMID:29892012|PMID:30886144|PMID:31515488|PMID:32296183|PMID:32814053|PMID:35271311 Actg1 Rat protein binding enables ISO RGD:1549970 1624291 UniProtKB:Q08460 PMID:19423573 RGD PMID:19423573 Actg1 Rat protein kinase binding enables IBA PANTHER:PTN007551913|RGD:628837|UniProtKB:P60709 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Actg1 Rat structural constituent of cytoskeleton enables ISO RGD:1549970 1624291 PMID:15194427 RGD PMID:15194427 Actg1 Rat structural constituent of postsynaptic actin cytoskeleton enables IDA 13702432 PMID:9875357 SynGO Actg1 Rat structural constituent of postsynaptic actin cytoskeleton enables IBA PANTHER:PTN002631586|RGD:1304556|UniProtKB:P60709 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Actg1 Rat ubiquitin protein ligase binding enables ISO RGD:1312061 1624291 UniProtKB:O60260 PMID:21753002 RGD PMID:21753002
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-di-tert-butyl-4-methylphenol (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,3'-diindolylmethane (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (EXP) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitrole (EXP) amphetamine (EXP) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) Benzo[k]fluoranthene (ISO) beta-lapachone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) bufalin (ISO) buspirone (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) chromium(6+) (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) cytochalasin D (ISO) D-glucose (EXP) DDE (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) dicrotophos (ISO) dihydroartemisinin (ISO) dioxygen (EXP) diuron (ISO) dopamine (EXP) doxorubicin (EXP,ISO) elemental selenium (ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (EXP,ISO) Evodiamine (ISO) fenoldopam (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) fumonisin B1 (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) glucose (EXP) GW 4064 (ISO) ivermectin (ISO) jaspamide (ISO) leflunomide (ISO) levofloxacin (EXP) mancozeb (ISO) metacetamol (ISO) methamphetamine (EXP) methidathion (ISO) methimazole (EXP) methotrexate (ISO) microcystin-LR (EXP) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nitrates (ISO) ozone (ISO) paracetamol (ISO) pentachlorophenol (ISO) perfluorododecanoic acid (EXP) phenformin (EXP) phenobarbital (EXP) PhIP (EXP) pirinixic acid (ISO) potassium dichromate (EXP) pregnenolone 16alpha-carbonitrile (EXP) rac-lactic acid (ISO) rotenone (EXP) Salinomycin (ISO) selenium atom (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP) triptonide (ISO) troglitazone (ISO) trovafloxacin (EXP) tunicamycin (ISO) valproic acid (ISO) yohimbine (EXP) zinc sulfate (ISO)
1.
The genetic association database.
Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
beta-Actin is confined to structures having high capacity of remodelling in developing and adult rat cerebellum.
Micheva KD, etal., Eur J Neurosci. 1998 Dec;10(12):3785-98.
5.
Possible role of non-muscle alpha-actinins in muscle cell mechanosensitivity.
Ogneva IV, etal., PLoS One. 2014 Apr 29;9(4):e96395. doi: 10.1371/journal.pone.0096395. eCollection 2014.
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
Role of cytosolic calcium in regulation of cytoskeletal gene expression by insulin.
Weinstock RS, etal., Am J Physiol. 1993 Apr;264(4 Pt 1):E519-25.
Actg1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,118,106 - 106,120,951 (-) NCBI GRCr8 mRatBN7.2 10 105,619,738 - 105,622,587 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 72,977,767 - 72,979,694 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 10 105,619,737 - 105,624,232 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 110,724,157 - 110,726,999 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,187,175 - 110,190,017 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 105,540,227 - 105,543,072 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 109,518,429 - 109,521,288 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 75,643,054 - 75,644,954 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 109,519,134 - 109,520,846 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,113,705 - 109,116,103 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 109,773,489 - 109,776,334 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 109,787,992 - 109,790,826 (-) NCBI Celera 10 104,164,981 - 104,167,826 (-) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
