Symbol:
Hsp90ab1
Name:
heat shock protein 90 alpha family class B member 1
RGD ID:
1303075
Description:
Enables several functions, including nucleotide binding activity; sulfonylurea receptor binding activity; and transmembrane transporter binding activity. Involved in several processes, including negative regulation of complement-dependent cytotoxicity; positive regulation of cell size; and regulation of protein metabolic process. Located in several cellular components, including basolateral plasma membrane; brush border membrane; and sperm head plasma membrane. Part of protein folding chaperone complex. Biomarker of muscular atrophy; pancreatitis; and pulmonary fibrosis. Human ortholog(s) of this gene implicated in multiple sclerosis. Orthologous to several human genes including HSP90AB1 (heat shock protein 90 alpha family class B member 1); PARTICIPATES IN aldosterone signaling pathway; androgen signaling pathway; cortisol signaling pathway; INTERACTS WITH (R)-adrenaline; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
heat shock 84 kDa; heat shock 90kDa protein 1, beta; heat shock protein 90 alpha (cytosolic), class B member 1; heat shock protein 90kDa alpha (cytosolic), class B member 1; heat shock protein 90kDa alpha family class B member 1; heat shock protein HSP 90-beta; HSP 84; HSP84; HSP90-BETA; HSP90B; HSPC2; Hspcb; MGC94263
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HSP90AB1 (heat shock protein 90 alpha family class B member 1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Hsp90ab1 (heat shock protein 90 alpha (cytosolic), class B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hsp90ab1 (heat shock protein 90 alpha family class B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HSP90AB1 (heat shock protein 90 alpha family class B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HSP90AB1 (heat shock protein 90 alpha family class B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hsp90ab1 (heat shock protein 90 alpha family class B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HSP90AB1 (heat shock protein 90 alpha family class B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HSP90AB1 (heat shock protein 90 alpha family class B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hsp90ab1 (heat shock protein 90 alpha family class B member 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HSP90AA1 (heat shock protein 90 alpha family class A member 1)
HGNC
OrthoDB
Homo sapiens (human):
HSP90AB3P (heat shock protein 90 alpha family class B member 3, pseudogene)
HGNC
Panther
Homo sapiens (human):
HSP90AB4P (heat shock protein 90 alpha family class B member 4, pseudogene)
HGNC
Panther
Homo sapiens (human):
HSP90AB2P (heat shock protein 90 alpha family class B member 2, pseudogene)
HGNC
Panther
Alliance orthologs 3
Homo sapiens (human):
HSP90AB1 (heat shock protein 90 alpha family class B member 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HSP90AB3P (heat shock protein 90 alpha family class B member 3, pseudogene)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Mus musculus (house mouse):
Hsp90ab1 (heat shock protein 90 alpha (cytosolic), class B member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
HSP90AB4P (heat shock protein 90 alpha family class B member 4, pseudogene)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Homo sapiens (human):
HSP90AB2P (heat shock protein 90 alpha family class B member 2, pseudogene)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
hsp90ab1 (heat shock protein 90, alpha (cytosolic), class B member 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
HSC82
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Hsp83
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hsp-90
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
HSP82
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
hsp90ab1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Related Pseudogenes:
Hsp90ab1-ps13
Hsp90ab1-ps17
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 22,930,249 - 22,935,929 (+) NCBI GRCr8 mRatBN7.2 9 15,432,986 - 15,438,358 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 15,433,691 - 15,438,488 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 24,019,488 - 24,024,885 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 29,082,165 - 29,087,562 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 27,382,927 - 27,388,324 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 17,817,791 - 17,823,163 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 17,817,721 - 17,823,243 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 16,706,512 - 16,711,884 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 11,033,496 - 11,038,868 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 11,030,786 - 11,036,319 (+) NCBI Celera 9 13,176,225 - 13,181,597 (+) NCBI Celera Cytogenetic Map 9 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hsp90ab1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552591 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HSP90AB1 mRNA CTD PMID:36331819 Hsp90ab1 Rat (R)-adrenaline multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of HSP90AB1 protein CTD PMID:19464573 Hsp90ab1 Rat (Z)-3-butylidenephthalide decreases expression ISO RGD:1346893 6480464 butylidenephthalide results in decreased expression of HSP90AB1 protein CTD PMID:23770345 Hsp90ab1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o,p'-DDT affects the expression of HSP90AB1 mRNA CTD PMID:17984292 Hsp90ab1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1552591 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of HSP90AB1 mRNA CTD PMID:22206623 Hsp90ab1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1552591 6480464 1,2-Dimethylhydrazine results in increased expression of HSP90AB1 mRNA CTD PMID:22206623 Hsp90ab1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of HSP90AB1 mRNA CTD PMID:20551477 Hsp90ab1 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1552591 6480464 Ethinyl Estradiol results in increased expression of HSP90AB1 mRNA CTD PMID:17942748 Hsp90ab1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of HSP90AB1 mRNA CTD PMID:17108234 Hsp90ab1 Rat 17alpha-ethynylestradiol affects expression ISO RGD:1552591 6480464 Ethinyl Estradiol affects the expression of HSP90AB1 mRNA CTD PMID:17555576 Hsp90ab1 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1552591 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HSP90AB1 mRNA CTD PMID:17942748 Hsp90ab1 Rat 17beta-estradiol affects expression ISO RGD:1346893 6480464 Estradiol affects the expression of HSP90AB1 mRNA CTD PMID:22574217 Hsp90ab1 Rat 17beta-estradiol increases expression ISO RGD:1552591 6480464 Estradiol results in increased expression of HSP90AB1 mRNA CTD PMID:39298647 Hsp90ab1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HSP90AB1 protein CTD PMID:32145629 Hsp90ab1 Rat 17beta-estradiol increases expression ISO RGD:1346893 6480464 Estradiol results in increased expression of HSP90AB1 mRNA CTD PMID:15223131|PMID:16514628 Hsp90ab1 Rat 17beta-estradiol multiple interactions ISO RGD:1346893 6480464 ESR1 protein affects the reaction [Estradiol results in increased expression of HSP90AB1 mRNA] CTD PMID:15223131 Hsp90ab1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1552591 6480464 Dihydrotestosterone results in increased expression of HSP90AB1 mRNA CTD PMID:17023530 Hsp90ab1 Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO RGD:1552591 6480464 Dihydrotestosterone results in decreased expression of HSP90AB1 mRNA CTD PMID:17023530 Hsp90ab1 Rat 1H-pyrazole increases expression ISO RGD:1552591 6480464 pyrazole results in increased expression of HSP90AB1 mRNA CTD PMID:17945193 Hsp90ab1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1552591 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of HSP90AB1 mRNA CTD PMID:30294300 Hsp90ab1 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO RGD:1346893 6480464 2,5,2',5'-tetrachlorobiphenyl results in increased expression of HSP90AB1 mRNA CTD PMID:21703328 Hsp90ab1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of HSP90AB1 mRNA; Tetrachlorodibenzodioxin results in decreased expression of HSP90AB1 more ... CTD PMID:16548065|PMID:21215274 Hsp90ab1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HSP90AB1 mRNA CTD PMID:33387578 Hsp90ab1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1552591 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HSP90AB1 mRNA CTD PMID:17942748 Hsp90ab1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552591 6480464 Tetrachlorodibenzodioxin affects the expression of HSP90AB1 mRNA CTD PMID:21570461 Hsp90ab1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of HSP90AB1 mRNA CTD PMID:22298810|PMID:34747641 Hsp90ab1 Rat 2,4-diaminotoluene decreases expression ISO RGD:1552591 6480464 2,4-diaminotoluene results in decreased expression of HSP90AB1 mRNA CTD PMID:22016648 Hsp90ab1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of HSP90AB1 mRNA CTD PMID:21346803 Hsp90ab1 Rat 2-amino-4,6-dinitrotoluene affects expression EXP 6480464 2-amino-4,6-dinitrotoluene affects the expression of HSP90AB1 mRNA CTD PMID:21346803 Hsp90ab1 Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO RGD:1346893 6480464 3,4,5,3',4'-pentachlorobiphenyl affects the expression of HSP90AB1 mRNA CTD PMID:21703328 Hsp90ab1 Rat 3,4-dihydrocoumarin decreases expression ISO RGD:1552591 6480464 3,4-dihydrocoumarin results in decreased expression of HSP90AB1 mRNA CTD PMID:22016648 Hsp90ab1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin analog results in increased expression of HSP90AB1 protein CTD PMID:26072098 Hsp90ab1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1346893 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Hsp90ab1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1,2-dithiol-3-thione results in increased expression of HSP90AB1 mRNA CTD PMID:19162173 Hsp90ab1 Rat 3H-1,2-dithiole-3-thione increases expression ISO RGD:1552591 6480464 1,2-dithiol-3-thione results in increased expression of HSP90AB1 mRNA CTD PMID:15375163 Hsp90ab1 Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:1552591 6480464 4,4'-diaminodiphenylmethane results in increased expression of HSP90AB1 mRNA CTD PMID:18648102 Hsp90ab1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1346893 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Hsp90ab1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1346893 6480464 bisphenol S results in increased expression of HSP90AB1 protein CTD PMID:34186270 Hsp90ab1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1552591 6480464 bisphenol S results in increased expression of HSP90AB1 mRNA CTD PMID:39298647 Hsp90ab1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of HSP90AB1 mRNA CTD PMID:21346803 Hsp90ab1 Rat 4-hydroxynon-2-enal affects binding EXP 6480464 4-hydroxy-2-nonenal binds to HSP90AB1 protein CTD PMID:21749116 Hsp90ab1 Rat 4-vinylcyclohexene dioxide affects expression ISO RGD:1552591 