Symbol:
Gsn
Name:
gelsolin
RGD ID:
1303089
Description:
Enables actin binding activity. Involved in several processes, including actin filament depolymerization; oligodendrocyte development; and positive regulation of p38MAPK cascade. Located in several cellular components, including apical ectoplasmic specialization; basal ectoplasmic specialization; and cytoskeleton. Part of protein-containing complex. Biomarker of hypothyroidism; lung disease; and myocardial infarction. Human ortholog(s) of this gene implicated in Finnish type amyloidosis. Orthologous to human GSN (gelsolin); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; N-cadherin signaling pathway; Fc gamma receptor mediated signaling pathway; INTERACTS WITH 1,3-dinitrobenzene; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
actin-depolymerizing factor; ADF; brevin; MGC95032
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GSN (gelsolin) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Gsn (gelsolin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gsn (gelsolin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GSN (gelsolin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GSN (gelsolin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gsn (gelsolin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GSN (gelsolin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GSN (gelsolin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gsn (gelsolin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ZNF322 (zinc finger protein 322) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
GSN (gelsolin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gsn (gelsolin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gsnb (gelsolin b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
gsna (gelsolin a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Gel
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
gsnl-1
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
qua
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
gsn
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 38,982,605 - 39,035,849 (+) NCBI GRCr8 mRatBN7.2 3 18,585,166 - 18,638,404 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 18,585,172 - 18,638,402 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 21,683,799 - 21,710,538 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 30,268,837 - 30,295,574 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 28,522,714 - 28,549,446 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 14,456,106 - 14,508,922 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 14,467,330 - 14,508,911 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 19,773,655 - 19,826,463 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 14,360,245 - 14,386,313 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 14,256,616 - 14,282,685 (+) NCBI Celera 3 13,325,045 - 13,351,501 (+) NCBI Celera Cytogenetic Map 3 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gsn Rat (1->4)-beta-D-glucan multiple interactions ISO Gsn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GSN mRNA CTD PMID:36331819 Gsn Rat 1,2-dimethylhydrazine multiple interactions ISO Gsn (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GSN mRNA CTD PMID:22206623 Gsn Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of GSN mRNA CTD PMID:21983209 Gsn Rat 17beta-estradiol affects expression ISO GSN (Homo sapiens) 6480464 Estradiol affects the expression of GSN mRNA CTD PMID:22574217 Gsn Rat 17beta-estradiol increases expression ISO Gsn (Mus musculus) 6480464 Estradiol results in increased expression of GSN mRNA CTD PMID:39298647 Gsn Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of GSN mRNA CTD PMID:32145629 Gsn Rat 17beta-estradiol multiple interactions ISO Gsn (Mus musculus) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of GSN mRNA CTD PMID:18556351 Gsn Rat 17beta-estradiol multiple interactions ISO GSN (Homo sapiens) 6480464 [Estradiol results in increased activity of ESR1 protein] which results in decreased expression of GSN mRNA and Estradiol inhibits the reaction [ESR1 protein binds to GSN protein] CTD PMID:22403704 and PMID:29389661 Gsn Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO GSN (Homo sapiens) 6480464 [Metribolone binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to GSN protein modified form] CTD PMID:28751236 Gsn Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gsn (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSN mRNA CTD PMID:20044593 and PMID:33956508 Gsn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gsn (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GSN mRNA CTD PMID:26377647 Gsn Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GSN (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GSN mRNA CTD PMID:20044593 more ... Gsn Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GSN mRNA CTD PMID:22298810 and PMID:34747641 Gsn Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GSN mRNA CTD PMID:21215274 Gsn Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gsn (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GSN mRNA CTD PMID:17035482 and PMID:19770486 Gsn Rat 2,3-dimethoxynaphthalene-1,4-dione decreases expression ISO GSN (Homo sapiens) 6480464 2 more ... CTD PMID:17547211 Gsn Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Gsn (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in decreased expression of GSN mRNA] CTD PMID:18200517 Gsn Rat 2,4,6-trinitrobenzenesulfonic acid decreases expression ISO Gsn (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in decreased expression of GSN mRNA CTD PMID:17982090 and PMID:18200517 Gsn Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Gsn (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Gsn Rat 2,5-hexanedione decreases expression EXP 6480464 2 and 5-hexanedione results in decreased expression of GSN protein CTD PMID:19033394 Gsn Rat 2,6-dimethoxyphenol multiple interactions ISO GSN (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of GSN protein CTD PMID:38598786 Gsn Rat 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile affects expression EXP 6480464 Verapamil affects the expression of GSN protein CTD PMID:23533533 Gsn Rat 2-bromohexadecanoic acid multiple interactions ISO GSN (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GSN protein] CTD PMID:38195004 Gsn Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO GSN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of GSN mRNA CTD PMID:28628672 Gsn Rat 4,4'-diaminodiphenylmethane decreases expression ISO Gsn (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of GSN mRNA CTD PMID:18648102 Gsn Rat 4,4'-sulfonyldiphenol multiple interactions ISO GSN (Homo sapiens) 6480464 bisphenol S inhibits the reaction [ESR1 protein binds to GSN protein] CTD PMID:29389661 Gsn Rat 4,4'-sulfonyldiphenol increases expression ISO Gsn (Mus musculus) 6480464 bisphenol S results in increased expression of GSN mRNA CTD PMID:30951980 Gsn Rat 4-hydroxynon-2-enal increases expression ISO Gsn (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of GSN mRNA CTD PMID:19191707 Gsn Rat 5-aza-2'-deoxycytidine multiple interactions ISO GSN (Homo sapiens) 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of GSN mRNA] CTD PMID:21095227 Gsn Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GSN mRNA CTD PMID:24780913 and PMID:25825206 Gsn Rat acetylsalicylic acid affects expression EXP 6480464 Aspirin affects the expression of GSN protein CTD PMID:23533533 Gsn Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of GSN mRNA CTD PMID:28959563 Gsn Rat acrylamide increases expression ISO GSN (Homo sapiens) 6480464 Acrylamide results in increased expression of GSN mRNA CTD PMID:38554842 Gsn Rat