ACTG1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 81,509,971 - 81,512,799 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 81,509,413 - 81,523,847 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 79,476,997 - 79,479,825 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 77,091,594 - 77,094,422 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 77,091,593 - 77,094,422 NCBI Cytogenetic Map 17 q25.3 NCBI HuRef 17 74,925,813 - 74,928,708 (-) NCBI HuRef CHM1_1 17 79,563,278 - 79,566,173 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 82,427,089 - 82,429,917 (-) NCBI T2T-CHM13v2.0
Actg1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 120,236,513 - 120,239,321 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 120,236,516 - 120,239,368 (-) Ensembl GRCm39 Ensembl GRCm38 11 120,345,687 - 120,348,495 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 120,345,690 - 120,348,542 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 120,207,004 - 120,209,798 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 120,161,780 - 120,171,339 (-) NCBI MGSCv36 mm8 Celera 11 132,080,255 - 132,083,049 (-) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 84.07 NCBI
Actg1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955506 1,546,678 - 1,552,105 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955506 1,546,678 - 1,549,611 (+) NCBI ChiLan1.0 ChiLan1.0
ACTG1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 98,096,764 - 98,099,674 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 102,996,909 - 102,999,820 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 75,965,911 - 75,968,822 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 81,668,221 - 81,671,087 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 81,668,221 - 81,671,087 (-) Ensembl panpan1.1 panPan2
ACTG1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 635,978 - 638,328 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 635,978 - 638,328 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 1,238,649 - 1,241,000 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 1,229,608 - 1,232,436 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 1,229,663 - 1,232,434 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 1,254,519 - 1,256,870 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 1,380,335 - 1,382,686 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 1,460,286 - 1,462,637 (+) NCBI UU_Cfam_GSD_1.0
Actg1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 1,238,788 - 1,241,248 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936594 5,170,711 - 5,173,247 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936594 5,170,711 - 5,173,251 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACTG1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 1,313,641 - 1,323,217 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 1,320,355 - 1,323,219 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 1,163,186 - 1,166,032 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACTG1 (Chlorocebus sabaeus - green monkey)
Actg1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 104 Count of miRNA genes: 79 Interacting mature miRNAs: 91 Transcripts: ENSRNOT00000054976 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 1354641 Bvd2 Brain ventricular dilatation QTL 2 6.36 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 10 93223816 107057807 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 10450493 Bp382 Blood pressure QTL 382 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1578672 Bmd16 Bone mineral density QTL 16 6.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 96703043 107057807 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2292436 Bp310 Blood pressure QTL 310 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 1578663 Bss18 Bone structure and strength QTL 18 3.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 10 96703043 107057807 Rat
PMC138261P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC156330P1
Rat Assembly Chr Position (strand) Source JBrowse Celera 19 51,258,498 - 51,259,502 UniSTS Celera 12 13,454,501 - 13,455,354 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 18 p12 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 10 q32.3 UniSTS
PMC201106P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC22644P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC302066P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC97568P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
RH128697
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 18 p12 UniSTS
PMC156124P2
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 10 q32.3 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 18 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