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of HSP90AB1 mRNA CTD PMID:20829426 Hsp90ab1 Rat 6-anilino-5,8-quinolinedione increases expression EXP 6480464 6-anilino-5,8-quinolinedione results in increased expression of HSP90AB1 protein CTD PMID:10617604 Hsp90ab1 Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Isoflavones] results in increased expression of HSP90AB1 protein CTD PMID:22248470 Hsp90ab1 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of HSP90AB1 protein CTD PMID:22248470 Hsp90ab1 Rat 7H-xanthine multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of HSP90AB1 protein; [Xanthine more ... CTD PMID:19464573 Hsp90ab1 Rat 9H-xanthine multiple interactions EXP 6480464 [Epinephrine co-treated with Xanthine co-treated with XDH] results in decreased expression of HSP90AB1 protein; [Xanthine more ... CTD PMID:19464573 Hsp90ab1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of HSP90AB1 mRNA CTD PMID:28959563 Hsp90ab1 Rat acrylamide increases expression ISO RGD:1346893 6480464 Acrylamide results in increased expression of HSP90AB1 mRNA CTD PMID:32763439 Hsp90ab1 Rat actinomycin D multiple interactions ISO RGD:1346893 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of HSP90AB1 protein CTD PMID:38460933 Hsp90ab1 Rat afimoxifene decreases expression ISO RGD:1346893 6480464 afimoxifene results in decreased expression of HSP90AB1 mRNA CTD PMID:16514628 Hsp90ab1 Rat aflatoxin B1 increases expression ISO RGD:1346893 6480464 Aflatoxin B1 results in increased expression of HSP90AB1 mRNA CTD PMID:27153756 Hsp90ab1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of HSP90AB1 mRNA CTD PMID:33354967 Hsp90ab1 Rat albendazole multiple interactions ISO RGD:1346893 6480464 [Ivermectin co-treated with Albendazole] results in increased expression of HSP90AB1 mRNA CTD PMID:16861626 Hsp90ab1 Rat all-trans-retinoic acid decreases expression ISO RGD:1346893 6480464 Tretinoin results in decreased expression of HSP90AB1 mRNA CTD PMID:15498508|PMID:17218384 Hsp90ab1 Rat all-trans-retinoic acid increases acetylation ISO RGD:1346893 6480464 Tretinoin results in increased acetylation of HSP90AB1 protein CTD PMID:28053092 Hsp90ab1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HSP90AB1 mRNA CTD PMID:16483693 Hsp90ab1 Rat amphibole asbestos decreases expression ISO RGD:1346893 6480464 Asbestos, Amphibole results in decreased expression of HSP90AB1 protein CTD PMID:20855422 Hsp90ab1 Rat aniline increases expression ISO RGD:1552591 6480464 aniline results in increased expression of HSP90AB1 mRNA CTD PMID:22016648 Hsp90ab1 Rat antimony(0) increases expression ISO RGD:1346893 6480464 Antimony results in increased expression of HSP90AB1 protein CTD PMID:38097005 Hsp90ab1 Rat antimony(0) multiple interactions ISO RGD:1346893 6480464 MCOLN1 protein inhibits the reaction [Antimony results in increased expression of HSP90AB1 protein] CTD PMID:38097005 Hsp90ab1 Rat antimycin A increases expression ISO RGD:1346893 6480464 Antimycin A results in increased expression of HSP90AB1 mRNA CTD PMID:33512557 Hsp90ab1 Rat arachidonic acid decreases expression ISO RGD:1552591 6480464 Arachidonic Acid results in decreased expression of HSP90AB1 mRNA CTD PMID:16623957 Hsp90ab1 Rat Aroclor 1254 decreases expression ISO RGD:1552591 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of HSP90AB1 mRNA CTD PMID:23650126 Hsp90ab1 Rat arsenous acid increases expression ISO RGD:1346893 6480464 Arsenic Trioxide results in increased expression of HSP90AB1 mRNA; Arsenic Trioxide results in increased expression more ... CTD PMID:19364129|PMID:20458559|PMID:22521957 Hsp90ab1 Rat arsenous acid affects response to substance ISO RGD:1346893 6480464 HSP90AB1 protein affects the susceptibility to Arsenic Trioxide CTD PMID:19371599 Hsp90ab1 Rat arsenous acid decreases expression ISO RGD:1346893 6480464 Arsenic Trioxide results in decreased expression of HSP90AB1 protein CTD PMID:25419056 Hsp90ab1 Rat astemizole decreases expression EXP 6480464 Astemizole results in decreased expression of HSP90AB1 mRNA CTD PMID:20221588 Hsp90ab1 Rat atrazine increases expression ISO RGD:1346893 6480464 Atrazine results in increased expression of HSP90AB1 mRNA CTD PMID:22378314 Hsp90ab1 Rat BAPTA multiple interactions ISO RGD:1346893 6480464 1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid inhibits the reaction [Humic Substances results in increased expression of HSP90AB1 protein] CTD PMID:23836447 Hsp90ab1 Rat benzo[a]pyrene increases mutagenesis ISO RGD:1346893 6480464 Benzo(a)pyrene results in increased mutagenesis of HSP90AB1 gene CTD PMID:25435355 Hsp90ab1 Rat benzo[a]pyrene increases methylation ISO RGD:1346893 6480464 Benzo(a)pyrene results in increased methylation of HSP90AB1 promoter CTD PMID:27901495 Hsp90ab1 Rat benzo[a]pyrene increases expression ISO RGD:1552591 6480464 Benzo(a)pyrene results in increased expression of HSP90AB1 mRNA CTD PMID:21569818|PMID:23747951 Hsp90ab1 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of HSP90AB1 protein CTD PMID:16456883 Hsp90ab1 Rat benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [sodium arsenite results in increased expression of HSP90AB1 protein]; sodium arsenite more ... CTD PMID:16456883 Hsp90ab1 Rat benzo[a]pyrene affects expression ISO RGD:1552591 6480464 Benzo(a)pyrene affects the expression of HSP90AB1 mRNA CTD PMID:22342234 Hsp90ab1 Rat benzo[a]pyrene multiple interactions ISO RGD:1552591 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of HSP90AB1 mRNA] CTD PMID:22228805 Hsp90ab1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1346893 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of HSP90AB1 mRNA CTD PMID:20018196 Hsp90ab1 Rat beta-naphthoflavone increases expression ISO RGD:1346893 6480464 beta-Naphthoflavone results in increased expression of HSP90AB1 mRNA CTD PMID:32151702 Hsp90ab1 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of HSP90AB1 more ... CTD PMID:23359474|PMID:26361869 Hsp90ab1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1552591 6480464 Diethylhexyl Phthalate results in decreased expression of HSP90AB1 mRNA CTD PMID:33754040 Hsp90ab1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of HSP90AB1 mRNA CTD PMID:21318169|PMID:26361869 Hsp90ab1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of HSP90AB1 more ... CTD PMID:23359474 Hsp90ab1 Rat bisphenol A decreases expression ISO RGD:1552591 6480464 bisphenol A results in decreased expression of HSP90AB1 mRNA CTD PMID:33221593 Hsp90ab1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HSP90AB1 mRNA CTD PMID:30903817 Hsp90ab1 Rat bisphenol A increases expression ISO RGD:1346893 6480464 bisphenol A results in increased expression of HSP90AB1 mRNA; bisphenol A results in increased expression more ... CTD PMID:15223131|PMID:34186270 Hsp90ab1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HSP90AB1 mRNA; bisphenol A results in increased expression more ... CTD PMID:15229138|PMID:25181051|PMID:32145629 Hsp90ab1 Rat bisphenol A multiple interactions ISO RGD:1346893 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:15223131|PMID:28628672 Hsp90ab1 Rat bisphenol A increases expression ISO RGD:1552591 6480464 bisphenol A results in increased expression of HSP90AB1 mRNA CTD PMID:26063408 Hsp90ab1 Rat bisphenol AF increases expression ISO RGD:1346893 6480464 bisphenol AF results in increased expression of HSP90AB1 protein CTD PMID:34186270 Hsp90ab1 Rat Bisphenol B increases expression ISO RGD:1346893 6480464 bisphenol B results in increased expression of HSP90AB1 protein CTD PMID:34186270 Hsp90ab1 Rat bisphenol F multiple interactions ISO RGD:1346893 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Hsp90ab1 Rat bisphenol F increases expression ISO RGD:1552591 6480464 bisphenol F results in increased expression of HSP90AB1 mRNA CTD PMID:38685157 Hsp90ab1 Rat bisphenol F increases expression ISO RGD:1346893 6480464 bisphenol F results in increased expression of HSP90AB1 protein CTD PMID:34186270 Hsp90ab1 Rat bortezomib increases expression ISO RGD:1346893 6480464 Bortezomib results in increased expression of HSP90AB1 mRNA CTD PMID:17895889 Hsp90ab1 Rat butanal increases expression ISO RGD:1346893 6480464 butyraldehyde results in increased expression of HSP90AB1 mRNA CTD PMID:26079696 Hsp90ab1 Rat cadmium atom increases expression ISO RGD:1346893 6480464 Cadmium results in increased expression of HSP90AB1 mRNA CTD PMID:24284285 Hsp90ab1 Rat cadmium dichloride decreases expression ISO RGD:1346893 6480464 Cadmium Chloride results in decreased expression of HSP90AB1 mRNA CTD PMID:18560533 Hsp90ab1 Rat cadmium dichloride affects expression ISO RGD:1346893 6480464 Cadmium Chloride affects the expression of HSP90AB1 mRNA CTD PMID:23828170 Hsp90ab1 Rat cadmium dichloride multiple interactions ISO RGD:1552591 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of HSP90AB1 mRNA CTD PMID:19840844 Hsp90ab1 Rat cadmium sulfate increases expression ISO RGD:1346893 6480464 cadmium sulfate results in increased expression of HSP90AB1 mRNA CTD PMID:12064557|PMID:21783983 Hsp90ab1 Rat caffeine affects phosphorylation ISO RGD:1346893 6480464 Caffeine affects the phosphorylation of HSP90AB1 protein CTD PMID:35688186 Hsp90ab1 Rat calcidiol decreases expression EXP 6480464 Calcifediol deficiency results in decreased expression of HSP90AB1 mRNA CTD PMID:17293106 Hsp90ab1 Rat cannabidiol increases expression ISO RGD:1346893 6480464 Cannabidiol results in increased expression of HSP90AB1 mRNA CTD PMID:28025562 Hsp90ab1 Rat carbon nanotube decreases expression ISO RGD:1552591 6480464 Nanotubes, Carbon analog results in decreased expression of HSP90AB1 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 Hsp90ab1 Rat celastrol multiple interactions EXP 6480464 celastrol inhibits the reaction [Dextran Sulfate results in increased expression of HSP90AB1 protein] CTD PMID:32470352 Hsp90ab1 Rat chloropicrin affects expression ISO RGD:1346893 6480464 chloropicrin affects the expression of HSP90AB1 mRNA CTD PMID:26352163 Hsp90ab1 Rat chloroprene increases expression ISO RGD:1552591 6480464 Chloroprene results in increased expression of HSP90AB1 mRNA CTD PMID:23125180 Hsp90ab1 Rat chlorpyrifos decreases expression ISO RGD:1552591 6480464 Chlorpyrifos results in decreased expression of HSP90AB1 mRNA CTD PMID:37019170 Hsp90ab1 Rat choline affects expression ISO RGD:1346893 6480464 Choline affects the expression of HSP90AB1 mRNA CTD PMID:17616785 Hsp90ab1 Rat chromium(6+) affects expression ISO RGD:1552591 6480464 chromium hexavalent ion affects the expression of HSP90AB1 mRNA CTD PMID:28472532 Hsp90ab1 Rat Cinobufagin decreases expression ISO RGD:1346893 6480464 cinobufagin results in decreased expression of HSP90AB1 mRNA CTD PMID:35447139 Hsp90ab1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of HSP90AB1 mRNA; Clofibrate results in increased expression of HSP90AB1 more ... CTD PMID:16470657|PMID:21318169 Hsp90ab1 Rat clofibrate decreases expression ISO RGD:1552591 6480464 Clofibrate results in decreased expression of HSP90AB1 mRNA CTD