Symbol:
Nqo2
Name:
N-ribosyldihydronicotinamide:quinone dehydrogenase 2
RGD ID:
1303320
Description:
Predicted to enable several functions, including anion binding activity; dihydronicotinamide riboside quinone reductase activity; and melatonin binding activity. Involved in several processes, including positive regulation of ERK1 and ERK2 cascade; positive regulation of neuron apoptotic process; and positive regulation of vascular associated smooth muscle cell proliferation. Predicted to be located in nucleoplasm. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in Parkinson's disease; agranulocytosis; breast cancer; and breast carcinoma. Orthologous to human NQO2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC94180; N-ribosyldihydronicotinamide:quinone reductase 2; NAD(P)H dehydrogenase, quinone 2; NAD(P)H quinone dehydrogenase 2; NRH dehydrogenase [quinone] 2; NRH:quinone oxidoreductase 2; QR2; quinone reductase 2; ribosyldihydronicotinamide dehydrogenase; ribosyldihydronicotinamide dehydrogenase [quinone]
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NQO2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Nqo2 (N-ribosyldihydronicotinamide quinone reductase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nqo2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NQO2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NQO2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NQO2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NQO2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nqo2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NQO2 (N-ribosyldihydronicotinamide:quinone dehydrogenase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nqo2 (N-ribosyldihydronicotinamide quinone reductase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nqo1 (NAD(P)H dehydrogenase, quinone 1)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 31,114,825 - 31,144,062 (-) NCBI GRCr8 mRatBN7.2 17 30,909,482 - 30,938,725 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 30,909,187 - 30,938,320 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 30,723,881 - 30,752,881 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 32,327,627 - 32,356,626 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 30,719,617 - 30,748,617 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 32,131,847 - 32,158,559 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 32,132,347 - 32,158,538 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 34,023,011 - 34,051,834 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 37,255,630 - 37,283,753 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 37,258,472 - 37,286,594 (-) NCBI Celera 17 30,474,024 - 30,502,465 (-) NCBI Celera Cytogenetic Map 17 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nqo2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NQO2 mRNA] CTD PMID:31150632 Nqo2 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1551869 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NQO2 mRNA CTD PMID:36331819 Nqo2 Rat 1,2-dichloroethane decreases expression ISO RGD:1551869 6480464 ethylene dichloride results in decreased expression of NQO2 mRNA CTD PMID:28960355 Nqo2 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1551869 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NQO2 mRNA CTD PMID:22206623 Nqo2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1551869 6480464 1,2-Dimethylhydrazine results in decreased expression of NQO2 mRNA CTD PMID:22206623 Nqo2 Rat 17beta-estradiol multiple interactions ISO RGD:1351629 6480464 [Estradiol co-treated with Norethindrone Acetate] results in increased expression of NQO2 mRNA CTD PMID:22217510 Nqo2 Rat 17beta-estradiol decreases expression ISO RGD:1551869 6480464 Estradiol results in decreased expression of NQO2 mRNA CTD PMID:39298647 Nqo2 Rat 17beta-estradiol increases expression ISO RGD:1351629 6480464 Estradiol results in increased expression of NQO2 mRNA CTD PMID:19167446 Nqo2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1551869 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Nqo2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1351629 6480464 Tetrachlorodibenzodioxin results in increased expression of NQO2 mRNA; Tetrachlorodibenzodioxin results in increased expression of NQO2 more ... CTD PMID:11154737|PMID:20106945|PMID:21632981 Nqo2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1551869 6480464 Tetrachlorodibenzodioxin affects the expression of NQO2 mRNA CTD PMID:21570461 Nqo2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1551869 6480464 Tetrachlorodibenzodioxin results in increased expression of NQO2 mRNA CTD PMID:21889950 Nqo2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NQO2 mRNA CTD PMID:18796159|PMID:21215274 Nqo2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1551869 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:21889950|PMID:28433925 Nqo2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of NQO2 mRNA CTD PMID:21346803 Nqo2 Rat 2,6-dichloroindophenol multiple interactions ISO RGD:1351629 6480464 [NQO2 protein results in increased oxidation of 1-benzyl-1,4-dihydronicotinamide] which results in increased reduction of 2,6-Dichloroindophenol; more ... CTD PMID:20399199|PMID:29281794 Nqo2 Rat 2,6-dichloroindophenol increases reduction ISO RGD:1351629 6480464 NQO2 protein results in increased reduction of 2,6-Dichloroindophenol CTD PMID:29281794 Nqo2 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1351629 6480464 Lactic Acid results in decreased expression of NQO2 mRNA CTD PMID:30851411 Nqo2 Rat 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide increases reduction ISO RGD:1351629 6480464 NQO2 protein results in increased reduction of thiazolyl blue CTD PMID:29281794 Nqo2 Rat 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide multiple interactions ISO RGD:1351629 6480464 resveratrol inhibits the reaction [NQO2 protein results in increased reduction of thiazolyl blue]; Tacrine inhibits more ... CTD PMID:29281794 Nqo2 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of NQO2 mRNA CTD PMID:28522335 Nqo2 Rat 3-methylcholanthrene increases expression ISO RGD:1551869 6480464 Methylcholanthrene results in increased expression of NQO2 mRNA CTD PMID:20713471 Nqo2 Rat 4',5,7-trihydroxy-3'-methoxyflavone multiple interactions ISO RGD:1351629 6480464 chrysoeriol inhibits the reaction [[NQO2 protein results in increased oxidation of 1-benzyl-1,4-dihydronicotinamide] which results in more ... CTD PMID:20399199 