aflatoxin B1 affects expression ISO GSN (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of GSN protein CTD PMID:20106945 Gsn Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of GSN mRNA CTD PMID:33354967 Gsn Rat aflatoxin B1 increases expression ISO GSN (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of GSN mRNA CTD PMID:21632981 more ... Gsn Rat Aflatoxin B2 alpha increases methylation ISO GSN (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of GSN intron CTD PMID:30157460 Gsn Rat aldehydo-D-glucose decreases secretion ISO GSN (Homo sapiens) 6480464 Glucose deficiency results in decreased secretion of GSN protein CTD PMID:24802182 Gsn Rat all-trans-retinoic acid increases expression ISO Gsn (Mus musculus) 6480464 Tretinoin results in increased expression of GSN mRNA CTD PMID:16604517 Gsn Rat all-trans-retinoic acid multiple interactions ISO Gsn (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of GSN mRNA CTD PMID:30951980 Gsn Rat all-trans-retinoic acid increases expression ISO GSN (Homo sapiens) 6480464 Tretinoin results in increased expression of GSN mRNA CTD PMID:15498508 more ... Gsn Rat aminoglutethimide decreases expression ISO GSN (Homo sapiens) 6480464 Aminoglutethimide results in decreased expression of GSN protein CTD PMID:26102013 Gsn Rat amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of GSN mRNA CTD PMID:17991464 Gsn Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of GSN mRNA CTD PMID:38685447 Gsn Rat arabinogalactan decreases expression EXP 329333030 arabinogalactan decreases expression of Gsn protein in heart RGD Gsn Rat aristolochic acid A decreases expression ISO GSN (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GSN mRNA CTD PMID:33212167 Gsn Rat arsane multiple interactions ISO GSN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GSN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GSN mRNA CTD PMID:39836092 Gsn Rat arsenic atom multiple interactions ISO GSN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GSN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GSN mRNA CTD PMID:39836092 Gsn Rat arsenous acid multiple interactions ISO GSN (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to GSN protein] CTD PMID:26598702 Gsn Rat atrazine increases expression ISO GSN (Homo sapiens) 6480464 Atrazine results in increased expression of GSN mRNA CTD PMID:22378314 Gsn Rat Azoxymethane multiple interactions ISO Gsn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GSN mRNA CTD PMID:29950665 Gsn Rat benzo[a]pyrene increases expression ISO GSN (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of GSN mRNA CTD PMID:22316170 Gsn Rat benzo[a]pyrene affects methylation ISO GSN (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GSN 5' UTR CTD PMID:27901495 Gsn Rat benzo[a]pyrene decreases expression ISO Gsn (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GSN mRNA CTD PMID:19770486 and PMID:22228805 Gsn Rat bilirubin IXalpha decreases expression ISO GSN (Homo sapiens) 6480464 Bilirubin results in decreased expression of GSN mRNA CTD PMID:20196124 Gsn Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in decreased expression of GSN mRNA CTD PMID:25031359 Gsn Rat bis(2-ethylhexyl) phthalate increases expression ISO GSN (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of GSN mRNA CTD PMID:31163220 Gsn Rat bisphenol A multiple interactions ISO GSN (Homo sapiens) 6480464 [bisphenol A binds to and affects the folding of AR protein] inhibits the reaction [AR protein modified form binds to GSN protein modified form] more ... CTD PMID:22403704 more ... Gsn Rat bisphenol A decreases methylation ISO GSN (Homo sapiens) 6480464 bisphenol A results in decreased methylation of GSN gene CTD PMID:31601247 Gsn Rat bisphenol A increases expression ISO Gsn (Mus musculus) 6480464 bisphenol A results in increased expression of GSN mRNA CTD PMID:30951980 more ... Gsn Rat bisphenol A affects expression ISO GSN (Homo sapiens) 6480464 bisphenol A affects the expression of GSN mRNA CTD PMID:30903817 Gsn Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GSN mRNA CTD PMID:30816183 more ... Gsn Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GSN mRNA CTD PMID:25181051 and PMID:32145629 Gsn Rat bisphenol AF increases expression ISO GSN (Homo sapiens) 6480464 bisphenol AF results in increased expression of GSN protein CTD PMID:34186270 Gsn Rat bisphenol AF multiple interactions ISO GSN (Homo sapiens) 6480464 [bisphenol AF binds to and affects the folding of AR protein] inhibits the reaction [AR protein modified form binds to GSN protein modified form] CTD PMID:28751236 Gsn Rat Bisphenol B increases expression ISO GSN (Homo sapiens) 6480464 bisphenol B results in increased expression of GSN protein CTD PMID:34186270 Gsn Rat bisphenol F increases expression ISO Gsn (Mus musculus) 6480464 bisphenol F results in increased expression of GSN mRNA CTD PMID:30951980 and PMID:36706583 Gsn Rat bisphenol F increases expression ISO GSN (Homo sapiens) 6480464 bisphenol F results in increased expression of GSN protein CTD PMID:34186270 Gsn Rat bisphenol F multiple interactions ISO Gsn (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of GSN mRNA CTD PMID:30951980 Gsn Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of GSN protein CTD PMID:25933445 Gsn Rat butyric acid increases expression ISO GSN (Homo sapiens) 6480464 Butyric Acid results in increased expression of GSN mRNA CTD PMID:34581912 Gsn Rat cadmium atom decreases expression ISO GSN (Homo sapiens) 6480464 Cadmium results in decreased expression of GSN mRNA CTD PMID:17547211 Gsn Rat cadmium atom affects binding ISO GSN (Homo sapiens) 6480464 GSN protein binds to Cadmium CTD PMID:23896426 Gsn Rat cadmium atom increases oxidation ISO Gsn (Mus musculus) 6480464 Cadmium results in increased oxidation of GSN protein CTD PMID:24077948 Gsn Rat cadmium atom affects localization EXP 6480464 Cadmium affects the localization of GSN protein CTD PMID:22553113 Gsn Rat cadmium atom multiple interactions ISO GSN (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GSN protein] more ... CTD PMID:33040242 and PMID:38195004 Gsn Rat cadmium dichloride decreases expression ISO GSN (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of GSN mRNA CTD PMID:17547211 Gsn Rat cadmium dichloride increases expression ISO GSN (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GSN mRNA CTD PMID:38382870 Gsn Rat cadmium dichloride multiple interactions ISO GSN (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of GSN protein] more ... CTD PMID:33040242 and PMID:38195004 Gsn Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of GSN promoter CTD PMID:22457795 Gsn Rat calcitriol increases expression ISO GSN (Homo sapiens) 6480464 Calcitriol results in increased expression of GSN mRNA CTD PMID:21592394 Gsn Rat calcitriol multiple interactions ISO GSN (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of GSN mRNA CTD PMID:21592394 Gsn Rat cannabidiol multiple interactions ISO GSN (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in increased expression of GSN protein CTD PMID:34122009 Gsn Rat cantharidin decreases expression ISO Gsn (Mus musculus) 6480464 Cantharidin results in decreased expression of GSN mRNA CTD PMID:36907384 Gsn Rat carbon nanotube multiple interactions ISO GSN (Homo sapiens) 6480464 [Nanotubes and Carbon co-treated with calfactant] results in decreased expression of GSN protein CTD PMID:23026733 Gsn Rat carbon nanotube decreases expression ISO Gsn (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Gsn Rat ciguatoxin CTX1B affects expression ISO Gsn (Mus musculus) 6480464 Ciguatoxins affects the expression of GSN mRNA CTD PMID:18353800 Gsn Rat cisplatin increases expression ISO Gsn (Mus musculus) 6480464 Cisplatin