PMID:17585979 Hsp90ab1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of HSP90AB1 mRNA CTD PMID:17602206 Hsp90ab1 Rat cobalt dichloride increases expression ISO RGD:1346893 6480464 cobaltous chloride results in increased expression of HSP90AB1 mRNA CTD PMID:17553155 Hsp90ab1 Rat cobalt dichloride multiple interactions ISO RGD:1346893 6480464 cobaltous chloride promotes the reaction [HIF1A protein binds to HSP90AB1 protein] CTD PMID:29355601 Hsp90ab1 Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of HSP90AB1 mRNA CTD PMID:17898221 Hsp90ab1 Rat copper atom multiple interactions ISO RGD:1346893 6480464 [Chelating Agents binds to Copper] which results in decreased expression of HSP90AB1 mRNA; [Disulfiram binds more ... CTD PMID:24690739|PMID:30911355 Hsp90ab1 Rat copper(0) multiple interactions ISO RGD:1346893 6480464 [Chelating Agents binds to Copper] which results in decreased expression of HSP90AB1 mRNA; [Disulfiram binds more ... CTD PMID:24690739|PMID:30911355 Hsp90ab1 Rat copper(II) sulfate decreases expression ISO RGD:1346893 6480464 Copper Sulfate results in decreased expression of HSP90AB1 mRNA CTD PMID:20599845 Hsp90ab1 Rat copper(II) sulfate increases expression ISO RGD:1346893 6480464 Copper Sulfate results in increased expression of HSP90AB1 mRNA CTD PMID:19549813|PMID:20599845 Hsp90ab1 Rat coumarin increases phosphorylation ISO RGD:1346893 6480464 coumarin results in increased phosphorylation of HSP90AB1 protein CTD PMID:35688186 Hsp90ab1 Rat coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of HSP90AB1 mRNA; Coumestrol results in increased expression of HSP90AB1 more ... CTD PMID:15229138 Hsp90ab1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of HSP90AB1 mRNA CTD PMID:26577399 Hsp90ab1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of HSP90AB1 mRNA CTD PMID:27523638 Hsp90ab1 Rat curcumin multiple interactions EXP 6480464 Curcumin promotes the reaction [Diethylhexyl Phthalate results in increased expression of HSP90AB1 mRNA] CTD PMID:26361869 Hsp90ab1 Rat cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of HSP90AB1 mRNA CTD PMID:11906922 Hsp90ab1 Rat cyclosporin A increases expression ISO RGD:1346893 6480464 Cyclosporine results in increased expression of HSP90AB1 mRNA CTD PMID:20106945 Hsp90ab1 Rat cyclosporin A decreases methylation ISO RGD:1346893 6480464 Cyclosporine results in decreased methylation of HSP90AB1 promoter CTD PMID:27989131 Hsp90ab1 Rat DDE increases expression ISO RGD:1346893 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of HSP90AB1 mRNA CTD PMID:38568856 Hsp90ab1 Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of HSP90AB1 mRNA CTD PMID:19797855 Hsp90ab1 Rat deguelin increases expression ISO RGD:1346893 6480464 deguelin results in increased expression of HSP90AB1 mRNA CTD PMID:33512557 Hsp90ab1 Rat deoxynivalenol affects phosphorylation ISO RGD:1552591 6480464 deoxynivalenol affects the phosphorylation of HSP90AB1 protein CTD PMID:23811945 Hsp90ab1 Rat dexamethasone multiple interactions ISO RGD:1346893 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Hsp90ab1 Rat dextran sulfate multiple interactions EXP 6480464 celastrol inhibits the reaction [Dextran Sulfate results in increased expression of HSP90AB1 protein] CTD PMID:32470352 Hsp90ab1 Rat dextran sulfate increases expression EXP 6480464 Dextran Sulfate results in increased expression of HSP90AB1 protein CTD PMID:32470352 Hsp90ab1 Rat diarsenic trioxide increases expression ISO RGD:1346893 6480464 Arsenic Trioxide results in increased expression of HSP90AB1 mRNA; Arsenic Trioxide results in increased expression more ... CTD PMID:19364129|PMID:20458559|PMID:22521957 Hsp90ab1 Rat diarsenic trioxide affects response to substance ISO RGD:1346893 6480464 HSP90AB1 protein affects the susceptibility to Arsenic Trioxide CTD PMID:19371599 Hsp90ab1 Rat diarsenic trioxide decreases expression ISO RGD:1346893 6480464 Arsenic Trioxide results in decreased expression of HSP90AB1 protein CTD PMID:25419056 Hsp90ab1 Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of HSP90AB1 more ... CTD PMID:23359474 Hsp90ab1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of HSP90AB1 mRNA; Diethylstilbestrol results in increased expression of HSP90AB1 more ... CTD PMID:15229138 Hsp90ab1 Rat disodium selenite increases expression ISO RGD:1346893 6480464 Sodium Selenite results in increased expression of HSP90AB1 mRNA CTD PMID:18175754 Hsp90ab1 Rat disulfiram multiple interactions ISO RGD:1346893 6480464 [Disulfiram binds to Copper] which results in decreased expression of HSP90AB1 mRNA CTD PMID:24690739 Hsp90ab1 Rat dopamine increases expression ISO RGD:1346893 6480464 Dopamine results in increased expression of HSP90AB1 protein CTD PMID:24675778 Hsp90ab1 Rat doxorubicin increases expression ISO RGD:1552591 6480464 Doxorubicin results in increased expression of HSP90AB1 mRNA CTD PMID:22016648 Hsp90ab1 Rat doxorubicin affects expression ISO RGD:1346893 6480464 Doxorubicin affects the expression of HSP90AB1 protein CTD PMID:29385562 Hsp90ab1 Rat elemental selenium increases expression ISO RGD:1346893 6480464 Selenium results in increased expression of HSP90AB1 mRNA CTD PMID:19244175 Hsp90ab1 Rat enzyme inhibitor multiple interactions ISO RGD:1346893 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Hsp90ab1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of HSP90AB1 mRNA CTD PMID:16784954 Hsp90ab1 Rat ethanol multiple interactions ISO RGD:1552591 6480464 Ethanol affects the expression of and affects the splicing of HSP90AB1 mRNA CTD PMID:30319688 Hsp90ab1 Rat Evodiamine increases expression ISO RGD:1346893 6480464 evodiamine results in increased expression of HSP90AB1 mRNA CTD PMID:38878560 Hsp90ab1 Rat fenofibrate multiple interactions ISO RGD:1552591 6480464 PPARA protein affects the reaction [Fenofibrate results in increased expression of HSP90AB1 mRNA] CTD PMID:21318169 Hsp90ab1 Rat fenofibrate increases expression ISO RGD:1552591 6480464 Fenofibrate results in increased expression of HSP90AB1 mRNA CTD PMID:21318169 Hsp90ab1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of HSP90AB1 mRNA CTD PMID:24136188 Hsp90ab1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of HSP90AB1 mRNA CTD PMID:24136188 Hsp90ab1 Rat folic acid multiple interactions ISO RGD:1552591 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of HSP90AB1 mRNA CTD PMID:22206623 Hsp90ab1 Rat folic acid affects expression ISO RGD:1552591 6480464 Folic Acid affects the expression of HSP90AB1 mRNA CTD PMID:26547318 Hsp90ab1 Rat FR900359 affects phosphorylation ISO RGD:1346893 6480464 FR900359 affects the phosphorylation of HSP90AB1 protein CTD PMID:37730182 Hsp90ab1 Rat fulvestrant decreases expression ISO RGD:1346893 6480464 fulvestrant results in decreased expression of HSP90AB1 mRNA CTD PMID:16514628 Hsp90ab1 Rat gamendazole affects binding EXP 10401123 gamendazole binds to Hsp90ab1 protein RGD Hsp90ab1 Rat geldanamycin affects binding EXP 6480464 geldanamycin binds to HSP90AB1 protein CTD PMID:21749116 Hsp90ab1 Rat geldanamycin increases expression ISO RGD:1346893 6480464 geldanamycin results in increased expression of HSP90AB1 mRNA CTD PMID:26705709 Hsp90ab1 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of HSP90AB1 mRNA; Genistein results in increased expression of HSP90AB1 more ... CTD PMID:15229138 Hsp90ab1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HSP90AB1 mRNA CTD PMID:33387578 Hsp90ab1 Rat gold atom multiple interactions ISO RGD:1552591 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of HSP90AB1 mRNA CTD PMID:19695318 Hsp90ab1 Rat gold(0) multiple interactions ISO RGD:1552591 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of HSP90AB1 mRNA CTD PMID:19695318 Hsp90ab1 Rat hexachlorobenzene decreases expression EXP 6480464 Hexachlorobenzene results in decreased expression of HSP90AB1 mRNA CTD PMID:15159207 Hsp90ab1 Rat indometacin multiple interactions ISO RGD:1346893 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Hsp90ab1 Rat isoflavones multiple interactions EXP 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Isoflavones] results in increased expression of HSP90AB1 protein; [ENNG co-treated with Isoflavones] more ... CTD PMID:22248470 Hsp90ab1 Rat ivermectin multiple interactions ISO RGD:1346893 6480464 [Ivermectin co-treated with Albendazole] results in increased expression of HSP90AB1 mRNA CTD PMID:16861626 Hsp90ab1 Rat ivermectin decreases expression ISO RGD:1346893 6480464 Ivermectin results in decreased expression of HSP90AB1 protein CTD PMID:32959892 Hsp90ab1 Rat kojic acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Diethylnitrosamine] results in decreased expression of HSP90AB1 mRNA; more ... CTD PMID:18544905 Hsp90ab1 Rat L-ascorbic acid affects expression ISO RGD:1552591 6480464 Ascorbic Acid affects the expression of HSP90AB1 protein CTD PMID:19224539 Hsp90ab1 Rat lead nitrate multiple interactions ISO RGD:1552591 6480464 lead nitrate affects the reaction [HSP90AB1 affects the expression of MT1 mRNA]; lead nitrate affects more ... CTD PMID:11891201 Hsp90ab1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of HSP90AB1 mRNA CTD PMID:24136188 Hsp90ab1 Rat limonene increases expression EXP 6480464 limonene results in increased expression of HSP90AB1 mRNA CTD PMID:12815608 Hsp90ab1 Rat lipopolysaccharide multiple interactions ISO RGD:1346893 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of HSP90AB1 mRNA; [usnic more ... CTD PMID:22777745|PMID:35877022 Hsp90ab1 Rat lipopolysaccharide increases expression ISO RGD:1552591 6480464 Lipopolysaccharides results in increased expression of HSP90AB1 mRNA CTD PMID:15919760 Hsp90ab1 Rat lovastatin decreases expression ISO RGD:1552591 6480464 Lovastatin results in decreased expression of HSP90AB1 mRNA CTD PMID:20493250 Hsp90ab1 Rat methyl methanesulfonate decreases expression ISO RGD:1346893 6480464 Methyl Methanesulfonate results in decreased expression of HSP90AB1 mRNA CTD PMID:23649840 Hsp90ab1 Rat Methylazoxymethanol acetate increases expression EXP 6480464 Methylazoxymethanol Acetate results in increased expression of HSP90AB1 mRNA CTD PMID:28349193 Hsp90ab1 Rat methylisothiazolinone increases expression ISO RGD:1346893 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of HSP90AB1 mRNA CTD PMID:31629900 Hsp90ab1 Rat miconazole increases expression ISO RGD:1552591 6480464 Miconazole results in increased expression of HSP90AB1 mRNA CTD PMID:27462272 Hsp90ab1 Rat morphine increases expression EXP 6480464 Morphine results in increased expression of HSP90AB1 mRNA CTD PMID:15497504 Hsp90ab1 Rat motexafin gadolinium multiple interactions ISO RGD:1346893 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of HSP90AB1 mRNA CTD PMID:16357179 Hsp90ab1 Rat motexafin gadolinium increases expression ISO RGD:1346893 6480464 motexafin gadolinium results in increased expression of HSP90AB1 mRNA CTD PMID:16357179 Hsp90ab1 Rat N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of HSP90AB1 gene CTD PMID:16495775 Hsp90ab1 Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:1346893 6480464 1-Methyl-4-phenylpyridinium results in increased expression of HSP90AB1 protein CTD PMID:24675778 Hsp90ab1 Rat N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO RGD:1552591 6480464 [Methylnitronitrosoguanidine co-treated with Cadmium Chloride] results in increased expression of HSP90AB1 mRNA CTD PMID:19840844 Hsp90ab1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of HSP90AB1 mRNA CTD PMID:19638242|PMID:20360939 Hsp90ab1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of HSP90AB1 mRNA; [Diethylnitrosamine co-treated with kojic more ... CTD PMID:17602206|PMID:18544905 Hsp90ab1 Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of HSP90AB1 protein CTD PMID:19716841 Hsp90ab1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of HSP90AB1 mRNA CTD PMID:24136188 Hsp90ab1 Rat nickel dichloride multiple interactions ISO RGD:1346893 6480464 nickel chloride inhibits the reaction [HIF1A protein binds to HSP90AB1 protein] CTD PMID:29355601 Hsp90ab1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of HSP90AB1 mRNA CTD PMID:24136188 Hsp90ab1 Rat nitrates multiple interactions ISO RGD:1552591 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of HSP90AB1 more ... CTD PMID:35964746 Hsp90ab1 Rat nonanoic acid increases expression ISO RGD:1552591 6480464 pelargonic acid results in increased expression of HSP90AB1 mRNA CTD PMID:11379042 Hsp90ab1 Rat Nutlin-3 multiple interactions ISO RGD:1346893 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of HSP90AB1 protein CTD PMID:38460933 Hsp90ab1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of HSP90AB1 protein CTD PMID:31369848 Hsp90ab1 Rat oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of HSP90AB1 mRNA CTD PMID:12486162 Hsp90ab1 Rat ozone increases expression ISO RGD:1552591 6480464 Ozone results in increased expression of HSP90AB1 mRNA CTD PMID:21543283 Hsp90ab1 Rat ozone increases phosphorylation EXP 6480464 Ozone results in increased phosphorylation of HSP90AB1 protein CTD PMID:33146391 Hsp90ab1 Rat p-menthan-3-ol decreases expression ISO RGD:1346893 6480464 Menthol results in decreased expression of HSP90AB1 mRNA; Menthol results in decreased expression of HSP90AB1 more ... CTD PMID:26760959 Hsp90ab1 Rat paracetamol increases expression ISO RGD:1552591 6480464 Acetaminophen results in increased expression of HSP90AB1 mRNA CTD PMID:11743745|PMID:12958197 Hsp90ab1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of HSP90AB1 mRNA CTD PMID:33387578 Hsp90ab1 Rat paracetamol increases expression ISO RGD:1346893 6480464 Acetaminophen results in increased expression of HSP90AB1 mRNA CTD PMID:21420995 Hsp90ab1 Rat paracetamol affects expression ISO RGD:1552591 6480464 Acetaminophen affects the expression of HSP90AB1 mRNA CTD PMID:17562736 Hsp90ab1 Rat paracetamol multiple interactions ISO RGD:1552591 6480464 PTGS2 protein affects the reaction [Acetaminophen results in increased expression of HSP90AB1 mRNA] CTD PMID:11743745 Hsp90ab1 Rat paraoxon decreases expression ISO RGD:1346893 6480464 Paraoxon results in decreased expression of HSP90AB1 protein CTD PMID:20931991 Hsp90ab1 Rat PCB138 affects expression ISO RGD:1346893 6480464 2,2',3',4,4',5-hexachlorobiphenyl affects the expression of HSP90AB1 mRNA CTD PMID:21703328 Hsp90ab1 Rat PCB138 decreases expression EXP 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in decreased expression of HSP90AB1 protein CTD PMID:21673325 Hsp90ab1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552591 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HSP90AB1 mRNA CTD PMID:36331819 Hsp90ab1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of HSP90AB1 mRNA CTD PMID:19162173|PMID:21318169 Hsp90ab1 Rat Pf-06840003 multiple interactions ISO RGD:1346893 6480464 PF-06840003 inhibits the reaction [MAPT protein mutant form results in decreased expression of HSP90AB1 mRNA] CTD PMID:39172838 Hsp90ab1 Rat phenobarbital multiple interactions ISO RGD:1552591 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of HSP90AB1 mRNA] CTD PMID:19482888 Hsp90ab1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of HSP90AB1 mRNA CTD PMID:19162173 Hsp90ab1 Rat phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of HSP90AB1 mRNA CTD PMID:19162173 Hsp90ab1 Rat phenobarbital increases expression ISO RGD:1552591 6480464 Phenobarbital results in increased expression of HSP90AB1 mRNA CTD PMID:19482888 Hsp90ab1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of HSP90AB1 mRNA CTD PMID:15215175 Hsp90ab1 Rat phlorizin decreases expression ISO RGD:1552591 6480464 Phlorhizin results in decreased expression of HSP90AB1 mRNA CTD PMID:22538082 Hsp90ab1 Rat pinosylvin decreases expression ISO RGD:1346893 6480464 pinosylvin results in decreased expression of HSP90AB1 mRNA CTD PMID:23333577 Hsp90ab1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of HSP90AB1 mRNA CTD PMID:19162173|PMID:21318169|PMID:22484513 Hsp90ab1 Rat pirinixic acid increases expression ISO RGD:1552591 6480464 pirinixic acid results in increased expression of HSP90AB1 mRNA CTD PMID:18301758|PMID:23811191 Hsp90ab1 Rat potassium dichromate decreases expression ISO RGD:1346893 6480464 Potassium Dichromate results in decreased expression of HSP90AB1 protein CTD PMID:23718831 Hsp90ab1 Rat prostaglandin A1 increases metabolic processing ISO RGD:1552591 6480464 prostaglandin A1 analog results in increased metabolism of HSP90AB1 protein CTD PMID:19800325 Hsp90ab1 Rat quercetin decreases expression ISO RGD:1346893 6480464 Quercetin results in decreased expression of HSP90AB1 protein CTD PMID:19207037 Hsp90ab1 Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of HSP90AB1 mRNA; Quercetin results in decreased expression of HSP90AB1 more ... CTD PMID:11318950|PMID:17103110|PMID:18095365 Hsp90ab1 Rat raloxifene decreases expression ISO RGD:1346893 6480464 Raloxifene Hydrochloride results in decreased expression of HSP90AB1 mRNA CTD PMID:16514628 Hsp90ab1 Rat resveratrol multiple interactions EXP 6480464 resveratrol promotes the reaction [Diethylhexyl Phthalate results in increased expression of HSP90AB1 mRNA] CTD PMID:26361869 Hsp90ab1 Rat rotenone decreases expression ISO RGD:1552591 6480464 Rotenone results in decreased expression of HSP90AB1 mRNA CTD PMID:23186747 Hsp90ab1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of HSP90AB1 protein CTD PMID:35544339 Hsp90ab1 Rat rotenone decreases expression ISO RGD:1346893 6480464 Rotenone results in decreased expression of HSP90AB1 mRNA CTD PMID:33512557 Hsp90ab1 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of HSP90AB1 protein CTD PMID:30951809 Hsp90ab1 Rat rotenone increases expression ISO RGD:1552591 6480464 Rotenone results in increased expression of HSP90AB1 mRNA CTD PMID:22016648 Hsp90ab1 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression ISO RGD:1552591 6480464 Buthionine Sulfoximine results in increased expression of HSP90AB1 mRNA CTD PMID:15707499 Hsp90ab1 Rat selenium atom increases expression ISO RGD:1346893 6480464 Selenium results in increased expression of HSP90AB1 mRNA CTD PMID:19244175 Hsp90ab1 Rat silicon dioxide affects secretion ISO RGD:1346893 6480464 Silicon Dioxide analog affects the secretion of HSP90AB1 protein CTD PMID:25895662 Hsp90ab1 Rat sodium arsenite multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [sodium arsenite results in increased expression of HSP90AB1 protein]; sodium arsenite more ... CTD PMID:16456883 Hsp90ab1 Rat sodium arsenite multiple interactions ISO RGD:1552591 6480464 ATM protein affects the reaction [sodium arsenite results in decreased expression of HSP90AB1 mRNA]; CHEK2 more ... CTD PMID:18996350 Hsp90ab1 Rat sodium arsenite increases expression ISO RGD:1346893 6480464 sodium arsenite results in increased expression of HSP90AB1 mRNA CTD PMID:12119132|PMID:38568856 Hsp90ab1 Rat sodium arsenite decreases expression ISO RGD:1346893 6480464 sodium arsenite results in decreased expression of HSP90AB1 protein CTD PMID:21925251 Hsp90ab1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of HSP90AB1 protein CTD PMID:16456883 Hsp90ab1 Rat sodium arsenite decreases expression ISO RGD:1552591 6480464 sodium arsenite results in decreased expression of HSP90AB1 mRNA CTD PMID:18996350 Hsp90ab1 Rat sodium arsenite increases expression ISO RGD:1552591 6480464 sodium arsenite results in increased expression of HSP90AB1 mRNA CTD PMID:16014739|PMID:16322246 Hsp90ab1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of HSP90AB1 mRNA CTD PMID:22561333 Hsp90ab1 Rat sodium dichromate decreases expression ISO RGD:1552591 6480464 sodium bichromate results in decreased expression of HSP90AB1 mRNA CTD PMID:31558096 Hsp90ab1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of HSP90AB1 mRNA CTD PMID:25993096 Hsp90ab1 Rat sodium fluoride increases expression ISO RGD:1552591 6480464 Sodium Fluoride results in increased expression of HSP90AB1 protein CTD PMID:27548804 Hsp90ab1 Rat sulfasalazine increases expression ISO RGD:1552591 6480464 Sulfasalazine results in increased expression of HSP90AB1 mRNA CTD PMID:22016648 Hsp90ab1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of HSP90AB1 protein CTD PMID:26141394 Hsp90ab1 Rat T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of HSP90AB1 mRNA CTD PMID:26141394 Hsp90ab1 Rat tamibarotene affects expression ISO RGD:1346893 6480464 tamibarotene affects the expression of HSP90AB1 mRNA CTD PMID:15498508 Hsp90ab1 Rat tamoxifen affects expression ISO RGD:1552591 6480464 Tamoxifen affects the expression of HSP90AB1 mRNA CTD PMID:17555576 Hsp90ab1 Rat tanespimycin affects binding ISO RGD:1346893 6480464 tanespimycin binds to HSP90AB1 protein CTD PMID:22895790 Hsp90ab1 Rat tetrachloromethane increases expression ISO RGD:1552591 6480464 Carbon Tetrachloride results in increased expression of HSP90AB1 mRNA CTD PMID:27339419|PMID:31919559 Hsp90ab1 Rat thimerosal decreases expression ISO RGD:1346893 6480464 Thimerosal results in decreased expression of HSP90AB1 mRNA CTD PMID:27188386 Hsp90ab1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HSP90AB1 mRNA CTD PMID:34492290 Hsp90ab1 Rat thiostrepton increases expression ISO RGD:1346893 6480464 Thiostrepton results in increased expression of HSP90AB1 mRNA CTD PMID:22321511 Hsp90ab1 Rat thiram increases expression ISO RGD:1346893 6480464 Thiram results in increased expression of HSP90AB1 mRNA CTD PMID:38568856 Hsp90ab1 Rat titanium dioxide decreases methylation ISO RGD:1552591 6480464 titanium dioxide results in decreased methylation of HSP90AB1 promoter CTD PMID:35295148 Hsp90ab1 Rat toluene 2,4-diisocyanate decreases expression ISO RGD:1552591 6480464 Toluene 2,4-Diisocyanate results in decreased expression of HSP90AB1 mRNA CTD PMID:11379042 Hsp90ab1 Rat trans-pinosylvin decreases expression ISO RGD:1346893 6480464 pinosylvin results in decreased expression of HSP90AB1 mRNA CTD PMID:23333577 Hsp90ab1 Rat Tributyltin oxide decreases phosphorylation ISO RGD:1552591 6480464 bis(tri-n-butyltin)oxide results in decreased phosphorylation