Nqo2 Rat 4'-hydroxydiclofenac multiple interactions ISO RGD:1351629 6480464 NQO2 protein results in increased reduction of and results in decreased glutathionylation of 4'-hydroxydiclofenac CTD PMID:29281794 Nqo2 Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:1551869 6480464 4,4'-diaminodiphenylmethane results in increased expression of NQO2 mRNA CTD PMID:18648102 Nqo2 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1551869 6480464 bisphenol S results in decreased expression of NQO2 mRNA CTD PMID:39298647 Nqo2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1351629 6480464 bisphenol S results in increased expression of NQO2 protein CTD PMID:34186270 Nqo2 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1551869 6480464 Fenretinide results in decreased expression of NQO2 mRNA CTD PMID:28973697 Nqo2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NQO2 mRNA CTD PMID:24780913 Nqo2 Rat aflatoxin B1 decreases expression ISO RGD:1551869 6480464 Aflatoxin B1 results in decreased expression of NQO2 mRNA CTD PMID:19770486 Nqo2 Rat aflatoxin B1 increases methylation ISO RGD:1351629 6480464 Aflatoxin B1 results in increased methylation of NQO2 gene CTD PMID:27153756 Nqo2 Rat aflatoxin B1 affects expression ISO RGD:1351629 6480464 Aflatoxin B1 affects the expression of NQO2 protein CTD PMID:20106945 Nqo2 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of NQO2 mRNA CTD PMID:20488242 Nqo2 Rat all-trans-retinoic acid increases expression ISO RGD:1351629 6480464 Tretinoin results in increased expression of NQO2 mRNA CTD PMID:33167477 Nqo2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NQO2 mRNA CTD PMID:35163327 Nqo2 Rat amodiaquine multiple interactions ISO RGD:1351629 6480464 Amodiaquine inhibits the reaction [NQO2 protein results in increased reduction of Vitamin K 3] CTD PMID:29281794 Nqo2 Rat aristolochic acids decreases expression EXP 6480464 Aristolochic Acids results in decreased expression of NQO2 mRNA CTD PMID:19717638 Nqo2 Rat arsenous acid increases expression ISO RGD:1351629 6480464 Arsenic Trioxide results in increased expression of NQO2 mRNA CTD PMID:21461292 Nqo2 Rat benzo[a]pyrene decreases expression ISO RGD:1551869 6480464 Benzo(a)pyrene results in decreased expression of NQO2 mRNA CTD PMID:20127859 Nqo2 Rat benzo[a]pyrene decreases methylation ISO RGD:1351629 6480464 Benzo(a)pyrene results in decreased methylation of NQO2 promoter CTD PMID:27901495 Nqo2 Rat benzo[a]pyrene increases methylation ISO RGD:1351629 6480464 Benzo(a)pyrene results in increased methylation of NQO2 3' UTR CTD PMID:27901495 Nqo2 Rat benzo[a]pyrene multiple interactions ISO RGD:1551869 6480464 [lipopolysaccharide, E coli O55-B5 co-treated with Benzo(a)pyrene] affects the expression of NQO2 mRNA CTD PMID:28987381 Nqo2 Rat benzo[a]pyrene increases expression ISO RGD:1351629 6480464 Benzo(a)pyrene results in increased expression of NQO2 mRNA CTD PMID:20106945|PMID:21632981 Nqo2 Rat benzo[a]pyrene increases expression ISO RGD:1551869 6480464 Benzo(a)pyrene results in increased expression of NQO2 mRNA CTD PMID:21715664 Nqo2 Rat beta-lapachone increases expression ISO RGD:1351629 6480464 beta-lapachone results in increased expression of NQO2 mRNA CTD PMID:38218311 Nqo2 Rat beta-naphthoflavone increases expression ISO RGD:1351629 6480464 beta-Naphthoflavone results in increased expression of NQO2 mRNA CTD PMID:19737606 Nqo2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1551869 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Nqo2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NQO2 mRNA CTD PMID:25181051 Nqo2 Rat bisphenol A increases expression ISO RGD:1351629 6480464 bisphenol A results in increased expression of NQO2 protein CTD PMID:34186270|PMID:37567409 Nqo2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NQO2 mRNA CTD PMID:34947998 Nqo2 Rat bisphenol A multiple interactions ISO RGD:1551869 6480464 [Tetrachlorodibenzodioxin co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with Diethylhexyl Phthalate co-treated with bisphenol A] results in decreased more ... CTD PMID:28433925 Nqo2 Rat bisphenol AF increases expression ISO RGD:1351629 6480464 bisphenol AF results in increased expression of NQO2 protein CTD PMID:34186270 Nqo2 Rat Bisphenol B increases expression ISO RGD:1351629 6480464 bisphenol B results in increased expression of NQO2 protein CTD PMID:34186270 Nqo2 Rat bisphenol F increases expression ISO RGD:1351629 6480464 bisphenol F results in increased expression of NQO2 protein CTD PMID:34186270 Nqo2 Rat bortezomib increases expression ISO RGD:1351629 6480464 Bortezomib results in increased expression of NQO2 mRNA CTD PMID:20977926 Nqo2 Rat capsaicin multiple interactions EXP 6480464 Capsaicin inhibits the reaction [Dietary Fats results in increased expression of NQO2 protein] CTD PMID:20359164 Nqo2 Rat carbamazepine multiple interactions ISO RGD:1351629 6480464 NQO2 protein results in increased reduction of and results in decreased glutathionylation of Carbamazepine metabolite CTD PMID:29281794 Nqo2 Rat carbon nanotube decreases expression ISO RGD:1551869 6480464 Nanotubes, Carbon analog results in decreased expression of NQO2 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Nqo2 Rat carbon nanotube affects expression ISO RGD:1551869 6480464 Nanotubes, Carbon affects the expression of NQO2 mRNA CTD PMID:31978390 Nqo2 Rat carbon nanotube increases expression ISO RGD:1551869 6480464 Nanotubes, Carbon results in increased expression of NQO2 mRNA CTD PMID:25554681 Nqo2 Rat CGP 52608 multiple interactions ISO RGD:1351629 6480464 CGP 52608 promotes the reaction [RORA protein binds to NQO2 gene] CTD PMID:28238834 Nqo2 Rat chenodeoxycholic acid multiple interactions ISO RGD:1351629 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Nqo2 Rat chloroquine multiple interactions ISO RGD:1351629 6480464 Chloroquine binds to and results in decreased activity of NQO2 protein CTD PMID:15078100 Nqo2 Rat cisplatin increases expression ISO RGD:1551869 6480464 Cisplatin results in increased expression of NQO2 mRNA CTD PMID:21151649 Nqo2 Rat clozapine affects response to substance ISO RGD:1351629 6480464 NQO2 gene SNP affects the susceptibility to Clozapine CTD PMID:14617031 Nqo2 Rat clozapine increases reduction ISO RGD:1351629 6480464 NQO2 protein results in increased reduction of Clozapine metabolite CTD PMID:29281794 Nqo2 Rat clozapine multiple interactions ISO RGD:1351629 6480464 Clozapine inhibits the reaction [NQO2 protein results in increased reduction of Vitamin K 