results in increased expression of GSN mRNA CTD PMID:21151649 Gsn Rat cobalt dichloride decreases expression ISO GSN (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of GSN mRNA CTD PMID:19320972 Gsn Rat cocaine decreases expression ISO GSN (Homo sapiens) 6480464 Cocaine results in decreased expression of GSN mRNA CTD PMID:12629581 Gsn Rat copper atom affects binding ISO GSN (Homo sapiens) 6480464 GSN protein binds to Copper CTD PMID:23896426 Gsn Rat copper(0) affects binding ISO GSN (Homo sapiens) 6480464 GSN protein binds to Copper CTD PMID:23896426 Gsn Rat copper(II) chloride increases expression ISO GSN (Homo sapiens) 6480464 cupric chloride results in increased expression of GSN mRNA CTD PMID:38568856 Gsn Rat corosolic acid increases expression ISO GSN (Homo sapiens) 6480464 corosolic acid results in increased expression of GSN mRNA CTD PMID:37939859 Gsn Rat cumene decreases expression ISO Gsn (Mus musculus) 6480464 cumene results in decreased expression of GSN mRNA CTD PMID:18648096 Gsn Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GSN mRNA CTD PMID:26577399 and PMID:27523638 Gsn Rat Cuprizon multiple interactions ISO GSN (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in increased expression of GSN protein CTD PMID:34122009 Gsn Rat curcumin multiple interactions ISO Gsn (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in decreased expression of GSN mRNA] CTD PMID:18200517 Gsn Rat cyclosporin A decreases expression ISO GSN (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GSN mRNA CTD PMID:20106945 more ... Gsn Rat D-glucose decreases secretion ISO GSN (Homo sapiens) 6480464 Glucose deficiency results in decreased secretion of GSN protein CTD PMID:24802182 Gsn Rat DDE decreases expression ISO GSN (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of GSN mRNA CTD PMID:38568856 Gsn Rat DDT multiple interactions ISO GSN (Homo sapiens) 6480464 [DDT results in increased activity of ESR1 protein] which results in decreased expression of GSN mRNA CTD PMID:22403704 Gsn Rat dexamethasone increases expression ISO Gsn (Mus musculus) 6480464 Dexamethasone results in increased expression of GSN mRNA CTD PMID:22733784 Gsn Rat dexamethasone multiple interactions ISO GSN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of GSN mRNA CTD PMID:28628672 Gsn Rat dexamethasone increases expression ISO GSN (Homo sapiens) 6480464 Dexamethasone results in increased expression of GSN mRNA CTD PMID:25047013 Gsn Rat dextran sulfate multiple interactions ISO Gsn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GSN mRNA CTD PMID:29950665 Gsn Rat diarsenic trioxide multiple interactions ISO GSN (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to GSN protein] CTD PMID:26598702 Gsn Rat dibutyl phthalate increases expression ISO Gsn (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of GSN mRNA CTD PMID:21266533 Gsn Rat diclofenac decreases expression ISO Gsn (Mus musculus) 6480464 Diclofenac results in decreased expression of GSN mRNA CTD PMID:26934552 Gsn Rat diethyl maleate decreases reduction ISO Gsn (Mus musculus) 6480464 diethyl maleate results in decreased reduction of GSN protein CTD PMID:19843705 Gsn Rat dimethylselenide multiple interactions ISO GSN (Homo sapiens) 6480464 [[Hydroxyl Radical results in increased oxidation of dimethylselenide] which results in decreased expression of GSN-AS1 mRNA] which results in decreased expression of GSN mRNA and [[Ozone results in increased oxidation of dimethylselenide] which results in decreased expression of GSN-AS1 mRNA] which results in decreased expression of GSN mRNA CTD PMID:33656867 Gsn Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of GSN mRNA CTD PMID:25152437 Gsn Rat dorsomorphin multiple interactions ISO GSN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gsn Rat doxorubicin increases expression ISO Gsn (Mus musculus) 6480464 Doxorubicin results in increased expression of GSN mRNA CTD PMID:15033991 Gsn Rat doxorubicin increases expression ISO GSN (Homo sapiens) 6480464 Doxorubicin results in increased expression of GSN mRNA CTD PMID:29803840 Gsn Rat elemental selenium increases expression ISO GSN (Homo sapiens) 6480464 Selenium results in increased expression of GSN mRNA CTD PMID:19244175 Gsn Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of GSN mRNA CTD PMID:29391264 Gsn Rat entinostat increases expression ISO GSN (Homo sapiens) 6480464 entinostat results in increased expression of GSN mRNA CTD PMID:27188386 Gsn Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of GSN mRNA CTD PMID:23962444 Gsn Rat folic acid multiple interactions ISO Gsn (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GSN mRNA CTD PMID:22206623 Gsn Rat fulvestrant multiple interactions ISO GSN (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of GSN gene CTD PMID:31601247 Gsn Rat furan increases expression EXP 6480464 furan results in increased expression of GSN mRNA CTD PMID:27387713 Gsn Rat furfural multiple interactions ISO GSN (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of GSN protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of GSN protein CTD PMID:38598786 Gsn Rat genistein multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in decreased expression of GSN mRNA CTD PMID:25031359 Gsn Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of GSN protein CTD PMID:22061828 Gsn Rat glucose decreases secretion ISO GSN (Homo sapiens) 6480464 Glucose deficiency results in decreased secretion of GSN protein CTD PMID:24802182 Gsn Rat gold atom decreases expression ISO Gsn (Mus musculus) 6480464 Gold analog results in decreased expression of GSN protein CTD PMID:24780912 Gsn Rat gold atom increases degradation ISO GSN (Homo sapiens) 6480464 Gold analog results in increased degradation of GSN protein CTD PMID:26551149 Gsn Rat gold(0) decreases expression ISO Gsn (Mus musculus) 6480464 Gold analog results in decreased expression of GSN protein CTD PMID:24780912 Gsn Rat gold(0) increases degradation ISO GSN (Homo sapiens) 6480464 Gold analog results in increased degradation of GSN protein CTD PMID:26551149 Gsn Rat GW 4064 increases expression ISO Gsn (Mus musculus) 6480464 GW 4064 results in increased expression of GSN mRNA CTD PMID:26655953 Gsn Rat hyaluronic acid multiple interactions EXP 6480464 [Hyaluronic Acid analog co-treated with Hydrogen Peroxide] results in decreased expression of GSN protein CTD PMID:23178681 Gsn Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of GSN protein CTD PMID:23178681 Gsn Rat hydralazine multiple interactions ISO GSN (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of GSN mRNA CTD PMID:17183730 Gsn Rat hydrogen peroxide affects expression ISO GSN (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of GSN mRNA CTD PMID:20044591 Gsn Rat hydrogen peroxide multiple interactions EXP 6480464 [Hyaluronic Acid analog co-treated with Hydrogen Peroxide] results in decreased expression of GSN protein CTD PMID:23178681 Gsn Rat hydrogen peroxide decreases secretion ISO Gsn (Mus musculus) 6480464 Hydrogen Peroxide results in decreased secretion of GSN mRNA CTD PMID:21179422 Gsn Rat hydroxyl multiple interactions ISO GSN (Homo sapiens) 6480464 [[Hydroxyl Radical results in increased oxidation of dimethylselenide] which results in decreased expression of GSN-AS1 mRNA] which results in decreased expression of GSN mRNA CTD PMID:33656867 Gsn Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of GSN mRNA CTD PMID:21396975 Gsn Rat indometacin multiple interactions ISO GSN (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of GSN mRNA CTD PMID:28628672 Gsn Rat inulin multiple interactions ISO Gsn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of GSN mRNA CTD PMID:36331819 Gsn Rat ivermectin decreases expression