Symbol:
Usp11
Name:
ubiquitin specific peptidase 11
RGD ID:
1303052
Description:
Predicted to enable cysteine-type deubiquitinase activity; cysteine-type endopeptidase activity; and transcription corepressor binding activity. Predicted to be involved in protein deubiquitination. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in nucleus. Orthologous to human USP11 (ubiquitin specific peptidase 11); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-methoxyethanol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
deubiquitinating enzyme 11; MGC105909; ubiquitin carboxyl-terminal hydrolase 11; ubiquitin specific protease 11; ubiquitin thioesterase 11; ubiquitin-specific-processing protease 11; Uhx1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 4,026,865 - 4,043,036 (-) NCBI GRCr8 mRatBN7.2 X 1,473,349 - 1,489,520 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 1,473,350 - 1,489,520 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 1,507,286 - 1,523,463 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 4,982,988 - 4,999,165 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 1,298,355 - 1,314,525 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 1,687,820 - 1,703,991 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 1,687,811 - 1,704,033 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 2,481,251 - 2,497,422 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 12,890,515 - 12,906,686 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 12,896,694 - 12,903,135 (-) NCBI Celera X 2,037,481 - 2,053,652 (-) NCBI Celera Cytogenetic Map X q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Usp11 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 4,026,865 - 4,043,036 (-) NCBI GRCr8 mRatBN7.2 X 1,473,349 - 1,489,520 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 1,473,350 - 1,489,520 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 1,507,286 - 1,523,463 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 4,982,988 - 4,999,165 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 1,298,355 - 1,314,525 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 1,687,820 - 1,703,991 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 1,687,811 - 1,704,033 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 2,481,251 - 2,497,422 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 12,890,515 - 12,906,686 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 12,896,694 - 12,903,135 (-) NCBI Celera X 2,037,481 - 2,053,652 (-) NCBI Celera Cytogenetic Map X q11 NCBI
USP11 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 47,233,009 - 47,248,328 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 47,232,866 - 47,248,328 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 47,092,408 - 47,107,727 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 46,977,258 - 46,992,671 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 46,848,567 - 46,863,981 NCBI Celera X 51,287,607 - 51,302,967 (+) NCBI Celera Cytogenetic Map X p11.3 NCBI HuRef X 44,802,084 - 44,817,144 (+) NCBI HuRef CHM1_1 X 47,123,812 - 47,139,152 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 46,642,700 - 46,657,954 (+) NCBI T2T-CHM13v2.0
Usp11 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 20,570,148 - 20,586,778 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 20,570,145 - 20,586,778 (+) Ensembl GRCm39 Ensembl GRCm38 X 20,703,909 - 20,720,539 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 20,703,906 - 20,720,539 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 20,281,035 - 20,297,665 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 19,860,891 - 19,877,498 (+) NCBI MGSCv36 mm8 Celera X 18,833,854 - 18,850,416 (+) NCBI Celera Cytogenetic Map X A1.3 NCBI cM Map X 16.2 NCBI
Usp11 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955516 841,114 - 857,322 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955516 840,708 - 858,201 (-) NCBI ChiLan1.0 ChiLan1.0
USP11 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 48,860,378 - 48,875,754 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 48,863,754 - 48,879,130 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 39,669,761 - 39,685,231 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 47,527,652 - 47,543,036 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 47,527,673 - 47,542,638 (+) Ensembl panpan1.1 panPan2
USP11 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 40,826,648 - 40,842,700 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 40,810,500 - 40,842,700 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 15,201,810 - 15,217,862 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 40,960,674 - 40,976,724 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 40,944,527 - 40,976,724 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 40,948,358 - 40,964,409 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 40,936,214 - 40,952,266 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 41,029,319 - 41,045,370 (+) NCBI UU_Cfam_GSD_1.0
Usp11 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 33,162,462 - 33,180,022 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936502 13,003,261 - 13,020,388 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936502 13,003,214 - 13,020,772 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP11 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 41,851,602 - 41,866,355 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 41,851,534 - 41,866,357 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 46,746,245 - 46,761,054 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP11 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 44,420,305 - 44,438,564 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 44,419,831 - 44,438,616 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666076 9,678,520 - 9,694,679 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp11
.
Predicted Target Of
Count of predictions: 480 Count of miRNA genes: 245 Interacting mature miRNAs: 293 Transcripts: ENSRNOT00000051956 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
70165 Bp64 Blood pressure QTL 64 5.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) X 1448129 31706553 Rat 731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat 70166 Bp65 Blood pressure QTL 65 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) X 1447972 11374346 Rat 634325 Bw13 Body weight QTL 13 0 body mass (VT:0001259) body weight (CMO:0000012) X 1447972 20991088 Rat
RH140271
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 1,473,358 - 1,473,553 (+) MAPPER mRatBN7.2 Rnor_6.0 X 1,687,830 - 1,688,024 NCBI Rnor6.0 Rnor_5.0 X 2,481,261 - 2,481,455 UniSTS Rnor5.0 RGSC_v3.4 X 12,890,525 - 12,890,719 UniSTS RGSC3.4 Celera X 2,037,491 - 2,037,685 UniSTS Cytogenetic Map X q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000051956 ⟹ ENSRNOP00000042897
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 1,473,350 - 1,489,520 (-) Ensembl Rnor_6.0 Ensembl X 1,687,811 - 1,704,033 (-) Ensembl
RefSeq Acc Id:
NM_001008861 ⟹ NP_001008861
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 4,026,865 - 4,043,036 (-) NCBI mRatBN7.2 X 1,473,349 - 1,489,520 (-) NCBI Rnor_6.0 X 1,687,820 - 1,703,991 (-) NCBI Rnor_5.0 X 2,481,251 - 2,497,422 (-) NCBI RGSC_v3.4 X 12,890,515 - 12,906,686 (-) RGD Celera X 2,037,481 - 2,053,652 (-) RGD
Sequence:
CGGACGGTGATGGCGGCGGTCGCAGCGGACCCAGCTGCAGCTGCCGTCCCGGCCTCTGCTGAGGACAGAGAGACACAGCCCGAGGCAATGCCAGACCTGGATCAACAGTGGCGCCAAATCGGGAATGG
hide sequence
RefSeq Acc Id:
NP_001008861 ⟸ NM_001008861
- UniProtKB:
F7FEA4 (UniProtKB/Swiss-Prot), Q0D2L8 (UniProtKB/Swiss-Prot), Q5D006 (UniProtKB/TrEMBL)
- Sequence:
MAAVAADPAAAAVPASAEDRETQPEAMPDLDQQWRQIGNGRERPLRAGESWFLVEKHWYKQWEAYVKGGDQDASTFPGSINNSGLFEDQISWHLRERLVEGDDYVLLPAPAWNYLVSWYGLKDDQPPI
hide sequence
Ensembl Acc Id:
ENSRNOP00000042897 ⟸ ENSRNOT00000051956
RGD ID: 13701694 Promoter ID: EPDNEW_R12218 Type: single initiation site Name: Usp11_1 Description: ubiquitin specific peptidase 11 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 1,704,016 - 1,704,076 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Usp11
ubiquitin specific peptidase 11
Usp11
ubiquitin specific protease 11
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Usp11
ubiquitin specific protease 11
Symbol and Name status set to approved
1299863 APPROVED
2005-02-14
Usp11
ubiquitin specific protease 11
Symbol and Name status set to provisional
70820 PROVISIONAL