3] CTD PMID:29281794 Nqo2 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of NQO2 mRNA CTD PMID:17898221 Nqo2 Rat copper(II) sulfate increases expression ISO RGD:1351629 6480464 Copper Sulfate results in increased expression of NQO2 mRNA CTD PMID:19549813 Nqo2 Rat coumestrol increases expression ISO RGD:1351629 6480464 Coumestrol results in increased expression of NQO2 mRNA CTD PMID:19167446 Nqo2 Rat coumestrol multiple interactions ISO RGD:1351629 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of NQO2 mRNA; [Coumestrol co-treated with Resveratrol] more ... CTD PMID:19167446 Nqo2 Rat cyclosporin A increases expression ISO RGD:1351629 6480464 Cyclosporine results in increased expression of NQO2 mRNA CTD PMID:20106945|PMID:27989131|PMID:32152650 Nqo2 Rat cyclosporin A multiple interactions ISO RGD:1351629 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Nqo2 Rat cyclosporin A decreases expression ISO RGD:1351629 6480464 Cyclosporine results in decreased expression of NQO2 mRNA CTD PMID:25562108 Nqo2 Rat cyclosporin A decreases expression ISO RGD:1551869 6480464 Cyclosporine results in decreased expression of NQO2 mRNA CTD PMID:19770486 Nqo2 Rat deoxycholic acid multiple interactions ISO RGD:1351629 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Nqo2 Rat diarsenic trioxide increases expression ISO RGD:1351629 6480464 Arsenic Trioxide results in increased expression of NQO2 mRNA CTD PMID:21461292 Nqo2 Rat dibutyl phthalate decreases expression ISO RGD:1551869 6480464 Dibutyl Phthalate results in decreased expression of NQO2 mRNA CTD PMID:21266533 Nqo2 Rat diethylstilbestrol decreases expression ISO RGD:1351629 6480464 Diethylstilbestrol results in decreased expression of NQO2 mRNA CTD PMID:36621641 Nqo2 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression ISO RGD:1351629 6480464 Antimony Potassium Tartrate results in increased expression of NQO2 mRNA CTD PMID:28713220 Nqo2 Rat dorsomorphin multiple interactions ISO RGD:1351629 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nqo2 Rat doxorubicin decreases expression ISO RGD:1551869 6480464 Doxorubicin results in decreased expression of NQO2 mRNA CTD PMID:25896364 Nqo2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of NQO2 mRNA CTD PMID:29391264 Nqo2 Rat Enterolactone multiple interactions ISO RGD:1351629 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of NQO2 mRNA CTD PMID:19167446 Nqo2 Rat entinostat increases expression ISO RGD:1351629 6480464 entinostat results in increased expression of NQO2 mRNA CTD PMID:26272509 Nqo2 Rat entinostat multiple interactions ISO RGD:1351629 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nqo2 Rat ethanol increases expression ISO RGD:1551869 6480464 Ethanol results in increased expression of NQO2 mRNA CTD PMID:30319688 Nqo2 Rat fenthion increases expression ISO RGD:1551869 6480464 Fenthion results in increased expression of NQO2 mRNA CTD PMID:34813904 Nqo2 Rat fluoranthene multiple interactions ISO RGD:1551869 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of NQO2 mRNA CTD PMID:28329830 Nqo2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of NQO2 mRNA CTD PMID:24136188 Nqo2 Rat flutriafol multiple interactions ISO RGD:1351629 6480464 Acetylcysteine inhibits the reaction [flutriafol results in increased expression of NQO2 mRNA] CTD PMID:34200939 Nqo2 Rat flutriafol increases expression ISO RGD:1351629 6480464 flutriafol results in increased expression of NQO2 mRNA CTD PMID:34200939 Nqo2 Rat folic acid multiple interactions ISO RGD:1551869 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NQO2 mRNA CTD PMID:22206623 Nqo2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NQO2 mRNA CTD PMID:33387578 Nqo2 Rat glycochenodeoxycholic acid multiple interactions ISO RGD:1351629 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Nqo2 Rat glycocholic acid multiple interactions ISO RGD:1351629 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Nqo2 Rat glycodeoxycholic acid multiple interactions ISO RGD:1351629 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with more ... CTD PMID:32152650 Nqo2 Rat hesperetin affects binding ISO RGD:1351629 6480464 hesperetin binds to NQO2 protein CTD PMID:37487865 Nqo2 Rat hydrogen peroxide multiple interactions ISO RGD:1351629 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of NQO2 protein CTD PMID:18951874 Nqo2 Rat inulin multiple interactions ISO RGD:1551869 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of NQO2 mRNA CTD PMID:36331819 Nqo2 Rat isoprenaline decreases expression ISO RGD:1551869 6480464 Isoproterenol results in decreased expression of NQO2 mRNA CTD PMID:21335049 Nqo2 Rat isotretinoin decreases expression ISO RGD:1351629 6480464 Isotretinoin results in decreased expression of NQO2 mRNA CTD PMID:20436886 Nqo2 Rat ivermectin decreases expression ISO RGD:1351629 6480464 Ivermectin results in decreased expression of NQO2 protein CTD PMID:32959892 Nqo2 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of NQO2 mRNA CTD PMID:22641619 Nqo2 Rat mefenamic acid multiple interactions ISO RGD:1351629 6480464 Mefenamic Acid inhibits the reaction [NQO2 protein results in increased reduction of Vitamin K 3]; more ... CTD PMID:29281794 Nqo2 Rat melatonin multiple interactions ISO RGD:1351629 6480464 Melatonin inhibits the reaction [[NQO2 protein results in increased oxidation of 1-benzyl-1,4-dihydronicotinamide] which results in more ... CTD PMID:20399199 Nqo2 Rat melatonin affects activity ISO RGD:1351629 6480464 Melatonin affects the activity of NQO2 protein CTD PMID:22289031 Nqo2 Rat menadione increases activity ISO RGD:1551869 6480464 NQO2 protein results in increased activity of Vitamin K 3 CTD PMID:17762829 Nqo2 Rat menadione increases reduction ISO RGD:1351629 6480464 NQO2 protein results in increased reduction of Vitamin K 3 CTD PMID:29281794 Nqo2 Rat menadione decreases response to substance ISO RGD:1551869 6480464 NQO2 gene mutant form results in decreased susceptibility to Vitamin K 3 CTD PMID:21859103 Nqo2 Rat menadione affects response to substance ISO RGD:1551869 6480464 NQO2 affects the susceptibility to Vitamin K 3 CTD PMID:12351651 Nqo2 Rat menadione multiple interactions ISO RGD:1351629 6480464 [NQO2 protein results in increased oxidation of 1-benzyl-1,4-dihydronicotinamide] which results in increased reduction of Vitamin more ... CTD PMID:20399199|PMID:29281794 Nqo2 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of NQO2 mRNA CTD PMID:30467583 Nqo2 Rat methyl methanesulfonate increases