ISO GSN (Homo sapiens) 6480464 Ivermectin results in decreased expression of GSN protein CTD PMID:32959892 Gsn Rat lead(0) affects expression ISO GSN (Homo sapiens) 6480464 Lead affects the expression of GSN mRNA CTD PMID:28903495 Gsn Rat lipopolysaccharide increases expression ISO Gsn (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of GSN mRNA CTD PMID:27339419 Gsn Rat manganese atom multiple interactions ISO GSN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GSN mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSN mRNA CTD PMID:39836092 Gsn Rat manganese(0) multiple interactions ISO GSN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GSN mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSN mRNA CTD PMID:39836092 Gsn Rat manganese(II) chloride multiple interactions ISO GSN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GSN mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of GSN mRNA CTD PMID:39836092 Gsn Rat medroxyprogesterone acetate increases expression ISO GSN (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in increased expression of GSN mRNA CTD PMID:18497975 Gsn Rat menadione affects response to substance ISO GSN (Homo sapiens) 6480464 GSN mRNA affects the susceptibility to Vitamin K 3 CTD PMID:14652020 and PMID:15033777 Gsn Rat mercury atom decreases expression ISO GSN (Homo sapiens) 6480464 Mercury results in decreased expression of GSN mRNA CTD PMID:17547211 Gsn Rat mercury atom affects expression ISO GSN (Homo sapiens) 6480464 Mercury affects the expression of GSN protein CTD PMID:22030286 Gsn Rat mercury(0) decreases expression ISO GSN (Homo sapiens) 6480464 Mercury results in decreased expression of GSN mRNA CTD PMID:17547211 Gsn Rat mercury(0) affects expression ISO GSN (Homo sapiens) 6480464 Mercury affects the expression of GSN protein CTD PMID:22030286 Gsn Rat metformin increases expression ISO GSN (Homo sapiens) 6480464 Metformin results in increased expression of GSN mRNA CTD PMID:19022234 Gsn Rat methotrexate increases expression ISO GSN (Homo sapiens) 6480464 Methotrexate results in increased expression of GSN mRNA CTD PMID:21678067 Gsn Rat methylmercury chloride decreases expression ISO GSN (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of GSN mRNA CTD PMID:23179753 and PMID:28001369 Gsn Rat methylseleninic acid increases expression ISO GSN (Homo sapiens) 6480464 methylselenic acid results in increased expression of GSN mRNA CTD PMID:18548127 Gsn Rat microcystin-LR increases expression ISO Gsn (Mus musculus) 6480464 cyanoginosin LR results in increased expression of GSN mRNA CTD PMID:17654400 Gsn Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of GSN mRNA CTD PMID:21515302 Gsn Rat N-nitrosodimethylamine decreases expression ISO GSN (Homo sapiens) 6480464 Dimethylnitrosamine results in decreased expression of GSN mRNA CTD PMID:17547211 Gsn Rat navitoclax increases cleavage ISO GSN (Homo sapiens) 6480464 navitoclax results in increased cleavage of GSN protein CTD PMID:21562047 Gsn Rat nickel atom affects binding ISO GSN (Homo sapiens) 6480464 GSN protein binds to Nickel CTD PMID:23896426 Gsn Rat nickel atom decreases expression ISO GSN (Homo sapiens) 6480464 Nickel results in decreased expression of GSN mRNA CTD PMID:25583101 Gsn Rat nickel sulfate increases expression ISO GSN (Homo sapiens) 6480464 nickel sulfate results in increased expression of GSN mRNA CTD PMID:18651567 Gsn Rat nitrates multiple interactions ISO Gsn (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GSN mRNA CTD PMID:35964746 Gsn Rat nitric oxide increases expression ISO Gsn (Mus musculus) 6480464 Nitric Oxide deficiency results in increased expression of GSN mRNA CTD PMID:15878706 Gsn Rat nitroglycerin increases expression EXP 6480464 Nitroglycerin results in increased expression of GSN mRNA CTD PMID:12187120 Gsn Rat ozone multiple interactions ISO GSN (Homo sapiens) 6480464 [[Ozone results in increased oxidation of dimethylselenide] which results in decreased expression of GSN-AS1 mRNA] which results in decreased expression of GSN mRNA CTD PMID:33656867 Gsn Rat ozone multiple interactions ISO Gsn (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of GSN mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of GSN mRNA CTD PMID:34911549 Gsn Rat p-menthan-3-ol decreases expression ISO GSN (Homo sapiens) 6480464 Menthol results in decreased expression of GSN mRNA CTD PMID:26760959 Gsn Rat paclitaxel decreases expression ISO GSN (Homo sapiens) 6480464 Paclitaxel results in decreased expression of GSN mRNA CTD PMID:15000894 Gsn Rat paracetamol affects expression ISO Gsn (Mus musculus) 6480464 Acetaminophen affects the expression of GSN mRNA CTD PMID:17562736 Gsn Rat paracetamol decreases expression ISO GSN (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GSN mRNA CTD PMID:29067470 Gsn Rat paracetamol multiple interactions ISO Gsn (Mus musculus) 6480464 [CTH gene mutant form results in increased susceptibility to Acetaminophen] which results in increased expression of GSN protein CTD PMID:25499718 Gsn Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of GSN protein CTD PMID:16099942 Gsn Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:21673325 Gsn Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gsn (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GSN mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of GSN mRNA CTD PMID:36331819 Gsn Rat phenethyl isothiocyanate increases expression ISO GSN (Homo sapiens) 6480464 phenethyl isothiocyanate results in increased expression of GSN mRNA CTD PMID:26678675 Gsn Rat phenobarbital multiple interactions ISO Gsn (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of GSN mRNA] CTD PMID:19482888 Gsn Rat phenobarbital decreases expression ISO Gsn (Mus musculus) 6480464 Phenobarbital results in decreased expression of GSN mRNA CTD PMID:19482888 Gsn Rat phenylhydrazine affects response to substance ISO Gsn (Mus musculus) 6480464 GSN protein affects the susceptibility to phenylhydrazine CTD PMID:22271892 Gsn Rat pirinixic acid multiple interactions ISO Gsn (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of GSN mRNA CTD PMID:19710929 Gsn Rat pirinixic acid increases expression ISO Gsn (Mus musculus) 6480464 pirinixic acid results in increased expression of GSN mRNA CTD PMID:23811191 Gsn Rat pirinixic acid decreases expression ISO Gsn (Mus musculus) 6480464 pirinixic acid results in decreased expression of GSN mRNA CTD PMID:17426115 Gsn Rat potassium dichromate increases expression ISO GSN (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of GSN protein CTD PMID:23718831 Gsn Rat progesterone multiple interactions ISO Gsn (Mus musculus) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of GSN mRNA CTD PMID:18556351 Gsn Rat quercetin increases expression ISO GSN (Homo sapiens) 6480464 Quercetin results in increased expression of GSN mRNA CTD PMID:21632981 Gsn Rat resveratrol multiple interactions ISO GSN (Homo sapiens) 6480464 [resveratrol results in increased activity of CASP3 protein] which results in increased cleavage of GSN protein CTD PMID:19423619 Gsn Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression ISO Gsn (Mus musculus) 6480464 Buthionine Sulfoximine results in increased expression of GSN mRNA CTD PMID:15878706 Gsn Rat SB 431542 multiple interactions ISO GSN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gsn Rat selenium atom increases expression ISO GSN (Homo sapiens) 6480464 Selenium results in increased expression of GSN mRNA CTD PMID:19244175 Gsn Rat silicon dioxide decreases expression ISO GSN (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of GSN mRNA CTD PMID:25895662 Gsn Rat sodium arsenite affects expression ISO Gsn (Mus musculus) 6480464 sodium arsenite affects the expression