of HSP90AB1 protein CTD PMID:22174045 Hsp90ab1 Rat trichloroethene decreases expression ISO RGD:1552591 6480464 Trichloroethylene results in decreased expression of HSP90AB1 mRNA CTD PMID:28973375 Hsp90ab1 Rat trimellitic anhydride increases expression ISO RGD:1552591 6480464 trimellitic anhydride results in increased expression of HSP90AB1 mRNA CTD PMID:19042947 Hsp90ab1 Rat triphenylstannane decreases expression ISO RGD:1346893 6480464 triphenyltin analog results in decreased expression of HSP90AB1 protein CTD PMID:31634547 Hsp90ab1 Rat troglitazone increases expression ISO RGD:1346893 6480464 troglitazone results in increased expression of HSP90AB1 mRNA CTD PMID:19631733 Hsp90ab1 Rat tunicamycin decreases expression ISO RGD:1346893 6480464 Tunicamycin results in decreased expression of HSP90AB1 mRNA CTD PMID:29453283 Hsp90ab1 Rat uranium atom affects expression ISO RGD:1346893 6480464 Uranium affects the expression of HSP90AB1 mRNA; Uranium affects the expression of HSP90AB1 protein CTD PMID:15672453 Hsp90ab1 Rat usnic acid multiple interactions ISO RGD:1346893 6480464 [usnic acid co-treated with Lipopolysaccharides] results in decreased expression of HSP90AB1 mRNA CTD PMID:22777745 Hsp90ab1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of HSP90AB1 mRNA CTD PMID:24136188 Hsp90ab1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of HSP90AB1 mRNA CTD PMID:21318169 Hsp90ab1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of HSP90AB1 mRNA CTD PMID:19015723 Hsp90ab1 Rat vitamin E increases expression ISO RGD:1346893 6480464 Vitamin E results in increased expression of HSP90AB1 mRNA CTD PMID:19244175 Hsp90ab1 Rat vorinostat decreases expression ISO RGD:1346893 6480464 vorinostat results in decreased expression of HSP90AB1 mRNA; vorinostat results in decreased expression of HSP90AB1 more ... CTD PMID:20543569|PMID:27188386 Hsp90ab1 Rat warfarin decreases expression ISO RGD:1552591 6480464 Warfarin results in decreased expression of HSP90AB1 mRNA CTD PMID:20493250 Hsp90ab1 Rat zearalenone decreases expression ISO RGD:1552591 6480464 Zearalenone results in decreased expression of HSP90AB1 protein CTD PMID:36252740 Hsp90ab1 Rat zinc acetate multiple interactions ISO RGD:1346893 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of HSP90AB1 mRNA CTD PMID:16357179 Hsp90ab1 Rat zinc acetate increases expression ISO RGD:1346893 6480464 Zinc Acetate results in increased expression of HSP90AB1 mRNA CTD PMID:16357179 Hsp90ab1 Rat zinc pyrithione increases expression ISO RGD:1346893 6480464 pyrithione zinc results in increased expression of HSP90AB1 mRNA CTD PMID:21424779
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Hsp90ab1 Rat ATP binding TAS 1304538 RGD Hsp90ab1 Rat ATP binding enables IEA InterPro:IPR001404 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Hsp90ab1 Rat ATP binding enables IEA InterPro:IPR001404|InterPro:IPR019805 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Hsp90ab1 Rat ATP binding enables IBA PANTHER:PTN000163527|PomBase:SPAC926.04c|RGD:1303075|RGD:631409|UniProtKB:P07900|UniProtKB:P08238 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Hsp90ab1 Rat ATP binding enables ISO RGD:1346893 1624291 PMID:10543959, PMID:10811660 RGD PMID:10543959|PMID:10811660 Hsp90ab1 Rat ATP binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Hsp90ab1 Rat ATP binding IDA 724444 both the N- and the C-terminal nucleotide binding site RGD Hsp90ab1 Rat ATP hydrolysis activity enables IEA InterPro:IPR001404 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Hsp90ab1 Rat ATP hydrolysis activity enables IBA PANTHER:PTN000163527|PomBase:SPAC926.04c|SGD:S000004798|SGD:S000006161|TAIR:locus:2135887|TAIR:locus:2161815|UniProtKB:P07900|UniProtKB:P0A6Z3|UniProtKB:Q8IC05|WB:WBGene00000915|ZFIN:ZDB-GENE-030131-4257 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Hsp90ab1 Rat ATP-dependent protein binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat ATP-dependent protein binding enables ISO RGD:1346893 1624291 UniProtKB:Q15185 PMID:10543959, PMID:10811660 RGD PMID:10543959|PMID:10811660 Hsp90ab1 Rat ATP-dependent protein folding chaperone enables IEA InterPro:IPR001404 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Hsp90ab1 Rat CTP binding IDA 724444 both the N- and the C-terminal nucleotide binding site RGD Hsp90ab1 Rat dATP binding IDA 724444 both the N- and the C-terminal nucleotide binding site RGD Hsp90ab1 Rat disordered domain specific binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat disordered domain specific binding enables ISO RGD:1346893 1624291 UniProtKB:P21758|UniProtKB:P53041 PMID:11785981, PMID:15713458 RGD PMID:11785981|PMID:15713458 Hsp90ab1 Rat DNA polymerase binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat DNA polymerase binding enables ISO RGD:1346893 1624291 UniProtKB:O14746 PMID:10197982, PMID:19751963 RGD PMID:10197982|PMID:19751963 Hsp90ab1 Rat double-stranded RNA binding enables ISO RGD:1346893 1624291 PMID:21266579 RGD PMID:21266579 Hsp90ab1 Rat double-stranded RNA binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat GTP binding IDA 724444 only the C-terminal nucleotide binding site RGD Hsp90ab1 Rat heat shock protein binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat heat shock protein binding enables ISO RGD:1346893 1624291 UniProtKB:P07900 PMID:20353823 RGD PMID:20353823 Hsp90ab1 Rat heterocyclic compound binding IPI CHEBI:90703 10401123 RGD Hsp90ab1 Rat histone deacetylase binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat histone deacetylase binding enables ISO RGD:1346893 1624291 UniProtKB:Q9BY41 PMID:16809764 RGD PMID:16809764 Hsp90ab1 Rat histone methyltransferase binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat histone methyltransferase binding enables ISO RGD:1346893 1624291 UniProtKB:Q9NRG4 PMID:24880080 RGD PMID:24880080 Hsp90ab1 Rat identical protein binding enables ISO RGD:1346893 1624291 UniProtKB:P08238 PMID:21183720, PMID:22939624, PMID:30382094 RGD PMID:21183720|PMID:22939624|PMID:30382094 Hsp90ab1 Rat identical protein binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat kinase binding enables ISO RGD:1346893 1624291 UniProtKB:O70405|UniProtKB:Q02156 PMID:20353823, PMID:21855797 RGD PMID:20353823|PMID:21855797 Hsp90ab1 Rat kinase binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat kinase binding enables IEA UniProtKB:P11499|ensembl:ENSMUSP00000024739 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat kinase binding enables ISO RGD:1552591 1624291 UniProtKB:O70405 PMID:21855797 RGD PMID:21855797 Hsp90ab1 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Hsp90ab1 Rat peptide binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat peptide binding enables ISO RGD:1346893 1624291 UniProtKB:P01137-PRO_0000033762 PMID:20599762 RGD PMID:20599762 Hsp90ab1 Rat protein binding IPI RGD:1596143 5686376 RGD Hsp90ab1 Rat protein binding enables ISO RGD:1346893 1624291 UniProtKB:O00170|UniProtKB:O14733|UniProtKB:O14757|UniProtKB:O14980|UniProtKB:O15111|UniProtKB:O15146|UniProtKB:O15197|UniProtKB:O43765|UniProtKB:O52302|UniProtKB:O60260|UniProtKB:O75426|UniProtKB:O75469|UniProtKB:O94921|UniProtKB:O95433|UniProtKB:O95568|UniProtKB:O95801|UniProtKB:P00533|UniProtKB:P00540|UniProtKB:P04049|UniProtKB:P04626|UniProtKB:P04629|UniProtKB:P04637|UniProtKB:P05129|UniProtKB:P06239|UniProtKB:P06241|UniProtKB:P07900|UniProtKB:P07947|UniProtKB:P07948|UniProtKB:P08195|UniProtKB:P08581|UniProtKB:P08631|UniProtKB:P09769|UniProtKB:P10398|UniProtKB:P10636-8|UniProtKB:P11362|UniProtKB:P11801|UniProtKB:P11802|UniProtKB:P12931|UniProtKB:P14616|UniProtKB:P15056|UniProtKB:P16591|UniProtKB:P21860|UniProtKB:P22607|UniProtKB:P22694|UniProtKB:P29317|UniProtKB:P29474|UniProtKB:P29597|UniProtKB:P30304|UniProtKB:P30530|UniProtKB:P30561|UniProtKB:P31152|UniProtKB:P31749|UniProtKB:P31751|UniProtKB:P31948|UniProtKB:P35916|UniProtKB:P36896|UniProtKB:P41279|UniProtKB:P42679|UniProtKB:P43250|UniProtKB:P48729|UniProtKB:P49674|UniProtKB:P49758|UniProtKB:P49761|UniProtKB:P49840|UniProtKB:P50613|UniProtKB:P50750|UniProtKB:P51451|UniProtKB:P51812|UniProtKB:P51813|UniProtKB:P51817|UniProtKB:P53041|UniProtKB:P53671|UniProtKB:P56696|UniProtKB:P62753|UniProtKB:P62913|UniProtKB:P62979|UniProtKB:P68400|UniProtKB:P80192|UniProtKB:P84022|UniProtKB:Q00526|UniProtKB:Q00534|UniProtKB:Q00613|UniProtKB:Q01432|UniProtKB:Q01974|UniProtKB:Q02156|UniProtKB:Q02790|UniProtKB:Q05513|UniProtKB:Q06187|UniProtKB:Q06418|UniProtKB:Q07912|UniProtKB:Q08881|UniProtKB:Q13131|UniProtKB:Q13163|UniProtKB:Q13164|UniProtKB:Q13418|UniProtKB:Q13451|UniProtKB:Q13490|UniProtKB:Q13555|UniProtKB:Q13616|UniProtKB:Q13617|UniProtKB:Q13618|UniProtKB:Q13619|UniProtKB:Q13620|UniProtKB:Q13882|UniProtKB:Q14145|UniProtKB:Q14164|UniProtKB:Q14318|UniProtKB:Q15131|UniProtKB:Q15139|UniProtKB:Q15185|UniProtKB:Q15208|UniProtKB:Q15303|UniProtKB:Q15418|UniProtKB:Q15831|UniProtKB:Q16543|UniProtKB:Q16665|UniProtKB:Q16671|UniProtKB:Q16832|UniProtKB:Q2WGJ6|UniProtKB:Q53GT1|UniProtKB:Q6J9G0|UniProtKB:Q7L3B6|UniProtKB:Q7Z624|UniProtKB:Q86SG6|UniProtKB:Q86UX6|UniProtKB:Q86YV6|UniProtKB:Q8BK64|UniProtKB:Q8IWX7|UniProtKB:Q8N165|UniProtKB:Q8N7X4|UniProtKB:Q8NE63|UniProtKB:Q8NG66|UniProtKB:Q8TD08|UniProtKB:Q8TD19|UniProtKB:Q8TF76|UniProtKB:Q8WTQ7|UniProtKB:Q8WXR4|UniProtKB:Q92918|UniProtKB:Q96A26|UniProtKB:Q96AZ1|UniProtKB:Q96GD4|UniProtKB:Q96PF2|UniProtKB:Q96Q40|UniProtKB:Q96QS6|UniProtKB:Q96S53|UniProtKB:Q99558|UniProtKB:Q9BQI3|UniProtKB:Q9BUU2|UniProtKB:Q9BXA6|UniProtKB:Q9BXA7|UniProtKB:Q9BXM7|UniProtKB:Q9BYZ6|UniProtKB:Q9H1R3|UniProtKB:Q9H6T3|UniProtKB:Q9HBY8|UniProtKB:Q9NR20|UniProtKB:Q9P215|UniProtKB:Q9UHD1|UniProtKB:Q9UHD2|UniProtKB:Q9UKC9|UniProtKB:Q9UKT8|UniProtKB:Q9UL18|UniProtKB:Q9UM73|UniProtKB:Q9UNE7|UniProtKB:Q9UPZ9|UniProtKB:Q9UQ88|UniProtKB:Q9UQM7|UniProtKB:Q9Y2Z0-2|UniProtKB:Q9Y463|UniProtKB:Q9Y6K9 PMID:11036079, PMID:14743216, PMID:15358771, PMID:15581363, PMID:15657067, PMID:15870294, PMID:16293251, PMID:16314389, PMID:16330544, PMID:16531226, PMID:16580629, PMID:16698020, PMID:17932509, more ... RGD PMID:11036079|PMID:14743216|PMID:15358771|PMID:15581363|PMID:15657067|PMID:15870294|PMID:16293251|PMID:16314389|PMID:16330544|PMID:16531226|PMID:16580629|PMID:16698020|PMID:17932509|PMID:17979178|PMID:18239673|PMID:18320024|PMID:18818696|PMID:19375531|PMID:20029029|PMID:20374249|PMID:20618441|PMID:20650008|PMID:21145461|PMID:21170051|PMID:21183720|PMID:21360678|PMID:21730179|PMID:21988832|PMID:22022502|PMID:22113938|PMID:22843495|PMID:22939624|PMID:23349634|PMID:23414517|PMID:23428871|PMID:23431407|PMID:23455922|PMID:23585225|PMID:24189400|PMID:24581495|PMID:24613385|PMID:24618592|PMID:24658140|PMID:24794838|PMID:24880080|PMID:25036637|PMID:25416956|PMID:25486457|PMID:25910212|PMID:25959826|PMID:26269332|PMID:26496610|PMID:26517842|PMID:27339980|PMID:27880917|PMID:28330616|PMID:28514442|PMID:28634279|PMID:29127155|PMID:29568061|PMID:30382094|PMID:30824926|PMID:31980649|PMID:32296183|PMID:32707033|PMID:32814053|PMID:33961781|PMID:35063084|PMID:35271311|PMID:35384245|PMID:37045861|PMID:37207277|PMID:37788672 