expression ISO RGD:1351629 6480464 Methyl Methanesulfonate results in increased expression of NQO2 mRNA CTD PMID:23649840 Nqo2 Rat methylmercury chloride decreases expression ISO RGD:1551869 6480464 methylmercuric chloride results in decreased expression of NQO2 mRNA CTD PMID:20061341 Nqo2 Rat methylmercury chloride increases expression ISO RGD:1351629 6480464 methylmercuric chloride results in increased expression of NQO2 mRNA CTD PMID:28001369 Nqo2 Rat N-acetyl-1,4-benzoquinone imine multiple interactions ISO RGD:1351629 6480464 NQO2 protein results in increased reduction of and results in decreased glutathionylation of N-acetyl-4-benzoquinoneimine; Tacrine more ... CTD PMID:29281794 Nqo2 Rat N-acetyl-L-cysteine multiple interactions ISO RGD:1351629 6480464 Acetylcysteine inhibits the reaction [flutriafol results in increased expression of NQO2 mRNA] CTD PMID:34200939 Nqo2 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of NQO2 mRNA CTD PMID:25380136 Nqo2 Rat N-ribosylnicotinamide multiple interactions ISO RGD:1351629 6480464 [NQO2 protein results in increased oxidation of nicotinamide-beta-riboside] which results in increased reduction of 2,6-Dichloroindophenol; more ... CTD PMID:20399199 Nqo2 Rat N-ribosylnicotinamide increases oxidation ISO RGD:1351629 6480464 NQO2 protein results in increased oxidation of nicotinamide-beta-riboside; NQO2 protein results in increased oxidation of more ... CTD PMID:20399199|PMID:29281794 Nqo2 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of NQO2 mRNA CTD PMID:24136188 Nqo2 Rat nickel sulfate increases expression ISO RGD:1351629 6480464 nickel sulfate results in increased expression of NQO2 mRNA CTD PMID:22714537 Nqo2 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of NQO2 mRNA CTD PMID:19717638 Nqo2 Rat okadaic acid increases expression ISO RGD:1351629 6480464 Okadaic Acid results in increased expression of NQO2 mRNA CTD PMID:38832940 Nqo2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of NQO2 mRNA CTD PMID:25729387 Nqo2 Rat oxidopamine multiple interactions ISO RGD:1351629 6480464 Oxidopamine results in increased expression of and results in increased activity of NQO2 protein CTD PMID:39271030 Nqo2 Rat ozone multiple interactions ISO RGD:1551869 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of NQO2 more ... CTD PMID:34911549 Nqo2 Rat panobinostat multiple interactions ISO RGD:1351629 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nqo2 Rat panobinostat increases expression ISO RGD:1351629 6480464 panobinostat results in increased expression of NQO2 mRNA CTD PMID:26272509 Nqo2 Rat paracetamol affects expression ISO RGD:1551869 6480464 Acetaminophen affects the expression of NQO2 mRNA CTD PMID:17562736 Nqo2 Rat paraquat increases response to substance ISO RGD:1351629 6480464 NQO2 protein results in increased susceptibility to Paraquat CTD PMID:22289031 Nqo2 Rat paraquat multiple interactions ISO RGD:1351629 6480464 N-(2-(2-methoxy-6H-dipyrido(2,3-a-3,2-e)pyrrolizin-11-yl)ethyl)-2-furamide inhibits the reaction [Paraquat results in increased activity of NQO2 protein] CTD PMID:22289031 Nqo2 Rat paraquat increases activity ISO RGD:1351629 6480464 Paraquat results in increased activity of NQO2 protein CTD PMID:22289031 Nqo2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1551869 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NQO2 mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Nqo2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NQO2 mRNA CTD PMID:35163327 Nqo2 Rat phenylmercury acetate increases expression ISO RGD:1351629 6480464 Phenylmercuric Acetate results in increased expression of NQO2 mRNA CTD PMID:26272509 Nqo2 Rat phenylmercury acetate multiple interactions ISO RGD:1351629 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nqo2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:1351629 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of NQO2 mRNA CTD PMID:16979875 Nqo2 Rat pirinixic acid decreases expression ISO RGD:1551869 6480464 pirinixic acid results in decreased expression of NQO2 mRNA CTD PMID:18445702 Nqo2 Rat primaquine multiple interactions ISO RGD:1351629 6480464 Primaquine binds to and results in decreased activity of NQO2 protein CTD PMID:15078100 Nqo2 Rat pterostilbene increases expression ISO RGD:1351629 6480464 pterostilbene results in increased expression of NQO2 mRNA; pterostilbene results in increased expression of NQO2 more ... CTD PMID:24936659 Nqo2 Rat quercetin affects binding ISO RGD:1351629 6480464 Quercetin binds to NQO2 protein CTD PMID:15350128 Nqo2 Rat quercetin multiple interactions ISO RGD:1351629 6480464 Quercetin inhibits the reaction [NQO2 protein results in increased reduction of estradiol-3,4-quinone] CTD PMID:18996184 Nqo2 Rat quercetin decreases expression ISO RGD:1351629 6480464 Quercetin results in decreased expression of NQO2 mRNA CTD PMID:21632981 Nqo2 Rat quinacrine multiple interactions ISO RGD:1351629 6480464 Quinacrine binds to and results in decreased activity of NQO2 protein CTD PMID:15078100 Nqo2 Rat rac-lactic acid decreases expression ISO RGD:1351629 6480464 Lactic Acid results in decreased expression of NQO2 mRNA CTD PMID:30851411 Nqo2 Rat resveratrol decreases activity ISO RGD:1351629 6480464 resveratrol analog results in decreased activity of NQO2 protein CTD PMID:23953689 Nqo2 Rat resveratrol affects binding ISO RGD:1351629 6480464 resveratrol binds to NQO2 protein CTD PMID:24968355 Nqo2 Rat resveratrol increases expression ISO RGD:1351629 6480464 resveratrol results in increased expression of NQO2 protein CTD PMID:15993843 Nqo2 Rat resveratrol multiple interactions ISO RGD:1351629 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of NQO2 mRNA; [resveratrol binds to NQO2 more ... CTD PMID:15350128|PMID:16759640|PMID:19167446|PMID:19661309|PMID:20399199|PMID:23953689|PMID:24968355|PMID:29281794 Nqo2 Rat sarin decreases expression ISO RGD:1351629 6480464 Sarin results in decreased expression of NQO2 mRNA CTD PMID:19522546 Nqo2 Rat SB 431542 multiple interactions ISO RGD:1351629 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Nqo2 Rat scopolamine increases expression EXP 6480464 Scopolamine results in increased expression of NQO2 mRNA CTD PMID:20861374 Nqo2 Rat silicon dioxide decreases expression ISO RGD:1551869 6480464 Silicon Dioxide results in decreased expression of NQO2 mRNA CTD PMID:23221170 Nqo2 Rat sodium arsenite increases expression ISO RGD:1351629 6480464 sodium arsenite results in increased expression of NQO2 mRNA CTD