of GSN mRNA CTD PMID:17450228 Gsn Rat sodium arsenite multiple interactions ISO GSN (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of GSN mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GSN mRNA CTD PMID:39836092 Gsn Rat sodium arsenite increases expression ISO GSN (Homo sapiens) 6480464 sodium arsenite results in increased expression of GSN mRNA CTD PMID:38568856 Gsn Rat sodium arsenite decreases expression ISO Gsn (Mus musculus) 6480464 sodium arsenite results in decreased expression of GSN mRNA and sodium arsenite results in decreased expression of GSN protein CTD PMID:29044176 and PMID:37682722 Gsn Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of GSN protein CTD PMID:29459688 Gsn Rat sodium chloride multiple interactions ISO GSN (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of GSN protein more ... CTD PMID:38598786 Gsn Rat sodium fluoride decreases expression ISO Gsn (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of GSN protein CTD PMID:28918527 Gsn Rat Sodium salicylate increases cleavage ISO GSN (Homo sapiens) 6480464 Sodium Salicylate results in increased cleavage of GSN protein CTD PMID:10090950 Gsn Rat Soman increases expression EXP 6480464 Soman results in increased expression of GSN mRNA CTD PMID:19281266 Gsn Rat succimer multiple interactions ISO Gsn (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of GSN mRNA CTD PMID:26378955 Gsn Rat sulforaphane decreases expression ISO GSN (Homo sapiens) 6480464 sulforaphane results in decreased expression of GSN mRNA CTD PMID:31838189 Gsn Rat sulforaphane increases methylation ISO GSN (Homo sapiens) 6480464 sulforaphane results in increased methylation of GSN gene CTD PMID:31838189 Gsn Rat sunitinib decreases expression ISO GSN (Homo sapiens) 6480464 Sunitinib results in decreased expression of GSN mRNA CTD PMID:31533062 Gsn Rat tamibarotene increases expression ISO GSN (Homo sapiens) 6480464 tamibarotene results in increased expression of GSN mRNA CTD PMID:15498508 Gsn Rat temozolomide decreases expression ISO GSN (Homo sapiens) 6480464 Temozolomide results in decreased expression of GSN mRNA CTD PMID:31758290 Gsn Rat tert-butyl hydroperoxide increases expression ISO Gsn (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of GSN mRNA CTD PMID:15003993 Gsn Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of GSN mRNA CTD PMID:21515302 Gsn Rat testosterone multiple interactions ISO GSN (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of GSN mRNA CTD PMID:21592394 Gsn Rat testosterone increases expression ISO Gsn (Mus musculus) 6480464 Testosterone results in increased expression of GSN mRNA CTD PMID:20403060 Gsn Rat testosterone increases expression ISO GSN (Homo sapiens) 6480464 Testosterone results in increased expression of GSN mRNA CTD PMID:21592394 Gsn Rat tetrachloromethane increases expression ISO Gsn (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of GSN mRNA CTD PMID:27339419 Gsn Rat tetrahydropalmatine decreases expression ISO GSN (Homo sapiens) 6480464 tetrahydropalmatine results in decreased expression of GSN protein CTD PMID:20109541 Gsn Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of GSN protein CTD PMID:35544339 Gsn Rat titanium dioxide decreases expression ISO Gsn (Mus musculus) 6480464 titanium dioxide results in decreased expression of GSN mRNA CTD PMID:23557971 and PMID:27760801 Gsn Rat titanium dioxide decreases methylation ISO Gsn (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GSN gene and titanium dioxide results in decreased methylation of GSN promoter CTD PMID:35295148 Gsn Rat titanium dioxide multiple interactions ISO Gsn (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GSN mRNA CTD PMID:29950665 Gsn Rat toxaphene increases degradation ISO GSN (Homo sapiens) 6480464 Toxaphene results in increased degradation of GSN protein CTD PMID:12139946 Gsn Rat toxaphene multiple interactions ISO GSN (Homo sapiens) 6480464 CAT protein inhibits the reaction [Toxaphene results in increased degradation of GSN protein] CTD PMID:12139946 Gsn Rat trichostatin A increases expression ISO GSN (Homo sapiens) 6480464 trichostatin A results in increased expression of GSN mRNA CTD PMID:24935251 and PMID:26272509 Gsn Rat trichostatin A affects expression ISO GSN (Homo sapiens) 6480464 trichostatin A affects the expression of GSN mRNA CTD PMID:28542535 Gsn Rat trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of GSN protein CTD PMID:12445420 Gsn Rat trichostatin A multiple interactions ISO GSN (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GSN mRNA CTD PMID:27188386 Gsn Rat triphenyl phosphate affects expression ISO GSN (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GSN mRNA CTD PMID:37042841 Gsn Rat troglitazone decreases expression ISO Gsn (Mus musculus) 6480464 troglitazone results in decreased expression of GSN mRNA CTD PMID:28973697 Gsn Rat troglitazone increases expression ISO GSN (Homo sapiens) 6480464 troglitazone results in increased expression of GSN mRNA CTD PMID:22684020 Gsn Rat troglitazone decreases expression ISO GSN (Homo sapiens) 6480464 troglitazone results in decreased expression of GSN mRNA CTD PMID:19022234 Gsn Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of GSN mRNA CTD PMID:19022234 Gsn Rat urethane decreases expression ISO Gsn (Mus musculus) 6480464 Urethane results in decreased expression of GSN mRNA CTD PMID:16289808 Gsn Rat valproic acid multiple interactions ISO GSN (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of GSN mRNA more ... CTD PMID:17183730 and PMID:27188386 Gsn Rat valproic acid increases expression ISO GSN (Homo sapiens) 6480464 Valproic Acid results in increased expression of GSN mRNA CTD PMID:19101580 more ... Gsn Rat valproic acid increases expression ISO Gsn (Mus musculus) 6480464 Valproic Acid results in increased expression of GSN mRNA CTD PMID:20546886 Gsn Rat verapamil affects expression EXP 6480464 Verapamil affects the expression of GSN protein CTD PMID:23533533 Gsn Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of GSN mRNA CTD PMID:19015723 Gsn Rat vitamin E increases expression ISO GSN (Homo sapiens) 6480464 Vitamin E results in increased expression of GSN mRNA CTD PMID:19244175 Gsn Rat vorinostat decreases expression ISO GSN (Homo sapiens) 6480464 vorinostat results in decreased expression of GSN mRNA CTD PMID:18769122 Gsn Rat zinc atom affects binding ISO GSN (Homo sapiens) 6480464 GSN protein binds to Zinc CTD PMID:23896426 Gsn Rat zinc(0) affects binding ISO GSN (Homo sapiens) 6480464 GSN protein binds to Zinc CTD PMID:23896426
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3-dimethoxynaphthalene-1,4-dione (ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP) 2-bromohexadecanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (EXP) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) aminoglutethimide (ISO) amiodarone (EXP) amitrole (EXP) arabinogalactan (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bilirubin IXalpha (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP) butyric acid (ISO) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) cannabidiol (ISO) cantharidin (ISO) carbon nanotube (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cobalt dichloride (ISO) cocaine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) corosolic acid (ISO) cumene (ISO) Cuprizon (EXP,ISO) curcumin (ISO) cyclosporin A (ISO) D-glucose (ISO) DDE (ISO) DDT (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diclofenac (ISO) diethyl maleate (ISO) dimethylselenide (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) entinostat (ISO) fipronil (EXP) folic acid (ISO) fulvestrant (ISO) furan (EXP) furfural (ISO) genistein (EXP) gentamycin (EXP) glucose (ISO) gold atom (ISO) gold(0) (ISO) GW 4064 (ISO) hyaluronic acid (EXP) hydralazine (ISO) hydrogen peroxide (EXP,ISO) hydroxyl (ISO) indole-3-methanol (EXP) indometacin (ISO) inulin (ISO) ivermectin (ISO) lead(0) (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) medroxyprogesterone acetate (ISO) menadione (ISO) mercury atom (ISO) mercury(0) (ISO) metformin (ISO) methotrexate (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) microcystin-LR (ISO) Muraglitazar (EXP) N-nitrosodimethylamine (ISO) navitoclax (ISO) nickel atom (ISO) nickel sulfate (ISO) nitrates (ISO) nitric oxide (ISO) nitroglycerin (EXP) ozone (ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) phenethyl isothiocyanate (ISO) phenobarbital (ISO) phenylhydrazine (ISO) pirinixic acid (ISO) potassium dichromate (ISO) progesterone (ISO) quercetin (ISO) resveratrol (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium fluoride (ISO) Sodium salicylate (ISO) Soman (EXP) succimer (ISO) sulforaphane (ISO) sunitinib (ISO) tamibarotene (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (ISO) tetrahydropalmatine (ISO) thapsigargin (EXP) titanium dioxide (ISO) toxaphene (ISO) trichostatin A (EXP,ISO) triphenyl phosphate (ISO) troglitazone (EXP,ISO) urethane (ISO) valproic acid (ISO) verapamil (EXP) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
actin cytoskeleton organization (IEA,ISO) actin filament capping (IEA,ISO) actin filament depolymerization (IEA,IMP,ISO) actin filament organization (IEA,ISO) actin filament polymerization (IEA,ISO,ISS) actin filament severing (IBA,IEA,ISO,ISS) actin polymerization or depolymerization (IBA,IDA) amyloid fibril formation (IEA,ISO) barbed-end actin filament capping (IBA,IEA) cardiac muscle cell contraction (IEA,ISO) cell projection assembly (IBA) cell projection organization (IEA) cellular response to cadmium ion (IDA) cellular response to type II interferon (IEA,ISO) central nervous system development (IBA) cilium assembly (IEA,ISO,ISS) extracellular matrix disassembly (ISO) hepatocyte apoptotic process (IEA,ISO) host-mediated suppression of symbiont invasion (IEA) oligodendrocyte development (IEP) phagocytosis, engulfment (IEA,ISO) positive regulation of actin nucleation (IEA,ISO) positive regulation of cardiac muscle hypertrophy (IMP) positive regulation of gene expression (IEA,ISO) positive regulation of keratinocyte apoptotic process (IEA,ISO) positive regulation of p38MAPK cascade (IMP) positive regulation of protein processing in phagocytic vesicle (IEA,ISO) protein destabilization (IEA,ISO) regulation of establishment of T cell polarity (IEA,ISO) regulation of plasma membrane raft polarization (IEA,ISO) regulation of podosome assembly (IEA,ISO) regulation of receptor clustering (IEA,ISO) relaxation of cardiac muscle (IEA,ISO) renal protein absorption (IEA,ISO) response to ethanol (IEP) response to folic acid (IEP) response to muscle stretch (IEA,ISO) striated muscle atrophy (IEA,ISO) tissue regeneration (IEP) vesicle-mediated transport (IEA,ISO)
Cellular Component
actin cap (IEA,ISO) actin cytoskeleton (IBA,IDA) apical ectoplasmic specialization (IDA) basal ectoplasmic specialization (IDA) cortical actin cytoskeleton (IEA,ISO) cytoplasm (IBA,IEA,ISO) cytoskeleton (IEA) cytosol (IEA,ISO,ISS) extracellular region (IEA,ISO,ISS) extracellular space (IBA,IDA,IEA,ISO) focal adhesion (IEA,ISO) glial filament (IDA) lamellipodium (IEA,ISO) myelin sheath (IDA) nucleus (IEA,ISO) perinuclear region of cytoplasm (IDA) phagocytic vesicle (IEA,ISO) plasma membrane (IEA,ISO) podosome (IEA,ISO) protein-containing complex (IDA) ruffle (IDA) sarcoplasm (IEA,ISO)
1.
Aging-associated increase of gelsolin for apoptosis resistance.
Ahn JS, etal., Biochem Biophys Res Commun 2003 Dec 26;312(4):1335-41.
2.
Involvement of gelsolin in cadmium-induced disruption of the mesangial cell cytoskeleton.
Apostolova MD, etal., Toxicol Sci. 2006 Feb;89(2):465-74. Epub 2005 Nov 9.
3.
Plasma gelsolin as a biomarker of acute rheumatic carditis.
Argun M, etal., Cardiol Young. 2015 Oct;25(7):1276-80. doi: 10.1017/S1047951114002327. Epub 2014 Nov 18.
4.
Widespread loss of gelsolin in breast cancers of humans, mice, and rats.
Asch HL, etal., Cancer Res. 1996 Nov 1;56(21):4841-5.
5.
Pulmonary vascular permeability and ischemic injury in gelsolin-deficient mice.
Becker PM, etal., Am J Respir Cell Mol Biol. 2003 Apr;28(4):478-84. doi: 10.1165/rcmb.2002-0024OC.
6.
Altered plasma-type gelsolin and amyloid-β in neonates with hypoxic-ischaemic encephalopathy under therapeutic hypothermia.
Benavente-Fernandez I, etal., J Cereb Blood Flow Metab. 2019 Jul;39(7):1349-1354. doi: 10.1177/0271678X18757419. Epub 2018 Feb 21.
7.
Modulation of gelsolin content in rat aortic smooth muscle cells during development, experimental intimal thickening and culture. An immunohistochemical and biochemical study.
Chaponnier C, etal., Eur J Biochem. 1990 Jul 5;190(3):559-65.
8.
Gelsolin and Progression of Aortic Arch Calcification in Chronic Hemodialysis Patients.
Chiou TT, etal., Int J Med Sci. 2016 Jan 29;13(2):92-8. doi: 10.7150/ijms.13785. eCollection 2016.
9.
Neuroprotective effects of gelsolin during murine stroke.
Endres M, etal., J Clin Invest. 1999 Feb;103(3):347-54. doi: 10.1172/JCI4953.
10.
Effect of prenatal exposure to ethanol on hepatic elongation factor-2 and proteome in 21 d old rats: protective effect of folic acid.
Garcia-Rodriguez S, etal., Free Radic Biol Med. 2003 Aug 15;35(4):428-37.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
The cytoskeleton in 'couch potato-ism': Insights from a murine model of impaired actin dynamics.
Gertz K, etal., Exp Neurol. 2018 Aug;306:34-44. doi: 10.1016/j.expneurol.2018.04.004. Epub 2018 Apr 21.
13.
Plasma gelsolin levels and 1-year mortality after first-ever ischemic stroke.
Guo XC, etal., J Crit Care. 2011 Dec;26(6):608-12. doi: 10.1016/j.jcrc.2011.02.007. Epub 2011 Apr 9.
14.
Protective effects of gelsolin in acute pulmonary thromboembolism and thrombosis in the carotid artery of mice.
Gupta AK, etal., PLoS One. 2019 Apr 19;14(4):e0215717. doi: 10.1371/journal.pone.0215717. eCollection 2019.
15.
Gelsolin--evidence for a role in turnover of junction-related actin filaments in Sertoli cells.
Guttman JA, etal., J Cell Sci 2002 Feb 1;115(Pt 3):499-505.
16.
Oral administration of alcalase potato protein hydrolysate-APPH attenuates high fat diet-induced cardiac complications via TGF-β/GSN axis in aging rats.
Hu WS, etal., Environ Toxicol. 2019 Jan;34(1):5-12. doi: 10.1002/tox.22651. Epub 2018 Sep 21.
17.
Gelsolin (GSN) induces cardiomyocyte hypertrophy and BNP expression via p38 signaling and GATA-4 transcriptional factor activation.
Hu WS, etal., Mol Cell Biochem. 2014 May;390(1-2):263-70. doi: 10.1007/s11010-014-1977-7. Epub 2014 Feb 7.
18.
High gelsolin content of developing oligodendrocytes.
Lena JY, etal., Int J Dev Neurosci. 1994 Aug;12(5):375-86.
19.
Mutation in gelsolin gene in Finnish hereditary amyloidosis.
Levy E, etal., J Exp Med. 1990 Dec 1;172(6):1865-7.
20.
Gelsolin regulates cardiac remodeling after myocardial infarction through DNase I-mediated apoptosis.
Li GH, etal., Circ Res. 2009 Apr 10;104(7):896-904. doi: 10.1161/CIRCRESAHA.108.172882. Epub 2009 Feb 26.
21.
Larch Arabinogalactan Attenuates Myocardial Injury by Inhibiting Apoptotic Cascades in a Rat Model of Ischemia-Reperfusion.
Lim SH, J Med Food. 2017 Jul;20(7):691-699. doi: 10.1089/jmf.2016.3886. Epub 2017 Jun 16.
22.
Evidence for apoptosis after intercerebral hemorrhage in rat striatum.
Matsushita K, etal., J Cereb Blood Flow Metab. 2000 Feb;20(2):396-404.
23.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
24.
Gene expression profile changes are commonly modulated across models and species after traumatic brain injury.
Natale JE, etal., J Neurotrauma. 2003 Oct;20(10):907-27.