Hsp90ab1 Rat protein binding enables IPI UniProtKB:P17046 10412301 PMID:18644871 ParkinsonsUK-UCL Hsp90ab1 Rat protein binding enables IPI UniProtKB:P0C865 12790637 PMID:23428871 UniProt Hsp90ab1 Rat protein binding enables IPI UniProtKB:P82995,UniProtKB:Q4KLJ8 14695071 PMID:27496612 UniProt Hsp90ab1 Rat protein binding enables ISO RGD:1552591 1624291 PR:E9Q9D5|PR:P10417|PR:Q8VII8|UniProtKB:P06537|UniProtKB:P19426|UniProtKB:P61809-PRO_0000004796|UniProtKB:Q3UV55|UniProtKB:Q99Pj2|UniProtKB:Q9WVS8 PMID:11751894, PMID:11809749, PMID:17475835, PMID:17517623, PMID:21689689, PMID:22579285, PMID:23055941, PMID:23428871, PMID:27686098 RGD PMID:11751894|PMID:11809749|PMID:17475835|PMID:17517623|PMID:21689689|PMID:22579285|PMID:23055941|PMID:23428871|PMID:27686098 Hsp90ab1 Rat protein binding IPI RGD:69316 5686378 RGD Hsp90ab1 Rat protein carrier chaperone enables NAS 10412301 PMID:18644871 ParkinsonsUK-UCL Hsp90ab1 Rat protein dimerization activity enables ISS UniProtKB:P08238 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Hsp90ab1 Rat protein dimerization activity enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat protein dimerization activity enables ISO RGD:1346893 1624291 PMID:7588731 RGD PMID:7588731 Hsp90ab1 Rat protein folding chaperone enables IMP 13514081 PMID:17517623 ARUK-UCL Hsp90ab1 Rat protein folding chaperone enables IEA UniProtKB:P11499|ensembl:ENSMUSP00000024739 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat protein folding chaperone enables ISO RGD:1552591 1624291 PMID:17517623, PMID:24286867, PMID:27496612 RGD PMID:17517623|PMID:24286867|PMID:27496612 Hsp90ab1 Rat protein homodimerization activity enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat protein homodimerization activity enables ISO RGD:1346893 1624291 PMID:10811660 RGD PMID:10811660 Hsp90ab1 Rat protein kinase binding enables IEA UniProtKB:P11499|ensembl:ENSMUSP00000024739 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat protein kinase binding enables ISO RGD:1552591 1624291 UniProtKB:P49615 PMID:17517623 RGD PMID:17517623 Hsp90ab1 Rat protein kinase regulator activity contributes_to ISO RGD:1552591 1624291 PMID:21855797 RGD PMID:21855797 Hsp90ab1 Rat protein kinase regulator activity contributes_to IEA UniProtKB:P11499|ensembl:ENSMUSP00000024739 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat protein phosphatase activator activity enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat protein phosphatase activator activity enables ISO RGD:1346893 1624291 PMID:26593036 RGD PMID:26593036 Hsp90ab1 Rat receptor ligand inhibitor activity enables ISO RGD:1346893 1624291 PMID:20599762 RGD PMID:20599762 Hsp90ab1 Rat receptor ligand inhibitor activity enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat receptor ligand inhibitor activity enables ISS UniProtKB:P08238 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Hsp90ab1 Rat sulfonylurea receptor binding IPI UniProtKB:Q09427 5686755 RGD Hsp90ab1 Rat tau protein binding enables IEA UniProtKB:P11499|ensembl:ENSMUSP00000024739 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat tau protein binding enables ISO RGD:1552591 1624291 UniProtKB:P10636 PMID:17517623 RGD PMID:17517623 Hsp90ab1 Rat transmembrane transporter binding IPI RGD:69247 5686755 RGD Hsp90ab1 Rat ubiquitin protein ligase binding enables IEA UniProtKB:P08238|ensembl:ENSP00000360709 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Hsp90ab1 Rat ubiquitin protein ligase binding enables ISO RGD:1346893 1624291 UniProtKB:Q9UNE7 PMID:16207813 RGD PMID:16207813 Hsp90ab1 Rat unfolded protein binding enables IEA InterPro:IPR001404 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Hsp90ab1 Rat unfolded protein binding enables IBA FB:FBgn0001233|PANTHER:PTN000163527|PomBase:SPAC926.04c|SGD:S000004798|SGD:S000006161 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Hsp90ab1 Rat unfolded protein binding enables IEA InterPro:IPR001404|InterPro:IPR019805 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Hsp90ab1 Rat UTP binding IDA 724444 only the C-terminal nucleotide binding site RGD
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (R)-adrenaline (EXP) (Z)-3-butylidenephthalide (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (ISO) 2,4-dinitrotoluene (EXP) 2-amino-4,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-dihydrocoumarin (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP,ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (EXP) 4-vinylcyclohexene dioxide (ISO) 6-anilino-5,8-quinolinedione (EXP) 7,12-dimethyltetraphene (EXP) 7H-xanthine (EXP) 9H-xanthine (EXP) acrylamide (EXP,ISO) actinomycin D (ISO) afimoxifene (ISO) aflatoxin B1 (EXP,ISO) albendazole (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphibole asbestos (ISO) aniline (ISO) antimony(0) (ISO) antimycin A (ISO) arachidonic acid (ISO) Aroclor 1254 (ISO) arsenous acid (ISO) astemizole (EXP) atrazine (ISO) BAPTA (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) caffeine (ISO) calcidiol (EXP) cannabidiol (ISO) carbon nanotube (ISO) celastrol (EXP) chloropicrin (ISO) chloroprene (ISO) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) Cinobufagin (ISO) clofibrate (EXP,ISO) clofibric acid (EXP) cobalt dichloride (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (EXP) Cuprizon (EXP) curcumin (EXP) cyclophosphamide (EXP) cyclosporin A (ISO) DDE (ISO) DDT (EXP) deguelin (ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (EXP) diarsenic trioxide (ISO) dibutyl phthalate (EXP) diethylstilbestrol (EXP) disodium selenite (ISO) disulfiram (ISO) dopamine (ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) Evodiamine (ISO) fenofibrate (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gamendazole (EXP) geldanamycin (EXP,ISO) genistein (EXP) gentamycin (EXP) gold atom (ISO) gold(0) (ISO) hexachlorobenzene (EXP) indometacin (ISO) isoflavones (EXP) ivermectin (ISO) kojic acid (EXP) L-ascorbic acid (ISO) lead nitrate (ISO) leflunomide (EXP) limonene (EXP) lipopolysaccharide (ISO) lovastatin (ISO) methyl methanesulfonate (ISO) Methylazoxymethanol acetate (EXP) methylisothiazolinone (ISO) miconazole (ISO) morphine (EXP) motexafin gadolinium (ISO) N-ethyl-N-nitrosourea (EXP) N-methyl-4-phenylpyridinium (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nefazodone (EXP) nickel dichloride (ISO) nimesulide (EXP) nitrates (ISO) nonanoic acid (ISO) Nutlin-3 (ISO) ochratoxin A (EXP) oxidopamine (EXP) ozone (EXP,ISO) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) paraoxon (ISO) PCB138 (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) Pf-06840003 (ISO) phenobarbital (EXP,ISO) PhIP (EXP) phlorizin (ISO) pinosylvin (ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) prostaglandin A1 (ISO) quercetin (EXP,ISO) raloxifene (ISO) resveratrol (EXP) rotenone (EXP,ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP,ISO) sodium fluoride (ISO) sulfasalazine (ISO) T-2 toxin (EXP) tamibarotene (ISO) tamoxifen (ISO) tanespimycin (ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) thiostrepton (ISO) thiram (ISO) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) trans-pinosylvin (ISO) Tributyltin oxide (ISO) trichloroethene (ISO) trimellitic anhydride (ISO) triphenylstannane (ISO) troglitazone (ISO) tunicamycin (ISO) uranium atom (ISO) usnic acid (ISO) valdecoxib (EXP) valproic acid (EXP) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) warfarin (ISO) zearalenone (ISO) zinc acetate (ISO) zinc pyrithione (ISO)
Biological Process
cellular response to heat (IBA,IEA,ISO) cellular response to interleukin-4 (IEA,ISO) chaperone-mediated autophagy (NAS) chaperone-mediated protein complex assembly (IEA,ISO) negative regulation of apoptotic process (IEA,ISO) negative regulation of complement-dependent cytotoxicity (IMP) negative regulation of neuron apoptotic process (IMP) negative regulation of proteasomal protein catabolic process (IEA,IMP,ISO) negative regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO,ISS) obsolete chaperone-mediated protein folding (IEA,ISO) placenta development (IEA,ISO) positive regulation of cell differentiation (IEA,ISO) positive regulation of cell size (IMP) positive regulation of protein binding (IMP) positive regulation of protein import into nucleus (IMP) positive regulation of protein localization to cell surface (IEA,ISO) positive regulation of protein serine/threonine kinase activity (IMP) positive regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO,ISS) protein folding (IBA,IEA,IMP,ISO,TAS) protein stabilization (IBA) regulation of cell cycle (IEA,ISO,ISS) regulation of protein complex stability (NAS) regulation of protein localization (IEA,ISO) regulation of protein ubiquitination (IEA,ISO) response to cocaine (IEP) response to salt stress (IEP) response to unfolded protein (TAS) response to xenobiotic stimulus (IEP) supramolecular fiber organization (IEA,ISO) telomerase holoenzyme complex assembly (IEA,ISO) telomere maintenance via telomerase (IEA,ISO) virion attachment to host cell (IEA,ISO)
Cellular Component
apical plasma membrane (IDA) aryl hydrocarbon receptor complex (IEA,ISO,ISS) axonal growth cone (IEA,ISO) basolateral plasma membrane (IDA) brush border membrane (IDA) cell surface (IDA) COP9 signalosome (IEA,ISO) cytoplasm (IDA,IEA,ISO) cytosol (IBA,IEA,ISO) dendritic growth cone (IEA,ISO) dynein axonemal particle (IEA,ISS) extracellular region (IEA,ISO,ISS) HSP90-CDC37 chaperone complex (IEA,ISO) inclusion body (IDA) lysosomal lumen (TAS) lysosomal membrane (IDA) melanosome (IEA) membrane (IEA) neuronal cell body (IEA,ISO) nucleus (IEA,ISO,ISS) ooplasm (IDA) perinuclear region of cytoplasm (IBA,IEA,ISO) plasma membrane (IBA,IEA,ISO) protein folding chaperone complex (IEA,IMP,ISO) protein-containing complex (IBA,IEA,ISO) sperm head plasma membrane (IDA)
Molecular Function
ATP binding (IBA,IDA,IEA,ISO,TAS) ATP hydrolysis activity (IBA,IEA) ATP-dependent protein binding (IEA,ISO) ATP-dependent protein folding chaperone (IEA) CTP binding (IDA) dATP binding (IDA) disordered domain specific binding (IEA,ISO) DNA polymerase binding (IEA,ISO) double-stranded RNA binding (IEA,ISO) GTP binding (IDA) heat shock protein binding (IEA,ISO) heterocyclic compound binding (IPI) histone deacetylase binding (IEA,ISO) histone methyltransferase binding (IEA,ISO) identical protein binding (IEA,ISO) kinase binding (IEA,ISO) nucleotide binding (IEA) peptide binding (IEA,ISO) protein binding (IPI,ISO) protein carrier chaperone (NAS) protein dimerization activity (IEA,ISO,ISS) protein folding chaperone (IEA,IMP,ISO) protein homodimerization activity (IEA,ISO) protein kinase binding (IEA,ISO) protein kinase regulator activity (IEA,ISO) protein phosphatase activator activity (IEA,ISO) receptor ligand inhibitor activity (IEA,ISO,ISS) sulfonylurea receptor binding (IPI) tau protein binding (IEA,ISO) transmembrane transporter binding (IPI) ubiquitin protein ligase binding (IEA,ISO) unfolded protein binding (IBA,IEA) UTP binding (IDA)
1.