PMID:22714537|PMID:24516582|PMID:25879800|PMID:28713220|PMID:38568856 Nqo2 Rat sodium fluoride increases expression ISO RGD:1551869 6480464 Sodium Fluoride results in increased expression of NQO2 protein CTD PMID:28918527 Nqo2 Rat sulforaphane increases expression ISO RGD:1351629 6480464 sulforaphane results in increased expression of NQO2 mRNA CTD PMID:26833863 Nqo2 Rat T-2 toxin increases expression ISO RGD:1351629 6480464 T-2 Toxin results in increased expression of NQO2 protein CTD PMID:34581912 Nqo2 Rat tacrine decreases activity ISO RGD:1351629 6480464 Tacrine results in decreased activity of NQO2 protein CTD PMID:29281794 Nqo2 Rat tacrine multiple interactions ISO RGD:1351629 6480464 Tacrine inhibits the reaction [NQO2 protein results in increased reduction of 2,6-Dichloroindophenol]; Tacrine inhibits the more ... CTD PMID:29281794 Nqo2 Rat tert-butyl hydroperoxide decreases expression ISO RGD:1351629 6480464 tert-Butylhydroperoxide results in decreased expression of NQO2 mRNA CTD PMID:15336504 Nqo2 Rat tetrachloromethane decreases expression ISO RGD:1551869 6480464 Carbon Tetrachloride results in decreased expression of NQO2 mRNA CTD PMID:27339419|PMID:31919559 Nqo2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NQO2 mRNA CTD PMID:31150632 Nqo2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NQO2 mRNA] CTD PMID:31150632 Nqo2 Rat thalidomide decreases expression ISO RGD:1551869 6480464 Thalidomide results in decreased expression of NQO2 mRNA CTD PMID:26217789 Nqo2 Rat theophylline multiple interactions ISO RGD:1351629 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of NQO2 protein CTD PMID:18951874 Nqo2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NQO2 mRNA CTD PMID:34492290 Nqo2 Rat titanium dioxide increases expression ISO RGD:1551869 6480464 titanium dioxide results in increased expression of NQO2 mRNA CTD PMID:35295148 Nqo2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of NQO2 mRNA CTD PMID:25729387 Nqo2 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of NQO2 mRNA CTD PMID:25729387 Nqo2 Rat trichostatin A increases expression ISO RGD:1351629 6480464 trichostatin A results in increased expression of NQO2 mRNA CTD PMID:24935251 Nqo2 Rat trichostatin A affects expression ISO RGD:1351629 6480464 trichostatin A affects the expression of NQO2 mRNA CTD PMID:28542535 Nqo2 Rat triphenyl phosphate affects expression ISO RGD:1351629 6480464 triphenyl phosphate affects the expression of NQO2 mRNA CTD PMID:37042841 Nqo2 Rat troglitazone decreases expression ISO RGD:1551869 6480464 troglitazone results in decreased expression of NQO2 mRNA CTD PMID:28973697 Nqo2 Rat ubiquinone-1 multiple interactions ISO RGD:1351629 6480464 [NQO2 protein results in increased oxidation of 1-benzyl-1,4-dihydronicotinamide] which results in increased reduction of Ubiquinone more ... CTD PMID:20399199 Nqo2 Rat valproic acid affects expression ISO RGD:1551869 6480464 Valproic Acid affects the expression of NQO2 mRNA CTD PMID:17292431 Nqo2 Rat valproic acid increases expression ISO RGD:1351629 6480464 Valproic Acid results in increased expression of NQO2 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:27188386|PMID:28001369|PMID:29154799 Nqo2 Rat valproic acid multiple interactions ISO RGD:1351629 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Nqo2 Rat valproic acid affects expression ISO RGD:1351629 6480464 Valproic Acid affects the expression of NQO2 mRNA CTD PMID:25979313 Nqo2 Rat valproic acid decreases methylation ISO RGD:1351629 6480464 Valproic Acid results in decreased methylation of NQO2 gene CTD PMID:29154799 Nqo2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NQO2 mRNA CTD PMID:22615374 Nqo2 Rat vorinostat increases expression ISO RGD:1351629 6480464 vorinostat results in increased expression of NQO2 protein CTD PMID:17593366 Nqo2 Rat zinc atom affects expression ISO RGD:1351629 6480464 Zinc affects the expression of NQO2 mRNA CTD PMID:16979875 Nqo2 Rat zinc atom multiple interactions ISO RGD:1351629 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NQO2 mRNA; [Zinc co-treated with more ... CTD PMID:16979875|PMID:18593933 Nqo2 Rat zinc(0) affects expression ISO RGD:1351629 6480464 Zinc affects the expression of NQO2 mRNA CTD PMID:16979875 Nqo2 Rat zinc(0) multiple interactions ISO RGD:1351629 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NQO2 mRNA; [Zinc co-treated with more ... CTD PMID:16979875|PMID:18593933
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dichloroindophenol (ISO) 2-hydroxypropanoic acid (ISO) 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (ISO) 3-chloropropane-1,2-diol (EXP) 3-methylcholanthrene (ISO) 4',5,7-trihydroxy-3'-methoxyflavone (ISO) 4'-hydroxydiclofenac (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) alpha-Zearalanol (EXP) amodiaquine (ISO) aristolochic acids (EXP) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) capsaicin (EXP) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chloroquine (ISO) cisplatin (ISO) clozapine (ISO) cocaine (EXP) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) deoxycholic acid (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diethylstilbestrol (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) entinostat (ISO) ethanol (ISO) fenthion (ISO) fluoranthene (ISO) flutamide (EXP) flutriafol (ISO) folic acid (ISO) gentamycin (EXP) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) hesperetin (ISO) hydrogen peroxide (ISO) inulin (ISO) isoprenaline (ISO) isotretinoin (ISO) ivermectin (ISO) lead diacetate (EXP) mefenamic acid (ISO) melatonin (ISO) menadione (ISO) methapyrilene (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-acetyl-1,4-benzoquinone imine (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodimethylamine (EXP) N-ribosylnicotinamide (ISO) nefazodone (EXP) nickel sulfate (ISO) ochratoxin A (EXP) okadaic acid (ISO) oxaliplatin (EXP) oxidopamine (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) primaquine (ISO) pterostilbene (ISO) quercetin (ISO) quinacrine (ISO) rac-lactic acid (ISO) resveratrol (ISO) sarin (ISO) SB 431542 (ISO) scopolamine (EXP) silicon dioxide (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulforaphane (ISO) T-2 toxin (ISO) tacrine (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thalidomide (ISO) theophylline (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) ubiquinone-1 (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Loss of quinone reductase 2 function selectively facilitates learning behaviors.