25.
Gelsolin gene expression is upregulated in damaged rat and human livers within non-parenchymal cells and not in hepatocytes.
Neubauer K, etal., Histochem Cell Biol. 2003 Oct;120(4):265-75. Epub 2003 Aug 28.
26.
Identification of a multiprotein "motor" complex binding to water channel aquaporin-2.
Noda Y, etal., Biochem Biophys Res Commun. 2005 May 20;330(4):1041-7.
27.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
28.
Plasma gelsolin levels and outcomes after aneurysmal subarachnoid hemorrhage.
Pan JW, etal., Crit Care. 2013 Jul 23;17(4):R149. doi: 10.1186/cc12828.
29.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
30.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
31.
Gelsolin immunoreactivity and development of the tectorial membrane in the cochlea of normal and hypothyroid rats.
Rabie A, etal., Cell Tissue Res. 1988 Oct;254(1):241-5.
32.
GOA pipeline
RGD automated data pipeline
33.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
34.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
35.
Lack of gelsolin promotes perpetuation of atrial fibrillation in the mouse heart.
Schrickel JW, etal., J Interv Card Electrophysiol. 2009 Oct;26(1):3-10. doi: 10.1007/s10840-009-9425-4. Epub 2009 Aug 8.
36.
Cognitive Impairment and Brain and Peripheral Alterations in a Murine Model of Intraventricular Hemorrhage in the Preterm Newborn.
Segado-Arenas A, etal., Mol Neurobiol. 2018 Jun;55(6):4896-4910. doi: 10.1007/s12035-017-0693-1. Epub 2017 Jul 28.
37.
Allele-specific expression in the human heart and its application to postoperative atrial fibrillation and myocardial ischemia.
Sigurdsson MI, etal., Genome Med. 2016 Dec 6;8(1):127. doi: 10.1186/s13073-016-0381-1.
38.
Circulating actin-gelsolin complexes following oleic acid-induced lung injury.
Smith DB, etal., Am J Pathol. 1988 Feb;130(2):261-7.
39.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
40.
Decreased plasma gelsolin concentrations in acute liver failure, myocardial infarction, septic shock, and myonecrosis.
Suhler E, etal., Crit Care Med. 1997 Apr;25(4):594-8. doi: 10.1097/00003246-199704000-00007.
41.
Investigation of the actin scavenging system in pre-eclampsia.
Tannetta DS, etal., Eur J Obstet Gynecol Reprod Biol. 2014 Jan;172:32-5. doi: 10.1016/j.ejogrb.2013.10.022. Epub 2013 Oct 25.
42.
Expression of Cytoplasmic Gelsolin in Rat Brain After Experimental Subarachnoid Hemorrhage.
Xie GB, etal., Cell Mol Neurobiol. 2015 Jul;35(5):723-31. doi: 10.1007/s10571-015-0168-8. Epub 2015 Mar 6.
43.
Two-dimensional electrophoresis with cationic detergents: a powerful tool for the proteomic analysis of myelin proteins. Part 2: analytical aspects.
Yamaguchi Y, etal., J Neurosci Res. 2008 Mar;86(4):766-75.
44.
Inhibition of histone deacetylation protects wildtype but not gelsolin-deficient mice from ischemic brain injury.
Yildirim F, etal., Exp Neurol. 2008 Apr;210(2):531-42. doi: 10.1016/j.expneurol.2007.11.031. Epub 2007 Dec 23.
45.
Significant reduction of plasma gelsolin levels in patients with intracerebral hemorrhage.
Zhao DQ, etal., Clin Chim Acta. 2013 Jan 16;415:202-6. doi: 10.1016/j.cca.2012.10.048. Epub 2012 Nov 7.
Gsn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 38,982,605 - 39,035,849 (+) NCBI GRCr8 mRatBN7.2 3 18,585,166 - 18,638,404 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 18,585,172 - 18,638,402 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 21,683,799 - 21,710,538 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 30,268,837 - 30,295,574 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 28,522,714 - 28,549,446 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 14,456,106 - 14,508,922 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 14,467,330 - 14,508,911 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 19,773,655 - 19,826,463 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 14,360,245 - 14,386,313 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 14,256,616 - 14,282,685 (+) NCBI Celera 3 13,325,045 - 13,351,501 (+) NCBI Celera Cytogenetic Map 3 p11 NCBI
GSN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 121,201,483 - 121,332,842 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 121,207,794 - 121,332,843 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 123,963,761 - 124,095,120 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 123,070,201 - 123,134,941 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 121,109,960 - 121,174,674 NCBI Celera 9 94,678,898 - 94,743,628 (+) NCBI Celera Cytogenetic Map 9 q33.2 NCBI HuRef 9 93,648,171 - 93,712,883 (+) NCBI HuRef CHM1_1 9 124,177,269 - 124,242,004 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 133,397,510 - 133,528,852 (+) NCBI T2T-CHM13v2.0
Gsn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 35,146,371 - 35,197,914 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 35,146,392 - 35,197,904 (+) Ensembl GRCm39 Ensembl GRCm38 2 35,256,359 - 35,307,902 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 35,256,380 - 35,307,892 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 35,137,960 - 35,163,412 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 35,104,449 - 35,129,901 (+) NCBI MGSCv36 mm8 Celera 2 34,977,113 - 35,002,613 (+) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 23.5 NCBI
Gsn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 6,682,058 - 6,733,361 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 6,682,202 - 6,733,361 (-) NCBI ChiLan1.0 ChiLan1.0
GSN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 18,011,809 - 18,076,682 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 18,014,159 - 18,079,040 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 92,413,819 - 92,460,483 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 120,741,148 - 120,805,831 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 120,741,148 - 120,805,831 (+) Ensembl panpan1.1 panPan2
GSN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 74,248,227 - 74,268,129 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 74,233,457 - 74,268,129 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 72,637,556 - 72,678,974 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 75,364,194 - 75,405,704 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 75,364,181 - 75,405,705 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 73,871,291 - 73,912,586 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 73,902,056 - 73,943,469 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 74,663,262 - 74,683,140 (+) NCBI UU_Cfam_GSD_1.0
Gsn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 189,981,162 - 190,034,252 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 9,764,944 - 9,802,841 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 9,749,755 - 9,802,787 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GSN Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 261,307,008 - 261,372,848 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 261,295,711 - 261,372,848 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 293,381,825 - 293,388,559 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GSN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 18,253,079 - 18,317,285 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 18,253,324 - 18,285,938 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666035 24,700,374 - 24,764,693 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gsn