18
22
98
225
174
172
110
50
110
12
421
194
185
83
120
62
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000054976 ⟹ ENSRNOP00000051859
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 105,619,737 - 105,622,665 (-) Ensembl Rnor_6.0 Ensembl 10 109,519,134 - 109,520,846 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079310
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 72,977,767 - 72,979,694 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099821 ⟹ ENSRNOP00000096406
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 105,619,745 - 105,624,232 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108340 ⟹ ENSRNOP00000084530
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 105,619,737 - 105,624,232 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108494 ⟹ ENSRNOP00000096150
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 105,619,745 - 105,624,232 (-) Ensembl
RefSeq Acc Id:
NM_001127449 ⟹ NP_001120921
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,118,106 - 106,120,951 (-) NCBI mRatBN7.2 10 105,619,742 - 105,622,587 (-) NCBI Rnor_6.0 10 109,518,433 - 109,521,288 (-) NCBI Rnor_5.0 10 109,113,705 - 109,116,103 (-) NCBI RGSC_v3.4 10 109,773,489 - 109,776,334 (-) RGD Celera 10 104,164,981 - 104,167,826 (-) RGD
Sequence:
GGTCTCACACTTCGCCGCCGGCTTACACTGCGTTTCTTTCCGCTGCTCCGTCGTCCCGTCCTCTGCCGATCGCAATGGAAGAAGAAATCGCCGCCCTCGTCATTGACAATGGCTCCGGCATGTGCAAA GCTGGCTTTGCTGGGGACGACGCCCCCAGGGCCGTGTTTCCTTCCATCGTCGGGCGCCCCCGACACCAGGGTGTCATGGTGGGCATGGGCCAGAAAGACTCGTACGTGGGTGATGAGGCCCAGAGCAA GAGGGGTATTCTGACCCTGAAGTACCCTATTGAGCACGGCATTGTCACCAACTGGGACGACATGGAGAAGATCTGGCACCACACCTTCTACAACGAGCTGCGTGTGGCCCCTGAGGAGCACCCGGTGC TTCTGACCGAGGCCCCCCTGAACCCCAAAGCTAACAGAGAGAAGATGACGCAGATAATGTTTGAAACCTTCAATACCCCAGCCATGTACGTGGCCATTCAGGCGGTGCTCTCCTTGTATGCATCTGGG CGTACCACTGGCATTGTCATGGACTCTGGTGACGGGGTCACACACACAGTGCCCATCTATGAGGGCTACGCCCTTCCCCACGCCATCTTGCGTCTGGACCTGGCTGGCCGGGACCTGACAGACTACCT CATGAAGATCCTGACTGAAAGGGGCTACAGCTTTACCACCACTGCTGAGAGGGAAATTGTTCGTGACATAAAGGAGAAGCTGTGCTATGTTGCCCTGGATTTTGAGCAAGAAATGGCTACTGCTGCAT CATCTTCCTCTTTGGAGAAGAGTTATGAGCTGCCTGATGGGCAGGTGATCACCATTGGCAATGAGCGCTTCCGGTGTCCAGAGGCTCTCTTCCAGCCTTCCTTCCTGGGCATGGAGTCCTGTGGCATC CACGAGACCACCTTCAACTCCATCATGAAGTGTGATGTGGACATCCGCAAAGACCTGTATGCCAACACAGTGCTGTCTGGTGGTACCACCATGTATCCAGGCATTGCTGACAGGATGCAGAAGGAGAT CACAGCCCTGGCTCCCAGCACAATGAAGATTAAGATCATTGCTCCTCCTGAACGCAAGTACTCAGTCTGGATTGGCGGCTCCATCCTGGCCTCACTGTCCACCTTCCAGCAGATGTGGATCAGCAAGC AGGAGTATGACGAGTCAGGCCCCTCCATTGTCCACCGCAAATGCTTCTAGATGGACTGAGCAGGTGCCAGGCATCTGCTGCATGAGCTGATTCTGAAGTATCGATTTGCCCTGGCAAATGTACACACC TCATGCTAGCCTCATGAAACTGGAATAAGCCTTTGAAAAGAAATTTGTCCTTGAAGCTTGTATCTGATATCAGCACTGGATCGTAGAACTTGTTGCTGATTTTTGACCTTGTATTCAAGTTAACTGTT CCCTTGGTATATGTTTAATACCCTGTGCATATCTTGATTTAGTCCTTAGTTCATGTGGCTCGGTCACTTGGTGGCTGGGGAGATCTGTGGAAAAGTCAGTCAGTCCCCAGCCTAGTGGATCTCTGTGA GCACCATGTAGTGATCTGTGCAGGGTATTAACCAACAGCAGACTTCCAGGATTTCCCGAGGCTGGCAAGGGTTCCTGAACTAGTTACCACTTCTTTTCTTGCCAGTCTAACAGGGTGGGAAAGTCCGA GCCTTAGGACCCAGTTTCTGTTCTGGTTTTTTCCCTCCTGACCTCCATGGGTTGTTACTTGCCTTGAGTTGGGAACGTTTGCATCGACACCTGTAAATGTATTCATCCTTTTAATTTATGTAAGGTTT TTGTACTCAATTCTTTAAGAAATGACAAATTTTGGTTTTCTACTGTTCAGTGAGAACATTAGGCCCCAGCAACACGTCATTGTGTAAAGAGAAATAAAAGTGCTGCAGTAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_001120921 ⟸ NM_001127449
- UniProtKB:
P63259 (UniProtKB/Swiss-Prot), A6HLC1 (UniProtKB/TrEMBL), A0A8L2QLX4 (UniProtKB/TrEMBL)
- Sequence:
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN TPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFR CPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
hide sequence
Ensembl Acc Id:
ENSRNOP00000051859 ⟸ ENSRNOT00000054976
Ensembl Acc Id:
ENSRNOP00000084530 ⟸ ENSRNOT00000108340
Ensembl Acc Id:
ENSRNOP00000096406 ⟸ ENSRNOT00000099821
Ensembl Acc Id:
ENSRNOP00000096150 ⟸ ENSRNOT00000108494
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-05-24
Actg1
actin, gamma 1
LOC295810
similar to Actin, cytoplasmic 2 (Gamma-actin)
Data merged from RGD:1589770
1643240
APPROVED
2008-08-29
Actg1
actin, gamma 1
Actg1
actin, gamma, cytoplasmic 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-11-20
LOC295810
similar to Actin, cytoplasmic 2 (Gamma-actin)
Symbol and Name status set to provisional
70820
PROVISIONAL
2006-03-30
Actg1
actin, gamma, cytoplasmic 1
Actg
actin, gamma, cytoplasmic
Symbol and Name updated
1299863
APPROVED
2005-12-06
Actg
actin, gamma, cytoplasmic
Actg_predicted
actin, gamma, cytoplasmic (predicted)
Symbol and Name updated
1559027
APPROVED
2005-01-12
Actg_predicted
actin, gamma, cytoplasmic (predicted)
Symbol and Name status set to approved
70820
APPROVED