Benoit CE, etal., J Neurosci. 2010 Sep 22;30(38):12690-700. doi: 10.1523/JNEUROSCI.2808-10.2010.
2.
Transthyretin: A key gene involved in the maintenance of memory capacities during aging.
Brouillette J and Quirion R, Neurobiol Aging. 2007 May 16.
3.
BALT development and augmentation of hyperoxic lung injury in mice deficient in NQO1 and NQO2.
Das A, etal., Free Radic Biol Med. 2006 May 15;40(10):1843-56. Epub 2006 Feb 17.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Association of superoxide dismutases and NAD(P)H quinone oxidoreductases with prognosis of patients with breast carcinomas.
Hubackova M, etal., Int J Cancer. 2012 Jan 15;130(2):338-48. doi: 10.1002/ijc.26006. Epub 2011 Apr 20.
6.
Disruption of dihydronicotinamide riboside:quinone oxidoreductase 2 (NQO2) leads to myeloid hyperplasia of bone marrow and decreased sensitivity to menadione toxicity.
Long DJ 2nd, etal., J Biol Chem 2002 Nov 29;277(48):46131-9. Epub 2002 Sep 25.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
NQO2 gene is associated with clozapine-induced agranulocytosis.
Ostrousky O, etal., Tissue Antigens. 2003 Dec;62(6):483-91.
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
Association of NRH:quinone oxidoreductase 2 gene promoter polymorphism with higher gene expression and increased susceptibility to Parkinson's disease.
Wang W, etal., J Gerontol A Biol Sci Med Sci. 2008 Feb;63(2):127-34.
14.
Resveratrol inhibits angiotensin II-induced ERK1/2 activation by downregulating quinone reductase 2 in rat vascular smooth muscle cells.
Zhang X, etal., J Biomed Res. 2012 Mar;26(2):103-9. doi: 10.1016/S1674-8301(12)60019-0.
15.
Downregulation of quinone reductase 2 attenuates vascular smooth muscle cells proliferation and neointimal formation in balloon injured rat carotid artery.
Zhang XW, etal., Cell Physiol Biochem. 2012;29(3-4):453-62. doi: 10.1159/000338499. Epub 2012 Apr 3.
Nqo2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 31,114,825 - 31,144,062 (-) NCBI GRCr8 mRatBN7.2 17 30,909,482 - 30,938,725 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 30,909,187 - 30,938,320 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 30,723,881 - 30,752,881 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 32,327,627 - 32,356,626 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 30,719,617 - 30,748,617 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 32,131,847 - 32,158,559 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 32,132,347 - 32,158,538 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 34,023,011 - 34,051,834 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 37,255,630 - 37,283,753 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 37,258,472 - 37,286,594 (-) NCBI Celera 17 30,474,024 - 30,502,465 (-) NCBI Celera Cytogenetic Map 17 p12 NCBI
NQO2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 2,999,894 - 3,019,755 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 2,987,987 - 3,019,755 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 3,000,128 - 3,019,989 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 2,945,066 - 2,964,993 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 2,945,229 - 2,964,993 NCBI Celera 6 4,229,080 - 4,249,008 (+) NCBI Celera Cytogenetic Map 6 p25.2 NCBI HuRef 6 2,873,204 - 2,893,131 (+) NCBI HuRef CHM1_1 6 3,002,428 - 3,022,361 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 2,868,796 - 2,888,657 (+) NCBI T2T-CHM13v2.0
Nqo2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 34,148,642 - 34,172,448 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 34,148,670 - 34,172,426 (+) Ensembl GRCm39 Ensembl GRCm38 13 33,964,655 - 33,988,465 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 33,964,687 - 33,988,443 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 34,056,528 - 34,080,334 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 33,972,216 - 33,993,112 (+) NCBI MGSCv36 mm8 Celera 13 35,093,939 - 35,117,741 (+) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 14.01 NCBI
Nqo2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955465 10,186,928 - 10,200,237 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955465 10,186,928 - 10,200,098 (-) NCBI ChiLan1.0 ChiLan1.0
NQO2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 17,613,398 - 17,647,746 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 13,606,253 - 13,645,470 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 2,819,422 - 2,844,765 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 2,928,021 - 2,947,304 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 2,928,021 - 2,947,304 (+) Ensembl panpan1.1 panPan2
NQO2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 3,294,776 - 3,315,438 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 3,294,850 - 3,312,836 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 3,301,901 - 3,322,549 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 3,350,127 - 3,370,739 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 3,350,161 - 3,370,710 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 3,225,857 - 3,246,468 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 3,248,146 - 3,268,605 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 4,580,552 - 4,601,200 (+) NCBI UU_Cfam_GSD_1.0