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 30 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000025857 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358357 Srcrtb1 Stress Responsive Cort Basal QTL 1 6.36 0.002 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 8658162 27494778 Rat 6893355 Bw101 Body weight QTL 101 0.4 0.38 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 11528620 Bss113 Bone structure and strength QTL 113 9.75 2e-10 femur morphology trait (VT:0000559) femoral neck width (CMO:0001695) 3 16490648 19241681 Rat 634306 Bp140 Blood pressure QTL 140 3.3 0.0013 arterial blood pressure trait (VT:2000000) body weight (CMO:0000012) 3 17374703 35528639 Rat 10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 1298526 Arunc3 Aerobic running capacity QTL 3 2.2 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 8227194 33703538 Rat 8693641 Alc30 Alcohol consumption QTL 30 2 0.739 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 3 10434306 24512004 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1558657 Cm43 Cardiac mass QTL 43 6.6 3e-08 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 6893363 Bw105 Body weight QTL 105 2.6 0.0036 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat 1558647 Cm46 Cardiac mass QTL 46 5.4 0.0000055 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 12879852 Cm93 Cardiac mass QTL 93 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 18311454 47233430 Rat 1558654 Bw56 Body weight QTL 56 4.5 0.0000171 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 12879853 Am5 Aortic mass QTL 5 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 18311454 47233430 Rat 12879854 Kidm63 Kidney mass QTL 63 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 18311454 47233430 Rat 1558650 Cm48 Cardiac mass QTL 48 4 0.0001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 3 10778823 30356773 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 12879849 Bw180 Body weight QTL 180 0.037 body mass (VT:0001259) body weight (CMO:0000012) 3 18311454 47233430 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 12879850 Cm91 Cardiac mass QTL 91 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 18311454 47233430 Rat 731172 Bp151 Blood pressure QTL 151 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 47233430 Rat 12879851 Cm92 Cardiac mass QTL 92 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 18311454 47233430 Rat 631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2325840 Bp345 Blood pressure QTL 345 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 28441896 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 70203 Gcr2 Gastric cancer resistance QTL 2 2.6 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 3 8658162 27494778 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat
RH128257
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 18,638,181 - 18,638,364 (+) MAPPER mRatBN7.2 Rnor_6.0 3 14,508,700 - 14,508,882 NCBI Rnor6.0 Rnor_5.0 3 19,826,241 - 19,826,423 UniSTS Rnor5.0 RGSC_v3.4 3 14,386,102 - 14,386,284 UniSTS RGSC3.4 Celera 3 13,351,294 - 13,351,472 UniSTS Cytogenetic Map 3 p11 UniSTS
UniSTS:498432
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 18,613,055 - 18,613,121 (+) MAPPER mRatBN7.2 Rnor_6.0 3 14,483,958 - 14,484,023 NCBI Rnor6.0 Rnor_5.0 3 19,801,499 - 19,801,564 UniSTS Rnor5.0 RGSC_v3.4 3 14,361,815 - 14,361,880 UniSTS RGSC3.4 Celera 3 13,326,614 - 13,326,679 UniSTS Cytogenetic Map 3 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025857 ⟹ ENSRNOP00000025857
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 18,611,487 - 18,638,393 (+) Ensembl Rnor_6.0 Ensembl 3 14,482,388 - 14,508,911 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078939 ⟹ ENSRNOP00000075631
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 18,585,172 - 18,638,383 (+) Ensembl Rnor_6.0 Ensembl 3 14,467,330 - 14,508,911 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107609 ⟹ ENSRNOP00000086188
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 18,585,192 - 18,638,391 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108827 ⟹ ENSRNOP00000088362
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 18,612,397 - 18,638,402 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112129 ⟹ ENSRNOP00000096124
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 18,611,406 - 18,638,402 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114912 ⟹ ENSRNOP00000084576
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 18,585,210 - 18,638,398 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116452 ⟹ ENSRNOP00000092845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 18,593,302 - 18,638,369 (+) Ensembl
RefSeq Acc Id:
NM_001004080 ⟹ NP_001004080
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 39,008,932 - 39,035,838 (+) NCBI mRatBN7.2 3 18,611,487 - 18,638,393 (+) NCBI Rnor_6.0 3 14,482,388 - 14,508,911 (+) NCBI Rnor_5.0 3 19,773,655 - 19,826,463 (+) NCBI RGSC_v3.4 3 14,360,245 - 14,386,313 (+) RGD Celera 3 13,325,045 - 13,351,501 (+) RGD
Sequence:
CACCGTCACCATGGCTCCGTATTGCTCCTCGCTGCGCTCTGCGCTGCTCGTCCTGGCGCTGTGCGCACTGTCGCCGTCCCATGCAGCCACCGCATCGCGGGGCAGGGCCCAAGAGAGGGCGCCCCAAA
hide sequence
RefSeq Acc Id:
XM_006234040 ⟹ XP_006234102
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 38,982,606 - 39,035,849 (+) NCBI mRatBN7.2 3 18,585,167 - 18,638,404 (+) NCBI Rnor_6.0 3 14,456,106 - 14,508,922 (+) NCBI Rnor_5.0 3 19,773,655 - 19,826,463 (+) NCBI
Sequence:
CGCACAGCGCACCCCGCCCCATCGCCAGGAACCAGCTGAGCACACAGCTGGACCCAGCGGTCGC
hide sequence
RefSeq Acc Id:
XM_017591662 ⟹ XP_017447151
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 38,982,605 - 39,035,849 (+) NCBI mRatBN7.2 3 18,585,166 - 18,638,404 (+) NCBI Rnor_6.0 3 14,456,106 - 14,508,922 (+) NCBI
Sequence:
CGCACAGCGCACCCCGCCCCATCGCCAGGAACCAGCTGAGCACACAGCTGGACCCAGCGGTCGCCGTCGCCCGCTCCGCCACAGCAGGTACCACCAACTCCTCTTTTCCCCGTTCTTCAGCTGCTGTC
hide sequence
RefSeq Acc Id:
XM_039104784 ⟹ XP_038960712
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 38,982,690 - 39,035,849 (+) NCBI mRatBN7.2 3 18,585,218 - 18,638,404 (+) NCBI
RefSeq Acc Id:
XM_063283523 ⟹ XP_063139593
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 38,982,605 - 39,035,849 (+) NCBI
RefSeq Acc Id:
XM_063283524 ⟹ XP_063139594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 38,986,245 - 39,035,849 (+) NCBI
RefSeq Acc Id:
NP_001004080 ⟸ NM_001004080
- Peptide Label:
precursor
- UniProtKB:
Q68FP1 (UniProtKB/Swiss-Prot), A6JUE8 (UniProtKB/TrEMBL)
- Sequence:
MAPYCSSLRSALLVLALCALSPSHAATASRGRAQERAPQSRVSETRPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAI
hide sequence
RefSeq Acc Id:
XP_006234102 ⟸ XM_006234040
- Peptide Label:
isoform X2
- UniProtKB:
A6JUE9 (UniProtKB/TrEMBL)
- Sequence:
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYW
hide sequence
RefSeq Acc Id:
XP_017447151 ⟸ XM_017591662
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZZX4 (UniProtKB/TrEMBL), A6JUE9 (UniProtKB/TrEMBL)
- Sequence:
MEKLFCCFPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLR
hide sequence
Ensembl Acc Id:
ENSRNOP00000025857 ⟸ ENSRNOT00000025857
Ensembl Acc Id:
ENSRNOP00000075631 ⟸ ENSRNOT00000078939
RefSeq Acc Id:
XP_038960712 ⟸ XM_039104784
- Peptide Label:
isoform X2
- UniProtKB:
A6JUE9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000088362 ⟸ ENSRNOT00000108827
Ensembl Acc Id:
ENSRNOP00000096124 ⟸ ENSRNOT00000112129
Ensembl Acc Id:
ENSRNOP00000086188 ⟸ ENSRNOT00000107609
Ensembl Acc Id:
ENSRNOP00000084576 ⟸ ENSRNOT00000114912
Ensembl Acc Id:
ENSRNOP00000092845 ⟸ ENSRNOT00000116452
RefSeq Acc Id:
XP_063139593 ⟸ XM_063283523
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZZX4 (UniProtKB/TrEMBL), A6JUE9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139594 ⟸ XM_063283524
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZZX4 (UniProtKB/TrEMBL), A6JUE9 (UniProtKB/TrEMBL)
RGD ID: 13692017 Promoter ID: EPDNEW_R2541 Type: multiple initiation site Name: Gsn_1 Description: gelsolin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 14,482,370 - 14,482,430 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Gsn
gelsolin
Symbol and Name status set to approved
1299863 APPROVED
2005-02-14
Gsn
gelsolin
Symbol and Name status set to provisional
70820 PROVISIONAL