The chaperone-mediated autophagy receptor organizes in dynamic protein complexes at the lysosomal membrane.
Bandyopadhyay U, etal., Mol Cell Biol. 2008 Sep;28(18):5747-63. doi: 10.1128/MCB.02070-07. Epub 2008 Jul 21.
2.
Antitumor activity of the combination of an HSP90 inhibitor and a PI3K/mTOR dual inhibitor against cholangiocarcinoma.
Chen MH, etal., Oncotarget. 2014 May 15;5(9):2372-89. doi: 10.18632/oncotarget.1706.
3.
Protection of oligodendrocyte precursor cells by low doses of HSP90 inhibitors in cell culture.
Cid C and Alcazar A, Exp Neurol. 2010 Sep;225(1):29-33. Epub 2009 Dec 4.
4.
Antibodies reactive to heat shock protein 90 induce oligodendrocyte precursor cell death in culture. Implications for demyelination in multiple sclerosis.
Cid C, etal., FASEB J. 2004 Feb;18(2):409-11. Epub 2003 Dec 19.
5.
Anti-heat shock protein 90beta antibodies decrease pre-oligodendrocyte population in perinatal and adult cell cultures. Implications for remyelination in multiple sclerosis.
Cid C, etal., J Neurochem. 2005 Oct;95(2):349-60. Epub 2005 Aug 31.
6.
Canonical and kinase activity-independent mechanisms for extracellular signal-regulated kinase 5 (ERK5) nuclear translocation require dissociation of Hsp90 from the ERK5-Cdc37 complex.
Erazo T, etal., Mol Cell Biol. 2013 Apr;33(8):1671-86. doi: 10.1128/MCB.01246-12. Epub 2013 Feb 19.
7.
Mass spectrometry analysis of complexes formed by myotonic dystrophy protein kinase (DMPK).
Forner F, etal., Biochim Biophys Acta. 2010 Jun;1804(6):1334-41. Epub 2010 Feb 25.
8.
HSP90 interacting with IRS-2 is involved in cAMP-dependent potentiation of IGF-I signals in FRTL-5 cells.
Fukushima T, etal., Mol Cell Endocrinol. 2011 Sep 15;344(1-2):81-9. Epub 2011 Jul 1.
9.
Cocaine withdrawal causes delayed dysregulation of stress genes in the hippocampus.
Garcia-Fuster MJ, etal., PLoS One. 2012;7(7):e42092. doi: 10.1371/journal.pone.0042092. Epub 2012 Jul 30.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Apg-2 has a chaperone-like activity similar to Hsp110 and is overexpressed in hepatocellular carcinomas.
Gotoh K, etal., FEBS Lett 2004 Feb 27;560(1-3):19-24.
12.
Down-regulation of heat shock protein HSP90ab1 in radiation-damaged lung cells other than mast cells.
Haase MG, etal., J Histochem Cytochem. 2014 May;62(5):355-68. doi: 10.1369/0022155414529133. Epub 2014 Mar 26.
13.
Protein kinase C-delta mediates neuronal apoptosis in the retinas of diabetic rats via the Akt signaling pathway.
Kim YH, etal., Diabetes. 2008 Aug;57(8):2181-90. Epub 2008 Apr 28.
14.
Interaction of a Novel Chaperone PhLP2A With the Heat Shock Protein Hsp90.
Krzemień-Ojak Ł, etal., J Cell Biochem. 2017 Feb;118(2):420-429. doi: 10.1002/jcb.25669. Epub 2016 Oct 17.
15.
Heat shock protein 90 regulates IkappaB kinase complex and NF-kappaB activation in angiotensin II-induced cardiac cell hypertrophy.
Lee KH, etal., Exp Mol Med. 2010 Oct 31;42(10):703-11.
16.
Induction of molecular chaperones in carbon tetrachloride-treated rat liver: implications in protection against liver damage.
Lee KJ, etal., Cell Stress Chaperones. 2004 Mar;9(1):58-68.
17.
Purification and identification of secreted oxidative stress-induced factors from vascular smooth muscle cells.
Liao DF, etal., J Biol Chem 2000 Jan 7;275(1):189-96.
18.
Protective effect of L-Arginine administration on proteins of unloaded m. soleus.
Lomonosova YN, etal., Biochemistry (Mosc). 2011 May;76(5):571-80. doi: 10.1134/S0006297911050075.
19.
Roles of heat-shock protein 90 in maintaining and facilitating the neurodegenerative phenotype in tauopathies.
Luo W, etal., Proc Natl Acad Sci U S A. 2007 May 29;104(22):9511-6. doi: 10.1073/pnas.0701055104. Epub 2007 May 21.
20.
Paternal exposure to testis cancer chemotherapeutics alters sperm fertilizing capacity and affects gene expression in the eight-cell stage rat embryo.
Maselli J, etal., Andrology. 2014 Mar;2(2):259-66. doi: 10.1111/j.2047-2927.2014.00185.x. Epub 2014 Jan 29.
21.
Cloning and regulation by glucocorticoid receptor ligands of a rat hsp90.
McGuire JA, etal., J Steroid Biochem Mol Biol 1992 Sep;42(8):813-22.
22.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
23.
Acute pancreatitis: hypertonic saline increases heat shock proteins 70 and 90 and reduces neutrophil infiltration in lung injury.
Moretti AI, etal., Pancreas. 2009 Jul;38(5):507-14.
24.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
25.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
26.
A block in the road to fertility: autoantibodies to heat-shock protein 90-beta in human ovarian autoimmunity.
Pires ES and Khole VV, Fertil Steril. 2009 Oct;92(4):1395-409. doi: 10.1016/j.fertnstert.2008.08.068. Epub 2008 Nov 19.
27.
Chaperoning of glucocorticoid receptors.
Pratt WB, etal., Handb Exp Pharmacol. 2006;(172):111-38.
28.
Molecular chaperones throughout the life cycle of the androgen receptor.
Prescott J and Coetzee GA, Cancer Lett. 2006 Jan 8;231(1):12-9.
29.
Upregulation and intrarenal redistribution of heat shock proteins 90alpha and 90beta by low-sodium diet in the rat.
Ramirez V, etal., Cell Stress Chaperones. 2004 Summer;9(2):198-206.
30.
GOA pipeline
RGD automated data pipeline
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Identification of HSP90 as a new GABARAPL1 (GEC1)-interacting protein.
Seguin-Py S, etal., Biochimie. 2011 Nov 20.
33.
Minireview: the intersection of steroid receptors with molecular chaperones: observations and questions.
Smith DF and Toft DO, Mol Endocrinol. 2008 Oct;22(10):2229-40. Epub 2008 May 1.
34.
Comparative analysis of the ATP-binding sites of Hsp90 by nucleotide affinity cleavage: a distinct nucleotide specificity of the C-terminal ATP-binding site.
Soti C, etal., Eur J Biochem 2003 Jun;270(11):2421-8.
35.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
36.
Gamendazole, an orally active indazole carboxylic acid male contraceptive agent, targets HSP90AB1 (HSP90BETA) and EEF1A1 (eEF1A), and stimulates Il1a transcription in rat Sertoli cells.
Tash JS, etal., Biol Reprod. 2008 Jun;78(6):1139-52. doi: 10.1095/biolreprod.107.062679. Epub 2008 Jan 23.
37.
Pseudovacuoles--immobilized by high-pressure freezing--are associated with blebbing in walker carcinosarcoma cells.
Vanhecke D, etal., J Microsc. 2008 May;230(Pt 2):253-62.
38.
Role of Hsp90 in biogenesis of the beta-cell ATP-sensitive potassium channel complex.
Yan FF, etal., Mol Biol Cell. 2010 Jun 15;21(12):1945-54. Epub 2010 Apr 28.
39.
Interactions of the mineralocorticoid receptor--within and without.
Yang J and Fuller PJ, Mol Cell Endocrinol. 2012 Mar 24;350(2):196-205. doi: 10.1016/j.mce.2011.07.001. Epub 2011 Jul 18.
40.
The potential role of heat shock proteins in acute spinal cord injury.
Zhou Y, etal., Eur Spine J. 2014 Jul;23(7):1480-90. doi: 10.1007/s00586-014-3214-1. Epub 2014 Feb 6.