NQO2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 1,792,876 - 1,806,301 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 1,792,745 - 1,805,916 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 1,825,528 - 1,829,240 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NQO2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 69,149,197 - 69,168,476 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 69,147,937 - 69,161,045 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 2,937,996 - 2,957,287 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nqo2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 197 Count of miRNA genes: 135 Interacting mature miRNAs: 147 Transcripts: ENSRNOT00000024141 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 27389946 53481766 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 1581512 Cm55 Cardiac mass QTL 55 2.8 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 27027949 56836890 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 4889891 Eae32 Experimental allergic encephalomyelitis QTL 32 4.8 0.0002 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 27027949 36146731 Rat 4889955 Bss93 Bone structure and strength QTL 93 4.4 tibia size trait (VT:0100001) tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727) 17 27027949 60463643 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024141 ⟹ ENSRNOP00000024141
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 30,909,187 - 30,938,320 (-) Ensembl Rnor_6.0 Ensembl 17 32,132,347 - 32,158,538 (-) Ensembl
RefSeq Acc Id:
NM_001004214 ⟹ NP_001004214
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,115,124 - 31,143,662 (-) NCBI mRatBN7.2 17 30,909,781 - 30,938,320 (-) NCBI Rnor_6.0 17 32,132,140 - 32,158,164 (-) NCBI Rnor_5.0 17 34,023,011 - 34,051,834 (-) NCBI RGSC_v3.4 17 37,255,630 - 37,283,753 (-) RGD Celera 17 30,474,024 - 30,502,465 (-) RGD
Sequence:
GTGTTCCCTCCAGGAGGCAGAGACTGTTACAATAACCAAGGAGAGTGACAGTACCTGAAACTTCTGGCTATTGTATAAGATCAGAGAATCTGTCTTCTCCAACATGGCAGGTAAGAAAGTGCTCCTTG TCTATGCACACCAAGAACCCAAGTCCTTCAATGGGTCCATGAAGCAAGTGGCTGTTGAAGAACTGAGCAAGCAGGGATGCACAGTCACTGTGTCTGATTTATACACCATGAACTTCGAGCCAAGGGCC ACAAGAAACGATGTTACTGGTGCCCTCTCTAATCCTGAAGTCTTCAAATATGGGATAGAAGCCTATGAAGCCTACAAGAAGAAAGCTCTGACCAGTGACATACTTGAAGAGCAGAGAAAGGTGCAAGA AGCTGATCTAGTGATATTTCAGTTTCCACTATACTGGTTCAGCGTTCCAGCAATCCTAAAAGGCTGGATGGATAGGGTGCTGTGCCAAGGGTTTGCCTTCGATGTCCCAGGCTTTTATGACTCTGGTT TTCTCAAGGATAAACTAGCCCTCCTTTCCTTTACCACGGGAGGTACAGCAGAGATGTACACAAAAGCTGGGGTCAATGGAGATTTCCGGTACTTCCTGTGGCCACTTCAGCATGGTACATTGCACTTC TGTGGATTTAAAGTCCTTGCCCCACAGATCAGTTTTGGTCCTGAAGTTTCATCAGAAGAACAAAGAAAAGTGATGCTGGCATCATGGGTCCAGCGGCTGAAGAGCATCTGGAAGGAAGAACCCATCCA CTGCACACCCTCTTGGTACTTCCAAGGATAACATTTTATGCTCTGGGTACAGCTGACAAGCAACATAGTAAGAGACCTAAAGCACGGCAAAGAGAAGGTGGTGATGTATCCTGAGATGTATTTAACAG TGCCCACCAATGAGTGTCTTCAGTTTCATTCAACTCCATCAGATATTTTGAAAATAAGTTTGTTGCACTGTATTAGTTCTGCCTGGTTATTCACTCAGTTTTCTGTTCTTTAATGTTTCTCTAAAATT TTTCTTGCAACTTTTGTAGCATAATTTTCTGAACATGTTTCACTCAGTTTCCTGTTAATCATCTTCAAATGACTTCTATCTGCAGTTTCTTTATATTCCTTTCTACTTTATATTCCTTTCCATTCCTT TCCTCCCCTTCAGACCCTTATTCATTTATTAAAATATTTAGTGTATACATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_006253867 ⟹ XP_006253929
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,114,825 - 31,144,062 (-) NCBI mRatBN7.2 17 30,909,482 - 30,938,723 (-) NCBI Rnor_6.0 17 32,131,847 - 32,158,559 (-) NCBI Rnor_5.0 17 34,023,011 - 34,051,834 (-) NCBI
Sequence:
GATTGCCCAGTAGTACACTGTGGGGCTTTTCGTGCTGTTTTGCCTGGATATATTAGTGCCTGTGAAGGATAAGGTACAAGGCAGAAAGGCGCCACTACCTATCTCCCAGCACAGGCTTCTGGCCAGAT GCAAGGAGCGAAACTGGTTTTGCCCACAACCATGGGGCAGGAACTGCAAGGAGACTGGAGAGGAGGGAAGATTGAAGTCCAATGATTCTGCACTGACAGGCCCTAAAGGGAGTTGTGGGCGGGCTGTT GCCCACAAACGGCCAAAGACTGTTACAATAACCAAGGAGAGTGACAGTACCTGAAACTTCTGGCTATTGTATAAGATCAGAGAATCTGTCTTCTCCAACATGGCAGGTAAGAAAGTGCTCCTTGTCTA TGCACACCAAGAACCCAAGTCCTTCAATGGGTCCATGAAGCAAGTGGCTGTTGAAGAACTGAGCAAGCAGGGATGCACAGTCACTGTGTCTGATTTATACACCATGAACTTCGAGCCAAGGGCCACAA GAAACGATGTTACTGGTGCCCTCTCTAATCCTGAAGTCTTCAAATATGGGATAGAAGCCTATGAAGCCTACAAGAAGAAAGCTCTGACCAGTGACATACTTGAAGAGCAGAGAAAGGTGCAAGAAGCT GATCTAGTGATATTTCAGTTTCCACTATACTGGTTCAGCGTTCCAGCAATCCTAAAAGGCTGGATGGATAGGGTGCTGTGCCAAGGGTTTGCCTTCGATGTCCCAGGCTTTTATGACTCTGGTTTTCT CAAGGATAAACTAGCCCTCCTTTCCTTTACCACGGGAGGTACAGCAGAGATGTACACAAAAGCTGGGGTCAATGGAGATTTCCGGTACTTCCTGTGGCCACTTCAGCATGGTACATTGCACTTCTGTG GATTTAAAGTCCTTGCCCCACAGATCAGTTTTGGTCCTGAAGTTTCATCAGAAGAACAAAGAAAAGTGATGCTGGCATCATGGGTCCAGCGGCTGAAGAGCATCTGGAAGGAAGAACCCATCCACTGC ACACCCTCTTGGTACTTCCAAGGATAACATTTTATGCTCTGGGTACAGCTGACAAGCAACATAGTAAGAGACCTAAAGCACGGCAAAGAGAAGGTGGTGATGTATCCTGAGATGTATTTAACAGTGCC CACCAATGAGTGTCTTCAGTTTCATTCAACTCCATCAGATATTTTGAAAATAAGTTTGTTGCACTGTATTAGTTCTGCCTGGTTATTCACTCAGTTTTCTGTTCTTTAATGTTTCTCTAAAATTTTTC TTGCAACTTTTGTAGCATAATTTTCTGAACATGTTTCACTCAGTTTCCTGTTAATCATCTTCAAATGACTTCTATCTGCAGTTTCTTTATATTCCTTTCTACTTTATATTCCTTTCCATTCCTTTCCT CCCCTTCAGACCCTTATTCATTTATTAAAATATTTAGTGTATACATGAACACACATGTCACTGTGTGTGTGTGTTGTGATTTGAATGAGATAGCCCCATAGGCTTATATGTTTGACTATTTGGTCCCC AGTTGGTAGAACTGTTTGAGAAAGATTAGGAAGTGTGGCTTCATTGGATGCAGTGTCATTGGTTTTGTGGTTTCAAAAGACACTGGTCATCCCGTGTGTCCTCTGCCTGCTGCTTTTGGATGAAGACG TGAACACTCAGCTGTTCCTTCCTTTGCTCTGCCATCATGAACTCTAACTCTCTAAAACCATAAGCCCAATTAAATGCTTTCTTTTA