Hsp90ab1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 22,930,249 - 22,935,929 (+) NCBI GRCr8 mRatBN7.2 9 15,432,986 - 15,438,358 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 15,433,691 - 15,438,488 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 24,019,488 - 24,024,885 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 29,082,165 - 29,087,562 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 27,382,927 - 27,388,324 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 17,817,791 - 17,823,163 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 17,817,721 - 17,823,243 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 16,706,512 - 16,711,884 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 11,033,496 - 11,038,868 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 11,030,786 - 11,036,319 (+) NCBI Celera 9 13,176,225 - 13,181,597 (+) NCBI Celera Cytogenetic Map 9 q12 NCBI
HSP90AB1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 44,246,194 - 44,253,883 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 44,246,166 - 44,253,888 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 44,213,931 - 44,221,620 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 44,322,827 - 44,329,592 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 44,322,826 - 44,329,592 NCBI Celera 6 45,767,994 - 45,774,759 (+) NCBI Celera Cytogenetic Map 6 p21.1 NCBI HuRef 6 43,935,917 - 43,943,640 (+) NCBI HuRef CHM1_1 6 44,217,626 - 44,225,330 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 44,080,360 - 44,088,031 (+) NCBI T2T-CHM13v2.0
Hsp90ab1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 45,878,704 - 45,884,187 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 45,878,701 - 45,884,197 (-) Ensembl GRCm39 Ensembl GRCm38 17 45,567,778 - 45,573,261 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 45,567,775 - 45,573,271 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 45,704,727 - 45,710,210 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 45,031,359 - 45,036,842 (-) NCBI MGSCv36 mm8 Celera 17 49,000,428 - 49,005,921 (-) NCBI Celera Cytogenetic Map 17 B3 NCBI cM Map 17 22.59 NCBI
Hsp90ab1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 9,873,908 - 9,878,459 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 9,872,649 - 9,878,459 (+) NCBI ChiLan1.0 ChiLan1.0
HSP90AB1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 58,750,514 - 58,757,909 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 54,620,583 - 54,627,983 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 43,842,796 - 43,849,637 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 45,126,060 - 45,132,972 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 45,125,773 - 45,133,872 (+) Ensembl panpan1.1 panPan2
HSP90AB1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 12,658,415 - 12,664,945 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 12,660,008 - 12,664,940 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 12,682,075 - 12,689,685 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 13,139,324 - 13,147,144 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 13,140,459 - 13,147,650 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 12,665,005 - 12,672,579 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 12,752,685 - 12,760,264 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 12,846,448 - 12,854,258 (+) NCBI UU_Cfam_GSD_1.0
Hsp90ab1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 48,123,181 - 48,129,743 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 15,830,459 - 15,835,535 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 15,830,459 - 15,836,994 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HSP90AB1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 39,244,458 - 39,250,481 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 39,237,299 - 39,250,479 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 45,106,779 - 45,119,936 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HSP90AB1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 27,914,261 - 27,921,666 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 27,911,013 - 27,921,251 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 44,300,580 - 44,307,963 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hsp90ab1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 292 Count of miRNA genes: 191 Interacting mature miRNAs: 214 Transcripts: ENSRNOT00000026920 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 61450 Ciaa3 CIA Autoantibody QTL 3 6.5 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 9 7954720 22071169 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat 61425 Cia15 Collagen induced arthritis QTL 15 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 9 5109826 42921101 Rat 70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1600365 Mcs20 Mammary carcinoma susceptibility QTL 20 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 9 13533770 42791750 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat
RH127542
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 15,438,717 - 15,438,913 (+) MAPPER mRatBN7.2 Rnor_6.0 9 17,823,523 - 17,823,718 NCBI Rnor6.0 Rnor_5.0 9 16,712,244 - 16,712,439 UniSTS Rnor5.0 RGSC_v3.4 9 11,039,228 - 11,039,424 UniSTS RGSC3.4 Celera 9 13,181,957 - 13,182,152 UniSTS RH 3.4 Map 9 78.5 UniSTS Cytogenetic Map 9 q12 UniSTS
RH129394
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 15,438,604 - 15,438,786 (+) MAPPER mRatBN7.2 Rnor_6.0 9 17,823,410 - 17,823,591 NCBI Rnor6.0 Rnor_5.0 9 16,712,131 - 16,712,312 UniSTS Rnor5.0 RGSC_v3.4 9 11,039,115 - 11,039,296 UniSTS RGSC3.4 Celera 9 13,181,844 - 13,182,025 UniSTS RH 3.4 Map 2 1089.99 UniSTS Cytogenetic Map 9 q12 UniSTS
RH140045
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 2 196,981,799 - 196,982,006 NCBI Rnor5.0 Rnor_5.0 2 249,154,349 - 249,154,557 NCBI Rnor5.0 RGSC_v3.4 2 223,131,022 - 223,131,229 UniSTS RGSC3.4 RGSC_v3.4 2 170,299,880 - 170,300,086 UniSTS RGSC3.4 Celera 2 206,759,298 - 206,759,505 UniSTS Celera 2 158,132,772 - 158,132,978 UniSTS RH 3.4 Map 9 79.0 UniSTS Cytogenetic Map 9 q12 UniSTS Cytogenetic Map 2 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026920 ⟹ ENSRNOP00000026920
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 15,433,691 - 15,438,361 (+) Ensembl Rnor_6.0 Ensembl 9 17,817,791 - 17,823,163 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086986 ⟹ ENSRNOP00000074112
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 15,434,254 - 15,438,488 (+) Ensembl Rnor_6.0 Ensembl 9 17,817,721 - 17,823,243 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113617 ⟹ ENSRNOP00000093861
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 15,434,254 - 15,438,488 (+) Ensembl
RefSeq Acc Id:
NM_001004082 ⟹ NP_001004082
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 22,930,423 - 22,935,795 (+) NCBI mRatBN7.2 9 15,432,986 - 15,438,358 (+) NCBI Rnor_6.0 9 17,817,791 - 17,823,163 (+) NCBI Rnor_5.0 9 16,706,512 - 16,711,884 (+) NCBI RGSC_v3.4 9 11,033,496 - 11,038,868 (+) RGD Celera 9 13,176,225 - 13,181,597 (+) RGD
Sequence:
CCGGGCCCACCCTGCTCTGTACTACTACTCGGCTTTCTCGTCAAGATGCCTGAGGAAGTGCACCATGGAGAGGAAGAGGTGGAGACCTTCGCCTTTCAGGCAGAAATTGCCCAGCTGATGTCCCTCAT CATCAACACTTTCTACTCAAACAAAGAGATTTTCCTCCGGGAGTTGATCTCTAATGCTTCTGATGCCCTGGACAAGATTCGGTATGAGAGCCTGACTGACCCTTCCAAGTTGGACAGCGGGAAAGAGC TGAAGATTGACATCATCCCCAACCCTCAGGAACGCACGCTGACTTTGGTGGACACAGGCATTGGCATGACCAAGGCTGACCTCATAAATAACTTGGGAACCATTGCTAAGTCTGGTACAAAGGCGTTC ATGGAGGCTCTCCAGGCTGGTGCAGACATCTCCATGATTGGGCAGTTTGGTGTCGGCTTCTACTCTGCCTACCTGGTGGCAGAGAAAGTGGTTGTGATCACGAAGCACAACGATGATGAGCAGTATGC CTGGGAGTCTTCTGCTGGTGGATCCTTCACTGTCCGTGCAGACCACGGTGAGCCCATTGGCCGGGGTACCAAAGTGATCCTTCACCTCAAAGAAGACCAGACAGAGTACTTAGAGGAGAGGAGGGTCA AGGAGGTGGTGAAGAAACACTCACAGTTCATAGGCTACCCCATCACCCTCTATCTGGAGAAGGAACGCGAGAAGGAGATCAGTGATGATGAGGCAGAGGAAGAGAAAGGGGAGAAGGAGGAGGAAGAT AAGGAGGATGAGGAGAAGCCTAAGATTGAGGATGTGGGATCTGATGAGGAGGATGACAGCGGCAAAGATAAGAAAAAGAAAACAAAGAAGATCAAGGAGAAGTACATTGACCAGGAAGAGCTGAATAA GACGAAGCCCATCTGGACCAGAAATCCTGATGACATCACTCAAGAGGAATATGGTGAATTCTACAAGAGCCTCACCAATGACTGGGAAGACCACTTGGCAGTCAAGCACTTCTCTGTAGAAGGGCAGT TGGAATTCAGGGCATTGCTCTTCATTCCCCGGCGAGCTCCCTTTGACCTCTTTGAGAACAAGAAGAAGAAGAACAACATCAAATTGTATGTCCGTCGTGTGTTCATCATGGACAGCTGTGATGAGCTG ATACCTGAGTACCTCAACTTCATCCGTGGTGTGGTTGATTCCGAGGACCTGCCTCTGAACATCTCCCGAGAAATGCTCCAGCAGAGCAAGATCCTGAAAGTCATCCGCAAAAACATTGTGAAGAAGTG CCTTGAGCTCTTCTCTGAGTTGGCTGAAGACAAAGAGAACTACAAGAAATTTTATGAGGCATTCTCTAAGAATTTAAAGCTTGGAATCCATGAGGATTCCACTAACCGTCGCCGCCTCTCTGAGCTCC TTCGCTACCATACCTCTCAGTCTGGAGATGAGATGACTTCCCTGTCAGAGTATGTGTCTCGCATGAAGGAGACACAGAAGTCCATCTACTATATCACTGGTGAGAGCAAAGAGCAGGTGGCCAACTCT GCCTTCGTGGAGCGTGTGCGGAAACGGGGCTTTGAGGTGGTATACATGACTGAGCCCATTGATGAGTACTGCGTACAGCAGCTCAAGGAGTTCGATGGCAAGAGCCTGGTCTCCGTGACCAAGGAGGG CCTGGAGCTACCAGAGGATGAGGAAGAGAAGAAAAAAATGGAGGAGAGCAAGGCAAAGTTTGAGAATCTCTGCAAGCTCATGAAGGAGATCTTGGACAAGAAGGTTGAAAAAGTGACTATCTCCAATA GGCTTGTGTCTTCCCCCTGCTGCATTGTGACCAGCACCTACGGCTGGACAGCCAACATGGAACGGATTATGAAGGCCCAGGCACTGCGGGACAACTCGACAATGGGCTACATGATGGCCAAGAAACAC CTAGAGATCAACCCTGACCACCCCATTGTGGAGACTCTGCGGCAGAAGGCTGAGGCAGACAAAAACGACAAAGCTGTCAAAGACCTGGTGGTGCTGCTGTTTGAGACTGCTCTGCTCTCCTCTGGCTT CTCACTTGAGGACCCCCAAACCCACTCCAACCGCATCTACCGCATGATTAAACTAGGCCTGGGCATTGATGAAGATGAGGTCACTGCAGAAGAGCCCAGTGCTGCTGTTCCCGATGAGATCCCCCCAC TGGAGGGTGATGAGGATGCCTCTCGCATGGAAGAAGTGGATTAAAGGCTCCTGGGAAGCCCCCGCCCTCTGTATAGTATCCCTGTGGCTCCCCCAACAGCCTTGACTGGCCCTGACCCACCTGGCTCT CTGCTCATGTCTACAAGAATCTCTTCTATCCTGT
hide sequence
RefSeq Acc Id:
XM_063266850 ⟹ XP_063122920
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 22,930,249 - 22,935,929 (+) NCBI
RefSeq Acc Id:
NP_001004082 ⟸ NM_001004082
- UniProtKB:
Q68GV5 (UniProtKB/Swiss-Prot), Q66H55 (UniProtKB/Swiss-Prot), Q1PSW2 (UniProtKB/Swiss-Prot), Q9QWC6 (UniProtKB/Swiss-Prot), P34058 (UniProtKB/Swiss-Prot), A0A8L2QEA3 (UniProtKB/TrEMBL)
- Sequence:
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQ FGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKEDEEKPKIEDVGSD EEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSE DLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVY MTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQ KAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEVD
hide sequence
Ensembl Acc Id:
ENSRNOP00000026920 ⟸ ENSRNOT00000026920
Ensembl Acc Id:
ENSRNOP00000074112 ⟸ ENSRNOT00000086986
Ensembl Acc Id:
ENSRNOP00000093861 ⟸ ENSRNOT00000113617
RefSeq Acc Id:
XP_063122920 ⟸ XM_063266850
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QEA3 (UniProtKB/TrEMBL)
RGD ID: 13696546
Promoter ID: EPDNEW_R7065
Type: multiple initiation site
Name: Hsp90ab1_1
Description: heat shock protein 90 alpha family class B member 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 17,817,739 - 17,817,799 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-29
Hsp90ab1
heat shock protein 90 alpha family class B member 1
Hsp90ab1
heat shock protein 90kDa alpha family class B member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2016-02-25
Hsp90ab1
heat shock protein 90kDa alpha family class B member 1
Hsp90ab1
heat shock protein 90 alpha (cytosolic), class B member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2011-04-27
Hsp90ab1
heat shock protein 90 alpha (cytosolic), class B member 1
Hsp90ab1
heat shock protein 90kDa alpha (cytosolic), class B member 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-01-09
Hsp90ab1
heat shock protein 90kDa alpha (cytosolic), class B member 1
Hspcb
heat shock 90kDa protein 1, beta
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863
APPROVED
2006-03-30
Hspcb
heat shock 90kDa protein 1, beta
Symbol and Name status set to approved
1299863
APPROVED
2005-02-14
Hspcb
heat shock 90kDa protein 1, beta
Symbol and Name status set to provisional
70820
PROVISIONAL