hide sequence
RefSeq Acc Id:
XM_006253868 ⟹ XP_006253930
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,114,825 - 31,143,777 (-) NCBI mRatBN7.2 17 30,909,482 - 30,938,435 (-) NCBI Rnor_6.0 17 32,131,847 - 32,158,263 (-) NCBI Rnor_5.0 17 34,023,011 - 34,051,834 (-) NCBI
Sequence:
GTGGGGAGTGGCCCTGGGCCCCCGTGCGCAGCCGCAGTGCCTGCCGGCACGCTATAGGCATTCCTGCCCTTGACAGTGGCTGTGTCGCGTTTGTGTGCAGTGTTCCCTCCAGGAGGCAGAGGTAAGAA AGTGCTCCTTGTCTATGCACACCAAGAACCCAAGTCCTTCAATGGGTCCATGAAGCAAGTGGCTGTTGAAGAACTGAGCAAGCAGGGATGCACAGTCACTGTGTCTGATTTATACACCATGAACTTCG AGCCAAGGGCCACAAGAAACGATGTTACTGGTGCCCTCTCTAATCCTGAAGTCTTCAAATATGGGATAGAAGCCTATGAAGCCTACAAGAAGAAAGCTCTGACCAGTGACATACTTGAAGAGCAGAGA AAGGTGCAAGAAGCTGATCTAGTGATATTTCAGTTTCCACTATACTGGTTCAGCGTTCCAGCAATCCTAAAAGGCTGGATGGATAGGGTGCTGTGCCAAGGGTTTGCCTTCGATGTCCCAGGCTTTTA TGACTCTGGTTTTCTCAAGGATAAACTAGCCCTCCTTTCCTTTACCACGGGAGGTACAGCAGAGATGTACACAAAAGCTGGGGTCAATGGAGATTTCCGGTACTTCCTGTGGCCACTTCAGCATGGTA CATTGCACTTCTGTGGATTTAAAGTCCTTGCCCCACAGATCAGTTTTGGTCCTGAAGTTTCATCAGAAGAACAAAGAAAAGTGATGCTGGCATCATGGGTCCAGCGGCTGAAGAGCATCTGGAAGGAA GAACCCATCCACTGCACACCCTCTTGGTACTTCCAAGGATAACATTTTATGCTCTGGGTACAGCTGACAAGCAACATAGTAAGAGACCTAAAGCACGGCAAAGAGAAGGTGGTGATGTATCCTGAGAT GTATTTAACAGTGCCCACCAATGAGTGTCTTCAGTTTCATTCAACTCCATCAGATATTTTGAAAATAAGTTTGTTGCACTGTATTAGTTCTGCCTGGTTATTCACTCAGTTTTCTGTTCTTTAATGTT TCTCTAAAATTTTTCTTGCAACTTTTGTAGCATAATTTTCTGAACATGTTTCACTCAGTTTCCTGTTAATCATCTTCAAATGACTTCTATCTGCAGTTTCTTTATATTCCTTTCTACTTTATATTCCT TTCCATTCCTTTCCTCCCCTTCAGACCCTTATTCATTTATTAAAATATTTAGTGTATACATGAACACACATGTCACTGTGTGTGTGTGTTGTGATTTGAATGAGATAGCCCCATAGGCTTATATGTTT GACTATTTGGTCCCCAGTTGGTAGAACTGTTTGAGAAAGATTAGGAAGTGTGGCTTCATTGGATGCAGTGTCATTGGTTTTGTGGTTTCAAAAGACACTGGTCATCCCGTGTGTCCTCTGCCTGCTGC TTTTGGATGAAGACGTGAACACTCAGCTGTTCCTTCCTTTGCTCTGCCATCATGAACTCTAACTCTCTAAAACCATAAGCCCAATTAAATGCTTTCTTTTA
hide sequence
RefSeq Acc Id:
XM_039095490 ⟹ XP_038951418
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,114,825 - 31,143,570 (-) NCBI mRatBN7.2 17 30,909,482 - 30,935,815 (-) NCBI
RefSeq Acc Id:
XM_039095491 ⟹ XP_038951419
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 31,114,825 - 31,144,057 (-) NCBI mRatBN7.2 17 30,909,482 - 30,938,725 (-) NCBI
RefSeq Acc Id:
NP_001004214 ⟸ NM_001004214
- UniProtKB:
Q6AY80 (UniProtKB/Swiss-Prot), A6J7H5 (UniProtKB/TrEMBL)
- Sequence:
MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFD VPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG
hide sequence
RefSeq Acc Id:
XP_006253929 ⟸ XM_006253867
- Peptide Label:
isoform X1
- UniProtKB:
Q6AY80 (UniProtKB/Swiss-Prot), A6J7H5 (UniProtKB/TrEMBL)
- Sequence:
MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFD VPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG
hide sequence
RefSeq Acc Id:
XP_006253930 ⟸ XM_006253868
- Peptide Label:
isoform X2
- UniProtKB:
A6J7H5 (UniProtKB/TrEMBL)
- Sequence:
MKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTT GGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG
hide sequence
Ensembl Acc Id:
ENSRNOP00000024141 ⟸ ENSRNOT00000024141
RefSeq Acc Id:
XP_038951419 ⟸ XM_039095491
- Peptide Label:
isoform X2
- UniProtKB:
A6J7H5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038951418 ⟸ XM_039095490
- Peptide Label:
isoform X1
- UniProtKB:
Q6AY80 (UniProtKB/Swiss-Prot), A6J7H5 (UniProtKB/TrEMBL)
RGD ID: 13700415
Promoter ID: EPDNEW_R10939
Type: initiation region
Name: Nqo2_1
Description: N-ribosyldihydronicotinamide:quinone reductase 2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R10940
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 32,158,204 - 32,158,264 EPDNEW
RGD ID: 13700416
Promoter ID: EPDNEW_R10940
Type: single initiation site
Name: Nqo2_2
Description: N-ribosyldihydronicotinamide:quinone reductase 2
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_R10939
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 32,158,558 - 32,158,618 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-08-03
Nqo2
N-ribosyldihydronicotinamide:quinone dehydrogenase 2
Nqo2
N-ribosyldihydronicotinamide:quinone reductase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2017-02-01
Nqo2
N-ribosyldihydronicotinamide:quinone reductase 2
Nqo2
NAD(P)H quinone dehydrogenase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2016-03-29
Nqo2
NAD(P)H quinone dehydrogenase 2
Nqo2
NAD(P)H dehydrogenase, quinone 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-03-30
Nqo2
NAD(P)H dehydrogenase, quinone 2
Symbol and Name status set to approved
1299863
APPROVED
2005-02-14
Nqo2
NAD(P)H dehydrogenase, quinone 2
Symbol and Name status set to provisional
70820
PROVISIONAL